Table of Contents
Committees 2
Welcoming Address 3
Acknowledgements 5
Floor Plans 6
Programme By Day Monday, August 25, 2008 8 Tuesday, August 26, 2008 9 Wednesday, August 27, 2008 10 Thursday, August 28, 2008 11 Friday, August 29, 2008 12
Opening / Closing Ceremony 13
Scientific programme Symposia description 14 Symposia programme 24 3RVWHUV±JHQHUDOLQIRDQGDUHDV Poster Session 1 (Monday, 25 August, 2008) 54 Poster Session 2 (Tuesday, August 26, 2008) 60 Poster Session 3 (Thursday, August 28, 2008) 66 Poster Session 4 (Friday, August 29, 2008) 72 Poster Awards 78 Workshops 79
Business Meetings 91
Excursions 92
Supporting Programme 93
Guidelines and Information for Speakers, Chairpersons, and Poster Presenters 94
Congress Information 95
Registration Fees 97
General Information 98
Social Events 100
City & Subway Map 101
Exhibition / Exhibitors 102
Author Index 103 Committees
Congress President Winfried E.H. Blum University of Natural Resources and Applied Life Sciences (BOKU), Vienna, Austria Tel.: (+43-1) 47654-3101; Fax: (+43-1) 47654-3130 E-mail: [email protected]
EUROSOIL 2008 is organised in co-operation with the national soil science societies of:
Austria Croatia Czech Republic Hungary Slovakia Slovenia Switzerland
Organising Committee
Winfried E.H. Blum, Austria Harald Kasamas, Austria Andreas Baumgarten, Austria Ernst Leitgeb, Austria Lubos Boruvka, Czech Republic Erika Micheli, Hungary Michael Englisch, Austria Luca Montanarella, Italy Volker Franzius, Germany Alfred Pehamberger, Austria Wolfgang Friesl, Austria Tomaz Prus, Slovenia Thorsten Gaertig, Germany Jaroslava Sobocka, Slovak Republic Martin H. Gerzabek, Austria Robert Stich, Austria Sigbert Huber, Austria Silvia Tobias, Switzerland Stjepan Husnjak, Croatia
Scientific Committee
Winfried E.H. Blum, Austria Franc Lobnik, Slovenia Ferdo Basic, Croatia Luca Montanarella, Italy Pavol Bielek, Slovakia Rainer Schulin, Switzerland Martin H. Gerzabek, Austria György Varallyay, Hungary Josef Kozak, Czech Republic
Conference Organisation, Abstract Management, Sponsoring
Vienna Medical Academy Alser Strasse 4, 1090 Vienna, Austria Tel.: (+43-1) 405 1383-16; Fax: (+43-1) 407 8274 E-mail: [email protected]
Exhibition Management Hotel Accomodation
Medizinische Ausstellungs- und Mondial Congress & Events Werbegesellschaft MAW Operngasse 20b Freyung 6 1040 Vienna A-1010 Vienna, Austria Tel: 0043 1 58804-0 Phone: +43 1 536 63 48 Fax: 0043 1 58804-185 Fax: +43 1 535 60 16 Email: [email protected] E-mail: [email protected]
Congress Venue
Technical University Vienna Karlsplatz 13 1040 Vienna, Austria Welcoming Address
It is my pleasure to welcome you to EUROSOIL 2008 on behalf of the Organising Committee. This 3rd International EUROSOIL Congress, after EUROSOIL 2000 in Reading, UK and EUROSOIL 2004 in, Freiburg Germany, is organised in Vienna/Austria by the national soil science societies of Austria, Croatia, the Czech Republic, Hungary, Slovakia, Slovenia and Switzerland, under the umbrella of the European Confederation of Soil Science Societies (ECSSS), a regional organisation within the International Union of Soil Sciences (IUSS), which was founded during the EUROSOIL Congress 2004 in Freiburg, Germany.
This Congress comprises 31 symposia, 13 workshops, 2 pre- and 1 post-congress excursion as well as different social events. A special challenge for this Congress is to keep momentum in the European development of soil protection, including the establishment of legal instruments in the form of a European framework directive for soil protection, similar to existing ones, such as for example the water framework directive.
Moreover, this international congress is held at a time of unprecedented changes in social and economic developments, in view of the current shortage of food, with a worldwide rise of food prices and, in parallel, the production of biofuels, not only for saving fossil energy, but also with the intention to combat climate DQGJOREDOFKDQJH±$WWKHPRPHQWSROLWLFDOO\VRFLDOO\DQG economically driven processes are faster than science can follow by steering or judging the effects of technical and economic developments, especially regarding the impacts of biofuel production on soils and the HQYLURQPHQW±0RUHRYHULQYLHZRIWKH tremendously increasing prices for energy and concomitantly the increasing costs for all kinds of soil and land uses through the price increase for fertilisers and energy in general, the question arises: What is the task of soil science within the knowledge- based bioeconomy, as well as in environmental protection?
There are new challenges ahead and I am convinced that this Congress will contribute to new concepts and activities, in order to cope with current and future tasks. Finally, I should like to thank all the members of the different Committees and the congress organisers, especially Mrs. Miriam Uebelhör, for their thoughtful and effective co-operation in the preparation of this international congress.
I wish you all a very pleasant stay in Vienna and a successful and interesting Congress, which should bring new highlights, information and ideas to all of you.
Winfried E.H. Blum Congress President Travel in comfort with us to your meeting in Austria.
Information and booking at www.austrian.com, in our sales offi ces or at your travel agency. Earn miles with Miles&More. www.austrian.com Acknowledgements
The EUROSOIL 2008 Conference gratefully acknowledges the support of the following institutions, companies and organisations (list correct as per date of printing):
Federal Ministry of Agriculture, Forestry, Environment and Water Management Stubenring 1 A-1010 Vienna
Vienna Convention Bureau Obere Augartenstrasse 40 A-1020 Vienna www.vienna.convention.at Floor plans Floor plans 3URJUDPPHE\GD\±0RQGD\$XJXVW soils Saal Böckl through Events or duration of of dynamic soil change innovations soil changes processes in methodological Identification of influence cause Characterisation different environment cutting-edge Rhizosphere Rhizosphere processes in methodology environments modelling and The rhizosphere: a complex micro- of soil of soil constituens constituens reconstruction Environmental Memory function Memory function HS 7 HS 17 HS 14A materials transport, transport, detection, detection, evaluation evaluation application of accumulation, bioavailability, Contaminants - &RQWDPLQDQWV± &RQWDPLQDQWV± Theory and Water Soil and Water Soil and Water Modelling of Soil Measurements in Coffee Break Coffee Break Lunch Break / Poster Session 1 Monday Opening Ceremony (Audi Max, Freihaus) HS 13 HS 6 lectures and Food Security - and Food Security - and Food Security - Modelling Symposia / Sessions August 25, 2008 Introductory Experiments Human Health Human Health Human Health Soil Quality on Soil Quality on Soil Quality on The Influence of The Influence of The Influence of Soil Classification Soil Classification Soil Classification HS 11 HS 18 Microbial soil biology by microbial communities New concepts Decomposition communities in time and space and methods in saal Fest Soil Fertility Nitrogen, Part I Nitrogen, Part II Sustainability and S01 S28 S08S01 S20 S28 S27 S08 S06S01 S20 S11 S28 S27 S25 S08 S06 S23 S20 S11 S30 S27 S25 S06 S23 S11 S30 S25 S23 S30 HS 8 Matter Matter - Matter - Dynamics Dynamics Soil Organic Soil Organic Soil Organic A B C 09:00 10:30 11:30 12:30 14:00 16:00 16:30 18:00 3URJUDPPHE\GD\±7XHVGD\$XJXVW S26 S26 Saal Böckl in DSM Mapping DEM/DTM Digital Soil Applications Pedometrics Methods and Pedometrical Exploitation in Approaches of Other Auxiliary Geophysics and Data Exploitation A A History Studies Society's Society's Local and Conceptual conservation conservation Issues in Soil Regional Case demands for and demands for and perception of soil perception of soil Practical mitigation Retention and The nano scale experiences and soil development HS 7 HS 17 HS 14A Natural Natural materials / Attenuation Attenuation application of accumulation, bioavailability, Contaminants - Remediation and Remediation and Phytoremediation Metal behaviour Phytoremediation Soils of cold regions Andosols and forming factor and Sediments Humans as soil Soil Mineralogy Soil Stratification mountainous and Coffee Break Coffee Break Lunch Break / Poster Session 2 Tuesday HS 13 HS 6 erosion erosion Symposia / Sessions August 26, 2008 soil erosion soil erosion Quantitative Modelling soil Assessing soil assessment of Measurements of threats specific soil soil indicator development Indicators for Challenges for New approaches for soil indicators Soil indicator sets Soil and HS 11 HS 18 change function biomass microbial soil fauna Ecological The nature of environmental engineering by microorganisms Soil biota and soil saal Fest Fertility Climate, Soil Fertility Soil Fertility Chemical and Biological Soil Nutrients, Soils Fertilization and Phosphorus and and Environment S01 S28 S08S01 S16 S28 S03S01 S08 S19 S28 S16 S11 S08 S03S01 S13 S16 S19 S28 S21 S03 S11 S08 S19 S13 S16 S11 S21 S03 S13 S19 S21B S11 S26 S13 S21B S26 HS 8 Matter - Matter - Matter - Matter - Properties Properties Properties Stabilization Soil Organic Soil Organic Soil Organic Soil Organic F D E G 08:30 10:30 11:00 12:30 14:00 16:00 16:30 18:00 3URJUDPPHE\GD\±:HGQHVGD\$XJXVW W8 W8 Saal W10 Böckl W13 HS 7 HS 17 HS 14A W12 W11 W11 W7 W7 W13 W1 Lunch Break Coffee Break Coffee Break W5 W5 W5 W5 Workshops /XQFK HS 13 HS 6 &RIIHH%UHDN &RIIHH%UHDN Wednesday August 27, 2008 W4 W4 W4 W4 &RIIHH%UHDN W2 W2 W2 HS 11 HS 18 W9 W9 W9 saal Fest W3 W3 W9 W6 W6 W2 W1 W12 W10 HS 8 08:00 08:30 10:30 11:00 12:30 14:00 16:00 16:30 18:00 3URJUDPPHE\GD\±7KXUVGD\$XJXVW S04 Saal Böckl effects systems modelling properties on physical Rheological Deformation Stress strain as structured processes and soil deformation Consequences of processes in soils Rates of Soil Body Processes Pedogenic Soils and GMOs Soils and GMOs Pedogenesis and Soil Systems and Soils Specific Urban vs Functions Quality and Urban Soils Urban Soils properties of Anthropogenic Contamination Urban Soils, their HS 7 HS 17 HS 14A Change Change Change Change Soils and Climate Soils and Climate Soils and Climate Soils and Climate Carbon nutrition nutrition Interactions - impacts on - impacts on Vegetation - Soil Forest operations Forest operations Coffee Break Coffee Break Lunch Break / Poster Session 3 Thursday soils HS 13 HS 6 regimes I Symposia / Sessions regimes II August 28, 2008 Soil physics Soil moisture Soil moisture Moisture flow in systems systems systems from soil from soil monitoring monitoring monitoring national soil general issues Soil monitoring Results coming Results coming Development of Use Land HS 11 HS 18 Factors Management Soil Protection Influencing Land Soil Degradation saal Fest Wastes Organic Pollutants Conditions Liming and Potassium, Inorganic and Biodegradation Unfavorable Soil and Bioavailability S01 S28 S17S01 S10 S28 S07S01 S17 S09 S28 S10 S02 S17 S07S01 S18 S10 S09 S28 S24 S07 S02 S17 S04 S09 S18 S10 S02 S24 S07 S18 S04 S09 S29 S02 S04 S18 S29 HS 8 Change Changes and Stock Soil Organic Soil Organic Soil Organic Soil Organic Matter - Stocks Matter - Climate Matter - Land use Matter - Modelling I 18:00 H J K 08:30 10:30 11:00 12:30 14:00 16:00 16:30 3URJUDPPHE\GD\±)ULGD\$XJXVW Saal Böckl HS 7 HS 17 HS 14A and policy and policy Contaminated Contaminated Soils: concepts Soils: concepts developement I Management of Management of developement II soil to Society to virtuality Awakening and raising conciousness Connecting Soil awareness about SOIL: from reality Closing (Festsaal) Ceremony Coffee Break Coffee Break Lunch Break / Friday Poster Session 4 HS 13 HS 6 Symposia / Sessions August 29, 2008 Water relations Biogeochemistry Irrigation Water relations II processes hydrological relationships Soil-water-plant Climate and soil Soil HS 11 HS 18 Processes Desertification Desertification and the Means Assessment of Mechanisms of and Salinisation and Salinisation Overview of Soil for Recuperation Soil Degradation saal Fest problems problems soil related soil related State of Art systems - the Application of Application of Soil Information GIS on solving of GIS on solving of S14 S15 S05S14 S07 S15 S09S14 S05 S22 S15 S07 S12 S05 S09 S07 S22 S09 S12 S22 HS 8 Interactions I Interactions II Interactions III Organo-Mineral Organo-Mineral Organo-Mineral L M N 08:30 10:30 11:00 12:30 14:00 16:00 17:00 18:00 Opening Ceremony
Auditorium of the TU Vienna, Getreidemarkt 9 0RQGD\$XJXVW±KUV
Welcome by Winfried E.H. Blum on behalf of the Organising Committee
Greeting address by Niek de Wit, on behalf of Commissioner Stavros Dimas Member of the European Commission
Greeting address by Edith Klauser Director General of the Austrian Ministry of Agriculture, Forestry, Environment and Water Resources
Greeting address by Stephen Nortcliff Secretary-General of the International Union of Soil Sciences
Lecture by Prof. Daniel Hillel: "Soil and the Evolution of Cultures"
Information about the Congress and its organisation by Winfried E.H. Blum
Closing Ceremony
Festsaal )ULGD\$XJXVW±KUV
w 3UHVHQWDWLRQRI3RVWHU$ZDUGVDQGWKH³6SULQJHU-RXUQDO3RVWHU$ZDUG´WRWKHZLQQHUV
w Announcement of the new president and vice-president of the European Confederation of Soil Science Societies (ECSSS), of the host country and the venue of the EUROSOIL 2012 congress
w Summarising remarks and farewell by Winfried E.H. Blum Symposia
Symposium Title Convenor Co-Convenor(s) Day Monday S01 Soil Organic Matter Frank Hagedorn, Switzerland Heike Knicker, Germany Tuesday Thursday Natasa Jaecks Vidic, S02 Soils and Climate Change Viliam Pichler, Slovakia Thursday Slovenia Lillian Oygarden, Norway S03 Soil Erosion Peter László, Hungary Tuesday José Luis Rubio, Spain Ferdo Basic, Croatia S04 Soil Compaction Marta Birkas, Hungary Thursday Rainer Horn, Germany S05 Soil Desertification and Salinisation Tibor Tóth, Hungary Jozef Deckers, Belgium Friday Svatopluk Matula, Czech S06 Soil and Water Theory Monday Republic Thursday S07 Soil and Water - Practical Applications György Várallyay, Hungary Eduard Klaghofer, Austria Friday Sophie Zechmeister- Monday S08 Soil Ecology - Soil as Living Space Ellen Kandeler, Germany Boltenstern, Austria Tuesday Jiri Kulhavy, Czech Republic Thursday S09 Forest Management and Soils Klaus Katzensteiner, Austria Ernst Leitgeb, Austria Friday Judit Berényi Üveges, S10 Advances in Soil Monitoring Josef Kobza, Slovakia Thursday Hungary Management of Contaminated Soils I: Monday S11 Volker Franzius, Germany Martin Schamann, Austria practical applications Tuesday Management of Contaminated Soils II: Joop Vegter, The S12 Harald Kasamas, Austria Friday concepts and policy developement Netherlands S13 Buffering Function of Soils Martin Gerzabek, Austria Alessandro Piccolo, Italy Tuesday Ruben Kretzschmar, Willem Van Riemsdijk, The S14 Organo-mineral Interactions Friday Switzerland Netherlands Soil Information Systems, Regionalisation Michael Englisch, Austria S15 Josef Kozak, Czech Republic Friday of Soil Data including Soil Associations Christine Le-Bas, France Robert Jones, United Kingdom S16 Soil Indicators Sigbert Huber, Austria Tuesday Jens Utermann, Germany Stephen Nortcliff, United S17 Land Use and Soil Protection Franc Lobnik, Slovenia Thursday Kingdom Wolfgang Burghardt, S18 Urban and Anthropogenic Soils Jaroslava Sobocka, Slovakia Thursday Germany Soil Forming Processes and Soil S19 Tamas Szegi, Hungary Peter Schad, Germany Tuesday Morphology S20 Soil Classification Erika Micheli, Hungary Alfred Pehamberger, Austria Monday Society's Demands for and Perceptions of S21A Silvia Tobias, Switzerland Katharina Helming, Germany Tuesday Soil Conservation S21B Soils and Societies in History Verena Winiwarter, Austria Hans-Rudolf Bork, Germany Tuesday Education in Soil Science and Raising S22 Monika Tulipan, Austria Mireille Dosso, France Friday Public Awareness S23 Rhizosphere Processes Walter Wenzel, Austria Hojka Kraigher, Slovenia Monday
S24 Soils and GMOs Angela Sessitsch, Austria Kornelia Smalla, Germany Thursday
S25 Memory Function of Recent and Paleosoils György Füleky, Hungary Adrijan Kosir, Slovenia Monday Lubos Boruvka, Czech S26 Pedometrics and Digital Soil Mapping Endre Dobos, Hungary Tuesday Republic The Influence of Soil Quality on Human Andreas Baumgarten, Wolfgang Friesl-Hanl, Austria S27 Monday Health and Food Security Austria Eiliv Steinnes, Norway Monday S28 Soil Fertility and Environment Milan Mesic, Croatia Rok Mihelic, Slovenia Tuesday Thursday Time scales of pedogenic processes for S29 Victor Targulian, Russia Attila Barci, Hungary Thursday predicting soil changes in time Micromorphological and mineralogical S30 features (evidence) of soil environmental Karl Stahr, Germany Monday change 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
SYMPOSIUM 1 - Soil organic matter Convenor: Frank Hagedorn, Switzerland Co-convenor: Heike Knicker, Germany Keynote speaker: Bernd Marschner, Germany
Soil organic matter (SOM) plays a central role in the global carbon cycle and influences all soil functions. During the last years new tools have been developed to address important research questions: (1) How does OM become stabilized in soils? (2) What are the feedbacks between global warming and SOM? (3) How can we manage the functional role of SOM? (4) And how can we link modelling and analyses of SOM to quantify SOM cycling? We invite contributions using innovative methods to elucidate the chemical structure of SOM, creative experimental approaches to determine the functional role of SOM and new developments of models to estimate SOM turnover.
6<0326,806RLOVDQGFOLPDWHFKDQJH Convenor: Natasa Jaecks Vidic, University Ljubljana, Slovenia Co-convenor: Viliam Pichler, Tech. Univ. Zvolen, Slovakia Keynote speaker: Anthony Dexter, France
Soils and agriculture both share in greenhouse gas production effecting global terrestrial systems on the contrary to forest and water supply which contribute to maintenance of ones. Identification and prediction of climate change impacts on soil resources and their functions are referred to production and ecological priorities. It assumes definition of pedogenetic and anthropogenic processes in soils to be expected in changed climate conditions including degradation impact assessment. I.e. decrease of organic matter in soil, changed soil moisture conditions, possible intensive erosion, accelerated mineralization and nutrient regime, salinization in aspect of expected drought, etc. Adaptable measurement proposals are inevitable to consider. As general measure against negative impacts will consists in: a) increase of carbon sequestration in soil, b) stabile organic matter formation, c) construction of multifunctional and ecologically stabilized landscape including anti-erosion treatments. Acceptable are contribution with innovative concepts and methods of technological measurement in soil water management, soil fertility conservation, soil erosion and/or salinization mitigation.
6<0326,806RLOHURVLRQ Convenor: Péter László, RISSAC, Hungary Co-Convenors: Lilian Oygarden, Norway; José Luis Rubio, Spain Keynote speaker: Peter Strauss, Austria
Soil erosion is a natural process, occurring over geological time. Most concerns about erosion are related to accelerated erosion, where the natural rate has been significantly increased by human activities such as changes in land cover and management. Soil erosion is among the major environmental threats related to agricultural land use in Europe. The general objective of this Symposium is to evaluate the state of the art in research in the field of erosion by water in Europe. to allow scientists to meet and exchange ideas on related topics and to initiate further collaborations. The main themes involved are: (i) Measurement; (ii) Processes; (iii) Erosion rates; (iv) Erosion factors; (v) Role of vegetation cover and management;; (vi) Modelling; (vii) Spatial and temporal variability; (viii) Digital mapping and upscaling. A special attention will be paid to the development of monitoring studies based on integrated field and modelling approaches and scenario analyses for potential effects of climate changes.
6<0326,806RLOFRPSDFWLRQ Convernor: Márta Birkás, Hungary Co-Convenors: Ferdo Basic, Croatia, Rainer Horn, Germany Keynote speaker: Berndt-Michael Wilke, Germany
Compaction is one of the most important soil quality indicators reflecting the potential for environmental damage and the physical state of the soil resources. The symposium will discuss the origin, risks, factors, and prevention possibilities of both natural and human induced processes. Papers and posters on the following subjects are welcome: (1) Subsoil compaction monitoring and measuring on the fields. (2) Tillage consequences. (3) Environmental consequences. (4) Impacts on soil biological activity. (5) Impacts on soil water management (drought sensitivity, water-logging). (6) Prevention of farming losses. (7) New challenges in subsoil compaction research and assessment. 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,806RLOGHVHUWLILFDWLRQDQGVDOLQLVDWLRQ Convenor: Tibor Tóth, Hungary Co-convenor: Jozef Deckers, Belgium Keynote speaker: José Alvarez, Spain
Soil desertification and salinization affect 3.6 billion and 0.83 billion hectares worldwide, respectively. Although these are natural degradation processes, the human-induced desertification and salinization cause large damage to the economy. The symposium will focus on the spatial and temporal assessment of these degradations, the mechanisms by which desertification and salinization spread, the management of affected areas, remediation and strategies for minimizing degradation. Modeling of desertification and salinization/sodification/alkalization as the basis of management decisions, especially in irrigated agriculture will be discussed. Off-site effects of the degradation and the societal consequences will be integral part of the work of the symposium. Questions concerning native vegetation and fauna as well as protection of native desert and saline ecosystems will also be included.
6<0326,806RLODQGZDWHUWKHRU\ Convenor: Svatopluk Matula, Czech Republic Keynote speaker: Svatopluk Matula, Czech Republic
This symposium will discuss mainly the following topics: New methods applicable to describe different transport of water and/or liquids in porous systems of soils; 1) Advances in methods of various soil hydrophysical properties determination (soil water content, soil water potential, hydraulic conductivity); 2) Advances in methods of other soil properties determination (electrical conductivity, soil permitivity, soil dielectric properties, ...); 3) Flow and transport processes in different porous media (fractures porous media, preferential flow); 4) Soil structure and its relation to fractured porous media and preferential flow; 5) Applications and interpretations of soil and water relationship theory, computer modelling, soil properties determination and measurement techniques (environmental applications, natural resources protection, precision agriculture etc.).
6<0326,806RLODQGZDWHU±SUDFWLFDODSSOLFDWLRQV Convenor: György Várallyay, Hungary Co-convenor: Eduard Klaghofer, Austria Keynote speaker: Rainer Horn, Germany
Water, as reactant, solvent and transporting agent plays an important, sometimes decisive role in the mass and energy regimes of soils, in the transport and transformation of various substances. Soil and land-site characteristics * determine the moisture supply of plants (natural vegetation and cultivated crops); * are responsible for different extreme moisture situatiRQV IORRGLQJZDWHUORJJLQJRYHUPRLVWHQLQJ±GURXJKW DQG * influence the air and heat regimes of soils; the soil biota; the biogeochemical processes of plant nutrients and potentially harmful soil pollutants. In the Symposium the practical aspects of soil moisture regime will be discussed. Beginning from the practical application of theoretical findings, followed by new measurement, computation and modelling techniques; the water relations of various soil degradation processes and biogeochemical cycles of elements cycles for their efficient control. Special attention will be paid to WKHÄHDUO\DODUP´V\VWHPVIRUHFDVWDQGSURJQRVLVWRJLYHVFLentifically based possibilities for the prevention of the unfavourable processes and their ecological, economical and social consequences. The impacts of potential climate changes on the soil hydrological processes will also be discussed (based on scenario analysis).
6<0326,806RLOHFRORJ\±VRLODVDOLYLQJVSDFH
In co-operation with the Research Focus "Functional Ecology and Global Change", Faculty of Life Sciences, University of Vienna Convenor: Sophie Zechmeister-Boltenstern, Austria Co-convenor: Ellen Kandeler, Germany Keynote speaker: Liliane Ruess, Germany
Life on Earth relies on life in earth, a habitat resembling a labyrinth. The structural organisation in a soil is the basis for the development of a specific soil community. The heterogeneity of microbial distribution and life strategy play a crucial role in terrestrial food web organization, but very little is known about the spatial organization of soil microorganisms across scales that are relevant both to microbial function and to field-based processes. At the molecular level, the topics of interest are transport of 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD substrates within the physical soil environment and enzymological characteristics of degradation; at the organismal level, the focus is on functional gene analyses, regulation of enzyme expression and growth kinetics, whereas at the community level, research concentrates on metabolism, microbial successions and competition between microbial and faunal communities. Soil physical and biochemical techniques, isotopic studies and new molecular biology techniques are rapidly evolving disciplines that hold promise to provide new insights into the complex interactions of microorganisms and soil. Our objective is to improve the interface among researchers working in various fields of soil biology in order to deepen our understanding of soil resilience and ecosystem sustainability.
6<0326,80)RUHVWPDQDJHPHQWDQGVRLOV Convenor: Klaus Katzensteiner, Austria Co-convenors: Ernst Leitgeb, Austria; Jiri Kulhavy, Czech Republic Keynote speakers: Helga Van Miegroet, United States; Klaus von Wilpert, Germany; Jan Cermak, Czech Republic
The symposium will be a forum to present most recent advancements in research on forest management impacts on soil. This symposium will discuss mainly the following topics:
1. Plant- soil feedback: a. Vegetation dynamics and soil b. Tree species and soil c. Stand treatment and soil 2. Forest soil management in the context of global climate change 3. Soil restoration
With respect to: » Soil physical properties, soil water and soil aeration » Humus dynamics and carbon sequestration » Soil chemical processes » Nutrient cycling
6<0326,80$GYDQFHVLQVRLOPRQLWRULQJ Convenor: Judit Berényi Üveges, Hungary Co-convenor: Josef Kobza, Slovakia Keynote speaker: Dominique Arrouays, France
Most societies realized the problems of different types of soil degradation. To gain information on the extent of the problem and to establish a basis for developing soil conservation policies information is needed on the soil status and its changes over time. This symposium emphasizes the role of soil monitoring in delivering information on changing soil parameters, important for soil functions, such as nutrient status, organic matter, biodiversity, heavy metal contamination, etc., and the need for harmonised methodologies to monitor changes in soil quality in order to protect soil resources and to improve comparability of soil data important for policy development. The main focus of the symposium is the methods suitable for following soil degradation processes and the results of the combat against them, but also other soil monitoring issues are welcome.
SYMPOSIUM 11 - Management of contaminDWHGVRLOVSUDFWLFDODSSOLFDWLRQV Convenor: Volker Franzius, Germany Co-convenor: Martin Schamann, Austria Keynote speaker: Jan Skowronek, Poland
The European Environment Agency estimates the number of contaminated sites in Europe with app. 300.000 either industrial sites or landfills or other local sources posing significant risks to human health or to the environment. Such chemical contamination can be a major stumbling block hindering sustainable development. A total clean-up of these sites is neither economically nor technically feasible. Sustainable approaches are required how to tackle historic contamination by taking into FRQVLGHUDWLRQPDLQHOHPHQWVRID³ULVNEDVHGODQGPDQDJHPHQW´VXFKDVPDNLQJODQGILWIRUXVHE\FRQVLGHULQJLQWKHVDPH time the protection of the environment and long term care of measures undertaken. We especially seek contributions with innovative risk based approaches for the management of historically contaminated soils, considering aspects like risk reduction, natural attenuation, landuse requirements, managing uncertainties, costs and stakeholder involvement. The symposium will provide a platform for both the Association of Engineers for Contaminated Sites (ITVA) and the Austrian Association for the Management of Contaminated Sites (ÖVA). 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,800DQDJHPHQWRIFRQWDPLQDWHGVRLOVFRQFHSWVDQGSROLF\GHYHORSPHQW Convenor: Harald Kasamas, Austria Co-convenor: Joop Vegter, Netherlands Keynote speaker: Joop Vegter, Netherlands
The European Environment Agency estimates the number of contaminated sites in EU15 with 300.000 to 1.5 million, either industrial sites or landfills or other local sources posing significant risks to human health or to the environment. Such chemical contamination can be a major stumbling block hindering sustainable development. A total clean-up of these sites is neither economically nor technically feasible. Sustainable approaches are required how to tackle historic contamination by taking into FRQVLGHUDWLRQPDLQHOHPHQWVRID³ULVNEDVHGODQGPDQDJHPHQW´VXFKDVULVNUHGXFWLRQODQGXVHUHODWHGUHTXLUHPHQWVPDNLQJ use of natural capacities in soil and grRXQGZDWHU FRVWV VWDNHKROGHU LQYROYHPHQW PDQDJLQJ XQFHUWDLQWLHV DQG PDQDJHPHQW constraints and influences. We especially seek contributions with innovative risk based approaches for the management of historically contaminated soils.
6<0326,80%XIIHULQJIXQFWLRQVRIVRLOV In co-operation with IUSS Convenor: Martin H. Gerzabek, Austria Co-convenor: Alessandro Piccolo, Italy Keynote speaker: Kai-Uwe Totsche, Germany
Among the soil functions, both the retention of pollutants in soil profiles and the resilience against acid deposits are of high importance for the sustainable use of soil resources. Scientific questions concerning WKHVHIXQFWLRQVDUHPDQ\IROGHJ L :Kich specific and unspecific interactions between pollutants and the soil matrix are mainly governing their short-, medium- and long- WHUPEHKDYLRXU" LL +RZGRHVODQGXVHDQGPDQDJHPHQWLQIOXHQFHWKHUHWHQWLRQSURSHUWLHVRIVRLOSURILOHV" LLL :KLFKLQGLFDWRrs are appropriate to predict the possible behaviour of pollutants in GLIIHUHQW VRLOV" LY +RZ LV LW IHDVDEOH WR LPSURYH PRGHOLQJ approaches for predictions? These and other related questions should be addressed in symposium 13. We especially seek contributions with innovative concepts and methods, both experimentally and in modelling.
6<0326,802UJDQRPLQHUDOLQWHUDFWLRQV In cooperation with IUSS
Convenor: Ruben Kretzschmar, Switzerland Co-convenor: Willem H. van Riemsdijk, Netherlands Keynote speaker: Klaus Kaiser, Germany
Soil minerals have reactive surfaces which interact with natural organic substances, such as humic and fulvic acids, proteins, polysaccharides, surfactants, and organic acids. Organic molecules adsorbed to mineral surfaces strongly alter the surface charge and adsorption of ions to the mineral surface. Understanding the humic-mineral interaction is also a crucial factor with respect to soil structure and it also affects the bioavailability of many elements. Mineral weathering and crystal growth processes are also strongly influenced by adsorbed organic molecules. Organic substances adsorbed to mineral surfaces are less easily degraded by microorganisms, which has important implications for soil carbon turnover and the long-term fate of organic compounds in soils. We especially seek contributions addressing the chemical processes controlling interactions between organic substances, mineral surfaces and ions using innovative experimental and theoretical approaches.
6<0326,806RLOLQIRUPDWLRQV\VWHPVUHJLRQDOL]DWLRQRIVRLOGDWDLQFOXGLQJVRLODVVRFLDWLRQV Convenor: Josef Kozak, Czech Republic Co-convenors: Michael Englisch, Austria; Christine Le Bas, France Keynote speaker: Rainer Baritz, Germany
The symposium will cover progress in the development of soil GIS as well as in its practical application. It will also cover the progress in mapping of soil regions and soil associations, including development of their clasclassification. The following topics ZLOOEHGLVFXVVHG - State of the art of soil GIS in Europe 1HZGHYHORSPHQWLQFRPELQDWLRQRIVRLODQGWHUUDLQFRYHU 627(5 LQWKH*,6V\VWHP - the use of soil GIS in description and evaluation of ecological functions of soil as well as in planning of proper land use 7KHXVHRI*,6IRUPDSSLQJRIVRLODVVRFLDWLRQV GLJLWDOPDSSLQJ - Classification of soil associations - The combination soil GIS mathematical models 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,806RLOLQGLFDWRUV Convenor: Sigbert Huber, Austria Co-convenors: Jens Utermann, Germany; Robert Jones, United Kingdom Keynote speaker: Nicolaas De Witt, Belgium
Soil indicators have been developed at a national and international level for many years, to gain information about soil quality and soil processes. Some of the indicators are used in environmental assessment and reporting. For the characterisation of soils and the monitoring of soil threats in Europe, a great number of indicators are needed. Experiences regarding the implementation of indicators as well as proposals for new indicators should be provided. Questions that seem worthwhile to be considered and discussed are:
- How can different parameters be aggregated to an indicator? - What are the criteria for the selection of soil indicators for environmental reporting? - How can thresholds for soil indicators be defined? - Which approaches exist to cope with the scale problem of soil variability and validity of indicator results? - Which data and research needs should be met until 2012 and beyond?
Best practice examples of soil indicators at different scales as well as innovative concepts and methods for answering the questions raised in this context, are looked for. A panel discussion on needs for further indicator development towards optimal soil information will conclude the symposium.
6<0326,80/DQGXVHDQGVRLOSURWHFWLRQ Convenor: Franc Lobnik, Slovenia Co-convenor: Stephen Nortcliff, United Kingdom Keynote speaker: Luca Montanarella, Italy
Soil Protection has increasingly become a focus for environmental policy both nationally and across Europe. Intrinsically linked to soil protection are decisions concerning the appropriate land use in a particular environmental context. Many of the current threats to soil arise because decisions on land use are inappropriate resulting in environmental imbalance. Whilst the soil system is robust and may withstand these pressures, if the nature and potential impacts of land use generated pressures on the soil system are not fully understood the consequence may be the degradation of the soil and in extreme cases soil loss. This symposium will seek to consider the relationships between land use decisions and soil protection strategies and consider how to ensure that land use decisions are appropriate to the soil and environmental conditions at a site.
6<0326,808UEDQDQGDQWKURSRJHQLFVRLOV Convenor: Jaroslava Sobocka, Slovakia Co-convenor: Wolfgang Burghardt, Germany Keynote speakers: Wolfgang Burghardt, Germany; Andreas Lehmann, Germany
There are invited contributions involving comprehensive understanding of urban soils and anthropogenic soils (Technosols) in the context of specific use of urban, industrial, traffic, mining and military areas with special focus to: a) physical-chemical transformation processes, b) chemical and mineralogical speciation of elements, c) microbial activity, and d) soil contact with ground water table. Quality of urban soils assessment in aspect of specific threshold values of noxious substances (heavy metals, organic pollutants) typical for urban areas and other characteristics (special physical properties, PM10, pathogenic RUJDQLVPV « 9HU\ LPSRUWDQW LV IRFXV RQ LPSOHPHQWDWLRQ RI innovative and cost-effective field measurement techniques for urban soil quality assessment. We especially appreciate contributions with innovative technology and methodology, both experimentally and modelling. Also development of future strategies in urban soil science research is appropriate.
6<0326,806RLOIRUPLQJSURFHVVHVDQGVRLOPRUSKRORJ\ Convernor: Tamas Szegi, Hungary Co-Convenor: Peter Schad, Germany Keynote speaker: Reinhold Jahn, Germany
Detection and prediction of changes in soils are fundamental in understanding and managing soils within ecosystems. Modern studies of soil genesis provided information on reversible and irreversible changes and are helpful guidelines in sustainable soil and land use planning. The symposium will discuss the traditional and the state-of-the-art methods of observing, measuring and quantifying soil formation processes. Special attention will be given to human impacts on soil genesis. Papers and posters on application of new methodologies (geostatistics, mineralogy etc.) are also welcome. 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,806RLOFODVVLILFDWLRQ Convenor: Erika Michéli, Hungary Co-Convenors: Alfred Pehamberger, Austria Keynote Speaker: Otto Spaargaren, Netherlands
Soil classification as a result of human thinking is reflecting the state of knowledge and the needs of the society. The symposium will discuss the demands of modern soil survey and mapping procedures and the recent developments in soil classification systems. Papers and posters on general principles and on the experiences with national soil classification systems as well on the official global correlation scheme, the World Reference Base for Soil Resources (WRB) are welcome.
6<0326,80$6RFLHW\ VGHPDQGVIRUDQGSHUFHSWLRQVRIVRLOFRQVHUYDWLRQ Convenor: Silvia Tobias, Switzerland Co-convenor: Katharina Helming, Germany Keynote Speaker: Tomas Ratinger, Spain
Soil is the basis for and strongly influenced by human land use. Socio-economic changes, new demands on land use and soil functions and technical progress entail new requirements and impacts on the soil ecosystem. This symposium addresses the relationship between human being and soil with a strong emphasis on interdisciplinary papers. We particularly focus on the following aspects: Changing societal demands on soil with socio-economic changes (including demographic changes): ± +LVWRU\RIODQGXVHDQGPDQDJHPHQWDQWKURSRJHQLFFKDQJHVLQVRLOHFRV\VWHPV QDWXUDO UHJHQeration of disturbed soils. ± 2SSRUWXQLWLHVDQGWKUHDWVIRUVRLOHFRV\VWHPVGXHWRODQGXVHFKDQJHDQGODQGVFDSHGHVLJQODQGDQGVRLOUHVWRUDWLRQDIWHU land use change (abandoned coal mines, gravel pits, military VLWHV HWF XUEDQ VSUDZO HVWDEOLVKPHQW RI JROI FRXUVHV recreational parks etc., marginalisation of land Perception of soil functions: ± +LVWRU\RIVRLOVFLHQFHFRPPXQLFDWLQJDQGLPSOHPHQWLQJVFLHQWific knowledge in soil protection strategies, practices and in land use planning and management. ± (OLFLWLQJ DQG XVLQJ WDFLW LQWXLWLYH NQRZOHGJH IURP SUDFWLFH H[SHULHQFH WUDGLWLRQ LQWHJUDWLQJ WDFLW NQRZOHGJH LQ VRLO protection programs (e.g. on farm scale). Progress in soil policies: ± ,QQRYDWLYHZD\VDQGLQVWUXPHQWVIRUFRPPXQLFDWLQJDnd implementing modern soil protection strategies. ± 6XFFHVVIDFWRUVIRUWKHLPSOHPHQWDWLRQRIsoil protection strategies and programs.
6<0326,80%6RLOVDQGVRFLHWLHVLQKLVWRU\ Convenor: Verena Winiwarter, Austria Co-convenor: Hans Rudolf Bork, Germany Keynote Speakers: Hans Rudolf Bork, Germany; Verena Winiwarter, Austria
Soils are the most historical of all elements, in that they preserve the legacies of human use and are affected by anthropogenic IDFWRUVZKLFKOHDGWRORQJWHUPFKDQJHV+XPDQVRLOLQWHUDFWLRQVKDYe figured prominently in history, such as in the "Dust Bowl" in 1930ies US history. We are looking not only for degradation narratives but for accounts of the whole host of interactions. We invite contributions to all themes in which interactions between humans and soils have figured prominently, such as: - the history of fertilization techniques - the history of soil conservation techniques (such as e.g. lithic mulching) - the history of soil perceptions in religion, art, folklore, etc. - the history of experiential soil knowledge (as opposed to soil science) - case studies in degradation and /or conservation of soils and all other themes which focus on the role of soils in human history and highlight the interdependency between societies and the soil. Ancient Roman Soil Testing (Tuesday, August 26, 2008 - after the Symposium, in front of the lecture hall) ,WZDVRQHRIWKHWHVWV$QFLHQW5RPDQVZRXOGXVHWRDVVHVVWKHTXDOity of their soils, in particular, if they were planning to plant a vineyard: Mixing the soil with water and tasting the resulting liquid after filtration. They held that salinity or bitterness of the soil is important for viticulture, since the wine will acquire the tastHRIWKHJURXQG$FFRUGLQJWRWKH$QFLHQWZULWLQJVWRWHVWIor this, one takes clear, fresh water and mixes it thoroughly with a soil VDPSOH2QFHWKHPL[WXUHLVILOWHUHGWKURXJKDQXQJOD]HG earthenware or a sieve as used in wine-making - details vary depending on the author - one can cautiously taste the water, which will have taken on the taste of the soil (Col. ,,9HUJ*HRUJ,,3DOO,9 We are re-creating this test and adding to it by making the wine growing on particular soils available to test in comparison. (DUOLHUH[DPSOHVRIWKLVHQGHDYRUKDYHVKRZQWKDWLQVRPHFDVHV a marked similarity between tastes is discernible to the soil- and- wine tasting connoisseur. We invite you to partiFLSDWHLQWKLVUHFUHDWLRQRI$QFLHQWSUDFWLFH 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,80(GXFDWLRQLQVRLOVFLHQFHDQGUDLVLQJSXEOLFDZDUHQHVV Convenor: Monika Tulipan, Austria Co-convenor: Mireille Dosso, France Keynote Speaker: Günter Miehlich, Germany
In order to enable protection and to emphasize the vital importance of soil for life, for every citizen as well as to ensure the sustainable use of soil, public awareness for the fascination of soil should be raised. In this symposium, it is possible to inform and to exchange experiences about: new education methods and formats at universities e.g. - by opening and demonstrating the relevance of soil science to other disciplines, - by developing multidisciplinary studies for students in the field, - by using new technologies, - by reinforcing the high value of scientific field work simply to rediscover the sexiness of soils and soil sciences and about how to reach non scientists, teachers, pupils, small children, politicians with e.g. public debates, workshops, exhibitions at different scales, living experience, TV, radio, videos, internet portals, real and virtual soil nature trails, games, art and how to open the gates of the soil scientific community.
6<0326,805KL]RVSKHUHSURFHVVHV Convenor: Walter W. Wenzel, Austria Co-convenor: Hoika Kraigher, Slovenia Keynote speaker: Philippe HINSINGER, France
7KHVRLO±URRWLQWHUIDFHLHthe rhizosphere, is distinguished from bulk soil by root-microbial induced modifications of physical, chemical and biological processes and resulting features. Since the days of Lorenz Hiltner, who FRLQHGWKHWHUP³UKL]RVSKHUH´Ln 1904, we have seen enormous progress in our understanding of individual rhizosphere processes on the micro-scale. Yet, owing to the complexity of this microenvironment, we are still far from understanding the interactions between processes and, in particular, their combined impact on nutrient and water efficiency or on pollutant bioavailability at the macro-scale, i.e. in the field. However, for management of water and nutrient efficiency in low input farming, and of the bioavailability of pollutants in contaminated soils, it is important to know how the various rhizosphere processes and related feedback loops interact, and as to whether these interactions result in magnification of desired effects or not. The symposium aims at providing an overview on the state-of-the art of process-oriented research in rhizosphere ecology with emphasis on process interactions and feedback loops. Special attention is also given to scaling problems and the related need of combining experimental and mathematical modelling approaches to enhance our understanding of the rhizosphere. These fundamental aspects are discussed in the context of their significance for the development of rhizotechnologies for sustainable land management.
6<0326,806RLOVDQG*02V Convenor: Angela Sessitsch, Austria Co-convenor: Kornelia Smalla, Germany Keynote Speaker: Michael Schloter, Germany
Soil is one of the most important resources and the soil microflora is mediating highly important geochemical processes. Soils act as growth subtrates for plant growth and plant-associated microorganisms play key roles in the nutrition and stress tolerance of plants as well as in antagonizing plant pathogens. On the one hand potential effects of genetically modified organisms on the soil ecosystem have world-wide raised concerns, whereas on the other hand GMOs including, e.g. genetically modified biofertilizers or bioremediation agents, may lead to reduced chemical inputs. This symposium will address issues of biosafety and possible consequences of GMOs on the soil environment as well as new, promising applications of GMOs to be used in agriculture or bioremediation. 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,800HPRU\IXQFWLRQRIUHFHQWDQGSDOHRVRLOV Convenor: György Füleky, Hungary Co-convenor: Adrijan Kosir, Slovenia Keynote Speaker: Roger Langohr, Belgium
Soil memory concerns both ability to record environmental and soil processes and the record of these processes itself. The main goal of this symposium is to identify the environmental conditions and pedogenic processes acting on the land surface from the resistant soil solid phase carriers and to extract all the information from the carriers of soil memory of different hierarchical level. Papers and posters on the following subjects are welcome: (i) Reconstraction of past landscapes, (ii) Interpretations of the paleoenvironmental conditions governing the development of landscapes including the influence of human impact, (iii) Estimations and quantifications of pedogenic processes in natural and human impacted systems, (iv) Interpretations of archaeological records associated with soils.
6<0326,803HGRPHWULFVDQGGLJLWDOVRLOPDSSLQJ Convenor: Lubos Boruvka, Czech Republic Co-convenor: Endre Dobos, Hungary Keynote Speaker: Richard Murray Lark, United Kingdom
The symposia will cover the emerging quantitative techniques to characterize soil properties and assess its variation in time and space. Increasing amount of soil information, emerging auxiliary data, and technical progress enable new advanced ways of soil data analysis and processing, including digital soil mapping and database development. This symposium will discuss mainly the following topics:
- New methods applicable to assess the spatial variation of soils, digital soil mapping (hybrid methods, fuzzy methods, fractal analysis, artificial neural networks etc.) - Soil data acquisition, sampling optimization for different purposes - Auxiliary data (digital terrain model, remote sensing etc.) exploitation, new auxiliary data sources; soil inference systems - Temporal and spatio-temporal variation of soil, its description and assessment - Accuracy assessment of soil assessment outputs and digital soil maps - Applications and interpretations of pedometrics and digital soil mapping (environmental issues, soil classification and allocation, precision farming, soil development etc.)
6<0326,807KHLQIOXHQFHRIVRLOTXDOLW\RQKXPDQKHDOWKDQGIRRGVHFXULW\ Convenor: Andreas Baumgarten, Austria Co-convenors: Wolfgang Friesl, Austria; Eiliv Steinnes, Norway Keynote Speakers: Eiliv Steinnes, Norway; Brian Alloway, United Kingdom
The impact of pathogens and toxic chemical substances in soil on human health directly and through transfer to food crops has received considerable attention. Through research in the field of "geomedicine" it has become apparent that the natural contents of elements in the soil may be far more important to human health than soil scientists or medical researchers have been aware of, either through deficiency or excess of the element in food crops grown on the soil. In this symposium the influence of natural factors as well as man-made changes in soils on human health and food security shall be highlighted.
6<0326,806RLOIHUWLOLW\DQGHQYLURQPHQW Convenor: Milan Mesic, Croatia Co-convenor: Rok Mihelic, Slovenia Keynote Speaker: Nemeth Tamas, Hungary
Maintenance of soil fertility is one of the important continuing tasks according to the concept of sustainable land use. Increased soil fertility is desirable but excessive addition of mineral and organic fertilizers and other soil amendments can became unfavorable, because of increased emission of specific pollutants to the environment. Complicated relations between physical, chemical and biological components of soil fertility as well as human influence on soils can be decisive for overall impact to the environment. Important parts of global cycles of many elements are carried out in soils. Among them carbon and nitrogen are often in the focus when problems of air quality and climate change are discussed. Nitrogen and phosphorus are essential plant nutrients, but in water environment they can cause pollution and eutrophication. Heavy metals, other inorganic and many organic pollutants can be emitted to the environment if soils are contaminated and fertility of such soils is endangered. Lower soil fertility in global cannot be accepted in a long-term, especially if food production is considered. Relations between components of soil fertility and environment should be addressed in this symposium. 6FLHQWLILF3URJUDPPH±'HVFULSWLRQ6\PSRVLD
6<0326,807LPHVFDOHVRISHGRJHQLFSURFHVVHVIRUSUHGLFWLQJVRLOFKDQJHVLQWLPH Convenor: Victor Targulian, Russia Co-convenor: Attila Barczi, Hungary Keynote speaker: Richard Arnold, United States
The qualitative knowledge of soil system behavior in time is a crucial point for understanding and predicting both natural and human-induced soil changes in recent pedosphere. The study of soils dated by any kinds of methods ( 14C, archeological, historical, geological, geomorphological, etc) gives to pedology information about pedogenesis duration under the given environment and allow to count the rates and/or characteristic times of the main specific pedogenic processes. The symposium aims to collect these characteristics for different soils and related environments, to group them in spatial and temporal hierarchy, i.e. describe their dependence from natural and anthropogenic factors, from the depths of soil horizons, from intensity of soil system functioning and, at last, to divide the whole set of pedogenic processes into fast, medium rate and slow ones. Such accumulated knowledge could be applied to the estimation of possible responses of different soils on different natural and anthropogenic impacts and to the assessment of reversibility/irreversibility of soil changes in time (soil resilience). It gives in turn the possibility to built various predicting (semi)qualitative scenarios of soil changes related to the general problem of the biosphere/geosphere global change
6<0326,800LFURPRUSKRORJLFDODQGPLQHUDORJLFDOIHDWXUHV HYLGHQFH RIVRLOHQYLURQPHQWDOFKDQJH Convenor: Karl Stahr, Germany Co-convenor: Maria Gerassimova, Russia Keynote Speaker: Karl Stahr, Germany
Mineralogy and Micromorphology are generally and historically fields of science which observe and explain conservative features of soils. However new formations generally formed at surfaces of cracks and voids. It is well known that the porespace of soils is the spectrum of methods to analyse mineral and surfaces, especially with small dimensions has significantly grown the last 20 years. However the interpretation of environmental change needs criminalistic energy in order to combine the right methods to reconstruct and elucidate processes which took place at the microscale of our soils. Therefore environmental detectives are encouraged a fantastic and interesting laboratory of nature. Reactions taking place in this laboratory result in changes at the pore walls (dissolution, precipitation, structural changes).
Luckily the spectrum of methods to analyse mineral and surfaces, especially with small dimensions has significantly grown the last 20 years. However the interpretation of environmental change needs criminalistic energy in order to combine the right methods to reconstruct and elucidate processes which took place at the microscale of our soils. Therefore environmental detectives are encouraged to contribute to this symposium. 6\PSRVLD±0RQGD\$XJXVW±%ORFN$ ±
+6 )HVWVDDO +6 +6 +6 6$ 6$ 6$ 6$ 6$ 6RLO2UJDQLF0DWWHU 6RLO)HUWLOLW\DQG )RUHVW0DQDJHPHQW 6RLO&ODVVLILFDWLRQ 7KH,QIOXHQFHRI6RLO (QYLURQPHQW DQG6RLOV 4XDOLW\RQ+XPDQ Chair: Chair: +HDOWKDQG)RRG Frank Hagedorn Chair: Chair: Erika Micheli 6HFXULW\ Birmensdorf, Switzerland Milan Mesic Ellen Kandeler GödöllĘ, Hungary Zagreb, Croatia Stuttgart, Germany Alfred Pehamberger Chair: Rok Mihelic Sophie Zechmeister- Vienna, Austria Andreas Baumgarten Ljubljana, Slovenia Boltenstern Vienna, Austria Erich Inselsbacher Vienna, Austria Vienna, 6$./ 6$./ 6$./ 6$./ 6$./ Stabilization of organic Sustainability Unravel the black box - The need for an Soils and Geomedicine matter in top- and investigations at farm biochemical markers overarching European subsoils: Mechanisms level on Nitrate provide new insight into soil classification Eiliv Steinnes and Mysteries Vulnerable Zones multitrophic interactions (Trondheim, Norway) in soil Otto Spaargaren Bernd Marschner Tamás Németh (Wageningen, (Bochum, Germany) (Budapest, Hungary) Liliane Ruess Netherlands) (Darmstadt, Germany)
6$ 6$ 6$ 6$ 6$ Decomposition of Norway Nitrogen budget and Struggling with scales in Using WRB 2006 in Changes of trace spruce needles and fine nitrogen stock in soils tracing diversity, mapping and database element concentrations in roots - how much is under organic and distribution and design: practical issues wheat - data from mineralized and how conventional farming expression patterns of at European scales Swedish long-term field much is leached as fungal and bacterial experiments DOC? Christine Bosshard laccase genes in soils Arwyn Jones (Zürich, Switzerland) (Ispra, Italy) Holger Kirchmann Dan Berggren Kleja Francois Buscot (Uppsala, Sweden) (Uppsala, Sweden) A(Halle/Saale, Germany)
MON TUE THU FRI 6\PSRVLD±0RQGD\$XJXVW±%ORFN$ ±
HS 6 HS 7 +6 +6$ %|FNOVDDO 6$ 6$ 6$ 6$ 6$ 6RLODQG:DWHU7KHRU\ &RQWDPLQDQWV± 0HPRU\IXQFWLRQRIVRLO 7KHUKL]RVSKHUHD (YHQWVRUGXUDWLRQRI GHWHFWLRQWUDQVSRUW FRQVWLWXHQV FRPSOH[ LQIOXHQFHFDXVHVRLO Chair: HYDOXDWLRQ PLFURHQYLURQPHQW FKDQJHV Svatopluk Matula Chair: Prague, Czech Republic Chair: György Füleky Chair: Chair: Martin Schamann Gödöllö, Hungary Walter Wenzel Karl Stahr Vienna, Austria Vienna, Austria Stuttgart, Germany Karin Eusterhues Jena, Germany 6$./ 6$./ 6$./ 6$./ 6$./ Hydropedology as one of Management of local and Facing constraints in Rhizosphere processes How to read the book of +\GURVFLHQFHV³DQG diffuse soil contamination environmental from the microsite to the soils? important part of Soil and on a heavily reconstruction from soils global scale: Raising the Water Relationship contaminated region data (soil) profile Karl Stahr (seen from the point of (Stuttgart, Germany) Svatopluk Matula view of the feasibility and Roger Langohr Philippe Hinsinger (Prague, Czech possibility of technical (Gent, Belgium) (Montpellier, France) Republic) implications of technologies)
Jan Skowronek (Katowice, Poland) 6$ 6$ 6$ 6$ 6$ Soils a key to understand Copper and Zn labile Soil organic matter as a Common mycelial Short time clay minerals signal propagation and pools changes in proxy for climate and networks and interactions evolution in a dynamics in hydrological intermittently flooded environment in last- in mycorrhizosphere chronosequence of time series in changing soils evaluated using interglacial palaeosols determine carbon micropodzols in oleron ecosystems isotopic dilution dynamics in the forest island (France) techniques Karen Vancampenhout ecosystem Stefan Engelhardt (Leuven, Belgium) Laurent Caner (Bayreuth, Germany) Mattia Biasioli Tine Grebenc (Poitiers, France) (Grugliasco,A Italy) (Ljubljana, Slovenia)
MON TUE THU FRI 6\PSRVLD±0RQGD\$XJXVW±%ORFN% ±
+6 )HVWVDDO +6 +6 +6 6% 6% 6% 6% 6% 6RLO2UJDQLF0DWWHU 1LWURJHQ3DUW, 'HFRPSRVLWLRQE\ 6RLO&ODVVLILFDWLRQ 7KH,QIOXHQFHRI6RLO '\QDPLFV PLFURELDOFRPPXQLWLHV 4XDOLW\RQ+XPDQ Chair: Chair: +HDOWKDQG)RRG Chair: Rok Mihelic Chair: Erika Micheli 6HFXULW\±([SHULPHQWV Frank Hagedorn Ljubljana, Slovenia Sophie Zechmeister- GödöllĘ, Hungary Birmensdorf, Switzerland Letizia Pompili Boltenstern Alfred Pehamberger Chair: Roma, Italy Vienna, Austria Vienna, Austria Andreas Baumgarten Milan Mesic Ellen Kandeler Vienna, Austria Zagreb, Croatia Stuttgart, Germany 6% 6% 6% 6% 6%./ Wintertime C-fluxes in a Nitrogen mineralization Substrate availability New wine in old Soil Factors Associated forest soil of the Swiss of winter wheat residues affect abundance and wineskins: Why soil with Zinc Deficiency in Jura: Clues from a 13C in a temperate climate as function of soil maps cannot simply be Crops and Humans labeled litter addition affected by tillage microorganisms in the "translated" from WRB intensity detritusphere 1998 into WRB 2006 Brian Alloway Adrian Kammer (Reading, United (Birmensdorf, Annemie Van den Christian Poll Peter Schad Kingdom) Switzerland) Bossche (Stuttgart, Germany) (Freising- (Ghent, Belgium) Weihenstephan, Germany) 6% 6% 6% 6% Effects of plant litter input Nitrogen management Fate of crop residues Data harmonization and on lignin degradation in and nitrate leaching on incorporated in soil: database development forest soils some Dutch dairy farms towards linking microbial for a transnational area diversity and evolution of along the Hungarian- Thimo Klotzbücher Marthijn Sonneveld organic matter Slovakian border (Bayreuth, Germany) (Wageningen, Netherlands) Noémie Pascault Endre Dobos (Dijon, France) (Miskolc, Hungary)
6% 6% 6% 6% 6% Decomposition and Nutrients soil and gate Short term bacterial WRB and large scale soil May nutritionally relevant microbial colonisation of balances in beef cattle community structure inventory - possibilities elements in grains be litter affected by the production systems of dynamics in forest soil and limitations influenced by the choice depth of incubation in a southern Chile and their and litter: an in situ study of site and/or variety? column experiment implications for the in a CarboEurope site Aldis Karklins environment (Jelgava, Latvia) Heide Spiegel Nils Rottmann Nicolas Chemidlin (Vienna, Austria) (Witzenhausen, Marta Alfaro Prevost-Boure Germany) (Osorno, Chile) (Orsay, France)
6% 6% 6% 6% 6% Soil biodegradation of Soil N dynamic as Resource limitation of The conversion of a Tsunami affected maize roots: relative affected by tillage and N microbial decomposition: national soil classification agricultural soils of paddy importance of chemical fertilisation in a the effect of tree girdling to the World Reference fields in Sri Lanka - characteristics and mediterranean semiarid and fertilization on Base. Problems met in improvement of rice yield endogenous microflora agroecosystem belowground C and N Svete, Latvia parameters by soil fluxes amendments Gaylord Erwan Machinet Carlos Cantero-Martinez Pieter Jungerius (Reims, France) (Lleida, Spain) Christina Kaiser (Amsterdam, Thomas Reichenauer (Vienna, Austria) Netherlands) (Seibersdorf, Austria) 6% 6% 6% 6% 6% Effect of litter quality on Retention and leaching Resource availability and Applicability of WRB Arable soils in Austria organic matter of nitrate after nitrification seasonal changes alter 2006 for classification of contaminated with Cd, composition of of pig manure on variable the prokaryotic Slovenian soils Pb, and Zn: How to treat earthworm casts charge soil (Nitisol) community in a soil of a them? Results of four natural beech forest Tomaz Kralj years experiments in the Ruth Ellerbrock Frederic Feder (Ljubljana, Slovenia) field (Müncheberg, Germany) (Saint-Denis, Reunion) Angela Sessitsch (Seibersdorf, Austria) Wolfgang Friesl B(Seibersdorf, Austria) 6% 6% 6% 6% 6% Implications of rising Tillage intensity: Nitrogen cycling in the Classification Schemes Sustainable mitigation atmospheric CO2 Influence on soil C and Rothwald forest soil - of Soils: Principles, and land use options for concentration for plant soil N - modelling microbial communities Issues and Purposes for human health and biomass and soil organic approach based on and effects of Scientific and Technical environmental quality in matter changes on a CANDY environmental change Development respect to the nutrition molecular level system and the nutrients Enrico Thiel Evelyn Hackl Toma Shishkov C, N, P, S Guido Wiesenberg (Halle, Germany) (Seibersdorf, Austria) (Sofia, Bulgaria) (Bayreuth, Germany) Klaus Isermann (Hanhofen, Germany)
MON TUE THU FRI 6\PSRVLD±0RQGD\$XJXVW±%ORFN% ±
+6 HS 7 +6 +6$ %|FNOVDDO 6% 6% 6% 6% 6% 0RGHOOLQJRI6 : &RQWDPLQDQWV± 0HPRU\IXQFWLRQRIVRLO 5KL]RVSKHUHSURFHVVHV ,GHQWLILFDWLRQRIVRLO GHWHFWLRQWUDQVSRUW FRQVWLWXHQV LQGLIIHUHQW FKDQJHWKURXJK Chair: HYDOXDWLRQ FRQW G HQYLURQPHQWV PHWKRGRORJLFDO Anthony Frison Chair: LQQRYDWLRQV Olivet, France Chair: György Füleky Chair: Martin Schamann Gödöllö, Hungary Hojka Kraigher Chair: Vienna, Austria Ljubljana, Slovenia Laurent Caner Poitiers, France Karl Stahr Stuttgart, Germany 6% 6% 6% 6% 6% Integrated ecological Enrichment of Pd, Pt, Au, The mycological memory Changes in Biotransformation of Fe modeling using and Hg from aqua regia in natural and mycorrhizosphere oxides by Shewanella pedostructure concept. soil digests anthropogenically functions of ozone oneidensis Problematic and transformed paleosoils stressed forest trees presentation of both Manfred Sager Karin Eusterhues computer models, Kamel (Vienna, Austria) Olga Marfenina Karin Pritsch (Jena, Germany) and KamelSoil (Moscow, Russian (Neuherberg, Germany) Federation) Valerie Auffray (Montpellier, France) 6% 6% 6% 6% 6% Superhydrophobic Health-based action Near infrared Mobilization and Mineral transformations surfaces: A model levels for metals and spectroscopy as a tool to complexation of Zn and in soils on mine spoils approach to predict organic pollutants in identify soil organic Cd in the rhizosphere of (Technosols) of contact angle and Norwegian soils matter origin Thlaspi caerulescens abandoned pyrite mine in surface energy of soil Wiesciszowice (Lower particles Rolf Ottesen Damien Ertlen Jörg Luster Silesia, SW Poland) (Trondheim, Norway) (Strasbourg, France) (Birmensdorf, Joerg Bachmann Switzerland) Lukasz Uzarowicz (Hannover, Germany) (Cracow, Poland) 6% 6% 6% 6% 6% Estimating Saturated Cr(VI) transport in typical Links between A Rhizotest to account Direct X-Ray diffraction Hydraulic Conductivity In soils of the North of composition of heavy for the impact of root- pattern fitting: an Semiarid Rangeland Portugal organo-mineral fractions induced changes in the advance in the Using Artificial Neural and forest expansion on rhizosphere on metal characterisation of soil Network Bruna Fonseca grassland with long-term bioavailability to plants: a clay minerals (Braga, Portugal) fire history case study with durum Bijan Khalilmoghadam wheat cultivated on Cu- Fabien Hubert (Isfahan, Iran) Alexander Dümig contaminated, former (Poitiers, France) (Freising- vineyard soils Weihenstephan, Germany) Matthieu Bravin (Montpellier, France) 6% 6% 6% 6% 6% Modelling the equivalent The use of earthworms Rare earth elements as Effect of rhizosphere pH Assessment concerning hydraulic properties and to test the efficiency of tracers of pedogenic on PAH availability the parent material hydraulic functioning of a remediation of oil- processes in old soils influence on the clay highly heterogeneous polluted soil in tropical Christophe Barnier quality from Romanian horizon Mexico Cédric Laveuf (Vandoeuvre lès Nancy, chernozems (Orléans, France) France) Anthony Frison Violette Geissen Marius Eftene (Orléans, France) (Villahermosa, Mexico) (Bucharest, Romania) 6% 6% 6% 6% 6% Improving pedotransfer Sorption behavior of Nitrogen isotopic studies Uptake of intact amino Micromorphological functions predictions by cadmium on zeolite and (15N) reveal past acids from soil by plants - identification of various adding pedological bentonite agricultural activities in a matter of above- and silica polymorphs in information soils from a 14th century below ground geochemically different Mohsen Hamidpour archaeological site biodiversity? environments and Melanie Weynants (Isfahan, Iran) changing (paleo-)climate (Louvain-la-Neuve, Pierre Curmi Leopold Sauheitl in southern Portugal Belgium) (Dijon, France) (Bayreuth, Germany) BChristine Stein (Stuttgart, Germany) 6% 6% 6% 6% 6% Confronting typical A strategy for efficient Specialities of structure Response of old, new Determination of assumptions of 1-D root surveying and mapping of compound paleosoil and organically bred multifractal spectra in water uptake models with of soil pollution around a later and middle winter wheat cultivars in three dimensional soil 3-D simulations metal smelter pleistocene on different farming systems aggregate images morphological and related to arbuscular Mathieu Javaux Andreas Papritz micromorphological data mycorrhizal fungi Alexandra Kravchenko (Louvain-la-Neuve, (Zürich, Switzerland) (East Lansing, United Belgium) Pavel Panin Isabell Hildermann States) (Moscow, Russian (Frick, Switzerland) Federation) MON TUE THU FRI 6\PSRVLD±0RQGD\$XJXVW±%ORFN& ±
+6 )HVWVDDO +6 +6 +6 6& 6& 6& 6& 6& 6RLO2UJDQLF0DWWHU 1LWURJHQ3DUW,, 0LFURELDOFRPPXQLWLHV 6RLO&ODVVLILFDWLRQ 7KH,QIOXHQFHRI6RLO '\QDPLFV LQWLPHDQGVSDFH 4XDOLW\RQ+XPDQ Chair: Chair: +HDOWKDQG)RRG Chair: Hubert Tunney Chair: Erika Micheli 6HFXULW\0RGHOOLQJ Dan Berggren Kleja, Wexford, Ireland Francois Buscot GödöllĘ, Hungary Uppsala Judih Schick Halle (Saale), Germany Alfred Pehamberger Chair: Uppsala, Sweden Braunschweig, Germany Angela Sessitsch Vienna, Austria Eiliv Steinnes Jeremy Doublet Seibersdorf, Austria Trondheim, Norway Thiverval Grignon. France 6& 6& 6& 6& 6& The increase in dissolved 'Nitrogenome' - Studying Microbial diversity affects Soil Assessment in A GIS-based probabilistic organic matter nitrogen pathways and community response to Austria health risk assessment concentration in soil-plant-microbe climatic changes methodology for leachates from relationships in Alfred Pehamberger screening soil pollution undisturbed soil cores agricultural soils within a Elsa Coucheney (Vienna, Austria) after stop-flow mainly standardized microcosm (Thiverval Grignon, Axel Sauer originates from decaying system France) (Dresden, Germany) biomass Erich Inselsbacher Inne De Troyer (Vienna, Austria) (Heverlee, Belgium) 6& 6& 6& 6& 6& Influence of dissolved Current limitations of the Functional resilience of Classification of topsoils Modeling soil organic matter Barometric Process soil microbial on national, European degradation effect on movement on the net Separation method for communities depends on and international levels long-term food security in balance of carbon and quantifying gross both soil structure and China nitrogen in pasture soils nitrification rates in microbial community Maike Bosold calcareous soils composition (Vechta, Germany) Liming Ye Anwar Ghani (Gent, Belgium) (Hamilton, New Zealand) Riyad Bisharat Bryan Griffiths (Stuttgart, Germany) (Wexford, Ireland) 6& 6& 6& 6& 6& Rapid vertical changes of Recovery and Bacterial spatial Determination of soil Spatial analysis and soil organic matter retranslocation of 15N- characteristics at the condition using modeling for mapping composition under urea in a drained microscale in soil electromagnetic sensors environmental and social juvenile Beech trees - a minerotrophic peatland array land vulnerability in lysimeter study 13 years after application Genevieve Grundmann México (Villeurbanne, France) Adriana Savin Carsten Mueller Scott Chang (Iasi, Romania) Daniel Lopez (Freising, Germany) (Edmonton, Canada) (Mexico, Mexico)
6& 6& 6& 6& 6& Does water stress affect Conventional versus Modelling the The Khajeh Research Human health risk composition and sustainable fertilization: interactions between soil Station Soils: assessment in an urban stabilization of SON? - A adaptation for climate structure and microbial Morphology, Mineralogy park - Planning issues 15N labelling phytotron change activity & Classification experiment Laura Poggio Dalia Feiziene Patricia Garnier Ali Asghar Jafarzadeh (Ispra, Italy) Pascale Naumann (Dotnuva, Lithuania) (Thiverval Grignon, (Tabriz, Iran) (Freising, Germany)CFrance)
MON TUE THU FRI 6\PSRVLD±0RQGD\$XJXVW±%ORFN& ±
+6 HS 7 +6 +6$ %|FNOVDDO 6& 6& 6& 6& 6& 0HDVXUHPHQWVLQ6 : &RQWDPLQDQWV (QYLURQPHQWDO 5KL]RVSKHUHPRGHOOLQJ &KDUDFWHULVDWLRQRI DFFXPXODWLRQ UHFRQVWUXFWLRQ DQGFXWWLQJHGJH G\QDPLFSURFHVVHVLQ Chair: ELRDYDLODELOLW\ PHWKRGRORJ\ VRLOV Jonathan Holland, DSSOLFDWLRQRIPDWHULDOV Chair: Wagga Wagga György Füleky Chair: Chair: Wagga Wagga Chair: Gödöllö, Hungary Philippe Hinsinger Karin Eusterhues Rainer Schulin Montpellier, France Jena, Germany Zürich, Switzerland Victoria Mocanu Bucharest, Romania 6& 6& 6& 6& 6& Calibration and Soil and Water Multiultivariate numerical Modelling the Phytolith transport in evaluation of the soil Contamination in an Agro methods for Rhizosphere: Challenges sandy soil: experiments water content sensors Industrial Region in paleoenvironment and Future Perspectives and modeling ECH2O EC 5 and TE for Tropical Mexico reconstruction by the the soil moisture sensor example of monocultural Andrea Schnepf Olga Fishkis network SoilNet Violette Geissen kurgan cemetery within (Vienna, Austria) (Stuttgart, Germany) (Villahermosa, Mexico) steppe Pre-Ural, Russia U. Rosenbaum (Juelich, Germany) Alexander Justus (Pushchino, Russian Federation) 6& 6& 6& 6& 6& Intrinsic hydraulic Mine tailings as Investigations of buried Soil properties and the Semi quantitative properties determination adsorbent for lead in soil profiles beneath rhizosphere: Theoretical analysis of clay illuviation of water repellent soils contaminated soil kurgans: Case study of considerations in Alfisols of subhumid using tension disc the Lyukas-mound regions of northern Iran, infiltrometry Salla Hartikainen kurgan Xavier Raynaud Golestan (Helsinki, Finland) (Paris, France) Axel Lamparter Attila Barczi Farhad Khormali (Hannover, Germany) (Godollo, Hungary) (Gorgan, Iran) 6& 6& 6& 6& 6& Characterization of the Mass balance and Eurasian mountain soils Non-invasive imaging of Using ǻpH as a mobile water fraction in a distribution of zinc, lead, as a paleoarchives of root structure and root geochemical index of Beauce loamy soil and cadmium in sludge- Holocene water uptake illite neoformation in amended soils saprolite Yves Coquet developed on diorite Natalia Kovaleva Sascha Oswald (Thiverval-Grignon, saprolites (Limousin, (Moscow, Russian (Leipzig, Germany) Laurent Caner France) France) Federation) (Poitiers, France)
Dominique Proust (Poitiers, France) 6& 6& 6& 6& A new method to Accumulation of some Modelling the genesis of Contribution of root measure in-situ subsoil heavy metals in wheat Luvisols from calcareous respiration to CO2 drainage flux grown on sludge treated loess emission from soil in on sandy soil mediterranean Jonathan Holland Peter Finke grassland: comparison of (Wagga Wagga, Refat Youssef (Gent, Belgium) partitioning methods Australia) (Egypt, Egypt) Olga Gavrichkova C(Viterbo, Italy)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN' ±
+6 )HVWVDDO +6 +6 +6 6' 6' 6' 6' 6' 6RLO2UJDQLF0DWWHU &OLPDWH)HUWLOL]DWLRQ 6RLOPLFURRUJDQLVPV 6RLOLQGLFDWRUVHWV $VVHVVLQJVRLOHURVLRQ 6WDELOL]DWLRQ DQG6RLO)HUWLOLW\ DQGHQYLURQPHQWDO FKDQJH Chair: Chair: Chair: Chair: Sigbert Huber Jose Luis Rubio Bernd Marschner Milan Mesic Chair: Vienna, Austria Valencia, Spain Bochum, Germany Zagreb, Croatia Rainer Joergensen Enrico Thiel Witzenhausen, Germany Leipzig, Germany Liliane Ruess Sogol Rasouli Darmstadt, Germany Zanjan, Iran 6' 6' 6' 6'./ 6'./ Decomposition and Impact of climate Biogeochemical The Soil Framework Challenges for soil stabilisation of soluble uncertainties and soil transformations and Directive: State of play erosion modelling across vs.structural C fractions characteristics on rainfed response to change of on the debate and the scales and disciplines from plant residues in maize productivity in soils in Antarctic dry importance of soil soils South Bulgaria valleys information in its Peter Strauss implementation (Petzenkirchen, Austria) Cyril Girardin Zornitsa Popova David Hopkins (Thiverval Grignon, (Sofia, Bulgaria) (Dundee, United Nicolaas De Witt France) Kingdom) (Brussels, Belgium) 6' 6' 6' Impact of Calcium Temperature and Development of soil as a cations on the formation moisture effects on N- living space: the case of of coordinative cross- N2O losses from soils by the Damma glacier linking in Soil Organic different land use forefield Matter (SOM) Irina Kurganova Else Buenemann Daniela Gildemeister (Pushchino, Russian (Lindau, Switzerland) (Koblenz, Germany) Federation)
6' 6' 6' 6' 6' Estimating the relative Irrigation - a prerequisite Tree species control The core-set of Assessing soil erosion in importance of for sustainable nitrification? environmental indicators Mediterranean karst stabilisation mechanisms agriculture in Bulgaria of the European landscapes of Lebanon for lignin Kasaina Andrianarisoa Environment Agency using remote sensing Ivan Varlev (Nancy, France) and GIS Anett Hofmann (Sofia, Bulgaria) Anna Gentile (Zürich, Switzerland) (Copenhagen, Denmark) Rania Bou Kheir (Beirut, Lebanon) 6' 6' 6' 6' 6' Priming effect of stable Cover crops as a N-dynamic and microbial Indicators for soil Quantitative analysis of soil organic matter pools: nitrogen contamination community structure monitoring in Europe soil erosion and a test of two control system in olive depending on vegetation sediment yield of the contradictory groves patterns in agricultural Robert Jones Alaki Chay basin to hypotheses. soils (Cranfield, United optimal management it Emilio González Sánc Kingdom) (Iran-Azerbaijan) Bertrand Guenet (Córdoba, Spain) Ute Hamer (Paris, France) (Tharandt, Germany) Mousa Abedini (Ardabil, Iran)
6' 6' 6' 6' 6' ³%ODFNQLWURJHQ´DQ The fate of N, P and Effects of organic and Environmental Indicators Uncertainty assessment important fractionD of the ethoprophos in sandy conventional farming - a German Approach of suspended sediment stable soil organic matter loam soil under red practices on biological estimates from sediment pool pepper cultivation as soil quality parameters: Frank Glante rating curves in a small affected by different Evolution during the (Dessau, Germany) mountain catchment in Heike Knicker surface management experimental period of the Southern Pyrenees, (Freising- practices the long-term DOK field Spain Weihenstephan, trial Germany) Kyung-Hwa Han Gusman Catari (Suwon, Republic of Hans-Rudolf Oberholzer (Barcelona, Spain) Korea) (Zürich, Switzerland) 6' 6' 6' 6' 6' Multi-scale study of the Relative efficiency of Seasonal dynamics of Proposal for a Soil Soil water and wind evolution of organic nitrate-N and ammonium- microbial communities in Indicator Set in Austria erosion estimation by matter during the N in the nutrition of two alpine soils: a using the test areas, GIS podzolisation of laterites young corn plants molecular approach Sigbert Huber land use and soil map in the upper Amazon (Vienna, Austria) basin Abdel Khalek Selim Roberto Geremia Tiina Köster (Cairo, Egypt) (Grenoble, France) (Saku, Estonia) Marion Bardy (Paris, France)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN' ±
+6 HS 7 +6 +6$ %|FNOVDDO 6' 6' 6' 6$' 6' $QGRVROVDQG6RLO &RQWDPLQDQWV 7KHQDQRVFDOHV 6RFLHW\ VGHPDQGVIRU 0HWKRGVDQG 0LQHUDORJ\ DFFXPXODWLRQ DQGSHUFHSWLRQRIVRLO $SSURDFKHVRI ELRDYDLODELOLW\ Chair: FRQVHUYDWLRQ 3HGRPHWULFV Chair: DSSOLFDWLRQRIPDWHULDOV Martin Gerzabek Tamas Szegi FRQW G Vienna, Austria Chair: Chair: Gödöllö, Hungary 3K\WRUHPHGLDWLRQ Silvia Tobias Endre Dobos Peter Schad Birmensdorf, Switzerland Miskolc, Hungary Freising, Germany Chair: Katharina Helming Rainer Schulin Müncheberg, Germany Zürich, Switzerland Gerhard Soja Seibersdorf, Austria 6'./ 6' 6'./ 6$'./ 6'./ Soil forming processes, Binding of From Atom to Pedon: The role of policies in soil Pedometrics, some soil functioning and soil organochlorine Linking Processes to protection and applications and classification - the pesticides in agricultural Phenomena and conservation preoccupations example of allophanic soils and a Function and non-allophanic phytoavailability Tomas Ratinger Murray Lark Andosols assessment Kai Totsche (Sevilla, Spain) (Hertfordshire, United (Jena, Germany) Kingdom) Reinhold Jahn Isabel Hilber (Halle (Saale), Germany) (Frick, Switzerland) 6' Growing of Crops on Contaminated Soils
Ivica Kisic (Zagreb, Croatia)
6' 6' 6' 6$' 6' Fractal structure in Comparing Kd, repetitive Fate of pesticides in soil Appreciation of soil by Integrating auxiliary data volcanic soils extractions and DGT as porosity using Lattice Dutch society and expert knowledge: means of assessing Boltzmann and X-ray an object-based Thierry Woignier heavy metal computed tomography Aaldrik Tiktak approach for fuzzy soil (Montpellier, France) bioavailability (Bilthoven, Netherlands) class prediction Valérie Pot Florian Wittstock (Thiverval-Grignon, Markus Möller (Seibersdorf, Austria) France) (Halle (Saale), Germany) 6' 6' 6' 6$' 6' Formation and genesis of Simulation of the Surface properties of Ecosystem services or Multiple Additive volcanic ash soils in the pytoextraction process hydrous iron oxides: a soil functions? A closer Regression Trees as a Matese Mountains of by repeated extraction of model study look at the interface tool for estimating soil Southern Italy soil with neutral salt between natural and properties. Principles and solution and Daniel Tunega social sciences applications Claudio Massimo determination of resupply (Vienna, Austria) Colombo processes Klaus Glenk Manuel Martin (Campobasso, Italy) (Aberdeen, United (Olivet, France) Sri Wahidah Prahastuti Kingdom) (Vienna, Austria) 6' 6' 6' 6$' 6' Mineralogical and Minimizing the Estimation of heavy Using the AMOEBA Topsoil organic carbon geochemical changes environmental risks of metal sorption in German approach for effective content in relation to associated withD the loss Lettuce cultivated in soils using artificial soil conservation edaphic and of vertic properties in the heavy metals affected neural networks communication and anthropogenic site upper horizons of a Soils information towards variables in Rwanda Vertisol Ihuaku Anagu farmers in Belgium Alaa El-Din Zaghloul (Stuttgart, Germany) Ann Verdoodt Eva Lacarce (Cairo, Egypt) Erwin Wauters (Gent, Belgium) (Olivet, France) (Merelbeke, Belgium) 6' 6' 6' 6$' 6' Silicon isotopic Bioremediation and The role of hydrogen Heritage soils in Enhanced soil fractionation by Si phytoremediation of bonds and cation-bridges Flanders: towards a phosphorus mapping sorption onto iron oxides: copper and herbicides on the thermodynamic conservation strategy with common secondary evidence from coming from vineyard soil stability of humic acids: information synthesized oxides and modeling study Karen Vancampenhout basaltic ash soils David Huguenot (Leuven, Belgium) Michael Schirrmann (Colmar, France) Adelia Aquino (Potsdam, Germany) Sophie Opfergelt (Vienna, Austria) (Louvain-la-Neuve, Belgium)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN( ±
+6 )HVWVDDO +6 +6 +6 6( 6( 6( 6( 6( 6RLO2UJDQLF0DWWHU &KHPLFDODQG 6RLOELRWDDQGVRLO ,QGLFDWRUVIRUVSHFLILF 0RGHOOLQJVRLOHURVLRQ 3URSHUWLHV %LRORJLFDO6RLO)HUWLOLW\ IXQFWLRQV VRLOWKUHDWV Chair: Chair: Chair: Chair: Chair: Peter Laszlo Heike Knicker Rok Mihelic Paolo Nannipieri Jens Utermann Budapest, Hungary Freising, Germany Ljubljana, Slovenia Firenze, Italy Hannover, Germany Marta Alfaro David Hopkins Psorno, Chile Dundee, United Kingdom Irina Kurganova Pushchino, Russian Federation 6( 6( 6( 6( 6( Characterisation of Effects of bulking agent Metaproteomics: a new The complex indicators Soil Erosion Survey for antioxidants in soil on nitrogen availability of approach for studying reflecting soil functioning Saxony using the organic matter sewage sludge functional microbial activity EROSION-3D Simulation composts: influence of ecology Model David Rimmer measurement scale for N Raimo Kõlli (Newcastle upon Tyne, availability Pierre Maron (Tartu, Estonia) Marcus Schindewolf United Kingdom) (Dijon, France) (Freiberg, Germany) Jeremy Doublet (Thiverval Grignon, France) 6( 6( 6( 6( 6( Separation of free Evaluation of crop Iron reducing bacterial Indicators and Modelling winter cover particulate organic matter responses to activities and Thresholds for crop management impact from bulk soil by organomineral fertilisers communities in paddy Desertification, Soil on runoff and erosion in electrostatic attraction in the UK and soils: impact of salinity Quality, and Remediation a continuous maize measurement of nitrogen and of organic matter - INDEX cropping system Michael Kaiser availability in controlled (Müncheberg, Germany) laboratory conditions Affi Bongoua Devisme Max Kuderna Eric Laloy (Vandoeuvre les nancy, (Vienna, Austria) (Louvain-la-Neuve, Diogenes Antille France) Belgium) (Bedfordshire, United Kingdom) 6( 6( 6( 6( 6( Elucidating the reaction Estimation of nitrogen How alternative How to monitor decline in Estimation of erosion and of sulfadiazine with soil mineralization of forest agricultural practices soil biodiversity across sediment rates using humic acid with 15N- soil by temperature, affect the soil biota and Europe? E.P.M. method (case CPMAS-NMR nitrogen content, and soil soil function - the case of study: Veladareh Basin, spectroscopy type, and its application the denitrification Rachel Creamer Ardabil, Iran) in Japan process (Cranfield, United Anne Berns Kingdom) Aghil Madadi (Jülich, Germany) Keizo Hirai Jean-Luc Chotte (Ardabil, Iran) (Morioka, Iwate, Japan) (Montpellier, France) 6( 6( 6( 6( 6( Investigation of the Long-term projections of Denitrifying activity and An ecosystem-services Quantitative modeling of effects of soil organic chemical soil fertility of fungal growth in the fresh based approach to the impact of landscape matter on water grassland soils in cast of Aporrectodea selecting biological structure on soil repellency by atomic Switzerland caliginosa indicators of soil quality morphogenetic force microscopy for national-scale soil processes in a complex Armin Keller Alexander Kurakov monitoring agricultural landscape Shuying Cheng (Zürich, Switzerland) (Moscow, Russian (Swansea, United Federation) Helaina Black Stéphane Follain Kingdom) (Aberdeen, United (Montpellier, France) EKingdom)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN( ±
+6 HS 7 +6 +6$ %|FNOVDDO 6( 6( 6( 6$( 6( 6RLO6WUDWLILFDWLRQDQG 3K\WRUHPHGLDWLRQ 0HWDOEHKDYLRXU 6RFLHW\ VGHPDQGVIRU '(0'70([SORLWDWLRQ 6HGLPHQWV FRQW G DQGSHUFHSWLRQRIVRLO LQ'LJLWDO6RLO0DSSLQJ Chair: FRQVHUYDWLRQ Chair: Chair: Alessandro Piccolo Chair: Peter Schad Gerhard Soja Portici, Italy Chair: Murray Lark Freising, Germany Seibersdorf, Austria Silvia Tobias Hertfordshire, United Tamas Szegi Birmensdorf, Switzerland Kingdom Gödöllö, Hungary Katharina Helming Müncheberg, Germany
6( 6( 6( 6$( 6( Soil forming processes Variability of edaphic The three-dimensional Repeat photography to DEM quality indicators and related conditions in metal- structure of soil organic analyse the effects of 30 for the derivation of morphological changes contaminated sites at matter years of land geomorphological during 11,000 years of multiple scales. A rehabilitation in the parameters soil development in temperate and a tropical Gabriele Schaumann Ethiopian highlands marine sediments of S- situations. (Koblenz, Germany) Laura Poggio Norway Jozef Deckers (Ispra, Italy) Gilles Colinet (Leuven, Belgium) Daniela Sauer (Gembloux, Belgium) (Stuttgart, Germany) 6( 6( 6( 6$( 6( Role of Geological Remediation of total Effect of soil moisture Landscape ecological Digital terrain analysis in Factors on Soil Forming petroleum hydrocarbons status on sorption factors influencing the an approach to stratify and Morphology in (TPHS) in a long-term processes of xenobiotics spread of bubonic plague geological mapping units Western Latvia Coastal contaminated soil using in soils in Lushoto, Tanzania and soil data as a basis Plains phytostimulation for a medium-scale soil technique Tatjana Simon Neerinckx map of Germany Raimonds Kasparinskis Schneckenburger (Antwerpen, Belgium) (Riga, Latvia) Aliasghar Besalatpour (Trier, Germany) Jan Willer (Isfahan, Iran) (Hannover, Germany)
6( 6( 6( 6$( 6( Geochemical soil zonality Phytomanagement of Influence of soil A review of policies and Soil-hydrological runoff on loess in Danube metal-contaminated properties on solute and the regulatory processes - a medium Lowland (SW Slovakia) agricultural land using extractable Trace Metal environment concerning scale digital mapping crop species in French forest soils soil conservation in the approach Ján ýurlík EU (Bratislava, Slovakia) Erika Fässler Laure Gandois Thorsten Behrens (Zürich, Switzerland) (Toulouse, France) Johannes Schuler (Tübingen, Germany) (Müncheberg, Germany)
6( 6$( 6( Remediation of soils Adapting policy Prediction of polluted with heavy measures to encourage groundwater levels and metals by using of the adoption of soil amplitudes in typical soil biosolid and supported conservation practices landscapes (low lands) of zeolite the Soil Map of Germany Nina Hagemann at scale 1:200,000 with Corneliu Bogatu (Berlin, Germany) Digital Soil Mapping E(Timisoara, Romania)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN) ±
+6 )HVWVDDO +6 +6 +6 6) 6) 6) 6) 6) 6RLO2UJDQLF0DWWHU 1XWULHQWV6RLOVDQG (FRORJLFDOHQJLQHHULQJ 1HZDSSURDFKHVIRU 4XDQWLWDWLYH 3URSHUWLHV (QYLURQPHQW E\VRLOIDXQD VRLOLQGLFDWRUV DVVHVVPHQWRIVRLO HURVLRQ Chair: Chair: Chair: Chair: Heike Knicker Tamás Németh Violette Geissen Robert Jones Chair: Freising, Germany Budapest, Hungary Villahermosa, Mexico Cranfield, United Lilian Oygarden Scott Chang Bryan Griffiths Kingdom Oslo, Norway Edmonton, AB, Canada Wexford, Ireland Kyung-Hwa Han Suwon, Republic of Korea 6) 6) 6) 6) 6) In situ investigation of Soil quality in a pasture Endogeic engineering: Soil quality indicators Physico-chemically SOM coatings on soil after application of Soil ecological processes and risk assessment induced erosion: Case particles using organic fertilizers or related to endogeic methodologies for study at the Lago di Vico fluorescence imaging mineral for 7 years earthworms - A summary subsoil compaction (Latium) of lab incubations Julia Bayer Ignacio Mariscal-Sancho Jan Van den Akker Friederike Lang (Swansea, United (Madrid, Spain) Martin Potthoff (Wageningen, (Berlin, Germany) Kingdom) (Göttingen, Germany) Netherlands) 6) 6) 6) 6) 6) The nature, distribution Changes in Chemical Functional impact of Using expert knowledge Mapping occurrence of and significance of Soil Properties after 11 earthworm biostructures to assess soil soil water erosion in organic carbon within Years of Different N and on soil bacterial compaction Sicily by a logistic and structurally intact soils Regular P and K community: A field multivariate geostatistical Fertilization approach in agricultural Silvia Tobias analysis Katie Smith soils (Birmensdorf, (Stirling, United Milan Mesic Switzerland) Maria Fantappiè Kingdom) (Zagreb, Croatia) Denis Piron (Firenze, Italy) (Rennes, France) 6) 6) 6) 6) 6) Understanding soil In-situ measurement of Root, mycorrhiza, and Putting together Sediment and nutrient structure dynamics plant available nutrients earthworm interactions: measures of soil physical loss from five Irish tillage during organic matter in tropical savanna and their combined effects on quality soils at two rainfall decomposition: forest soils - correlations plant biomass, nutrition intensities techniques for mapping with plant functional traits and soil structure Blair McKenzie C distributions onto 3-D (Dundee, United John Regan soil structure Franziska Schrodt Roxane Milleret Kingdom) (Wexford, Ireland) (Leeds, United Kingdom) (Neuchâtel, Switzerland) Clare Wilson (Stirling, United Kingdom) 6) 6) 6) 6) 6) Drying state and Effect of Continuous Impact of root growth, Assessment and Monitoring of Water wettability of soil samples Fertilization on Soil fungi and earthworms on monitoring of soil Erosion in Croatia - assessed by DRIFT Health in Rice Paddy soil physical properties conditions using indexes Fifteen Years of spectroscopy as assessed by based on near infrared Experience Pil Joo Kim shrinkage analysis reflectance (NIR) Dörte Diehl (Jinju, Republic of Korea) spectroscopy Ivica Kisic (Koblenz, Germany) Pascal Boivin (Zagreb, Croatia) (Jussy, Switzerland) Lauric Cécillon (Grenoble, France) 6) 6) 6) 6) 6) Use of physical Soil sulfur - Ecological forest Novel approaches for The evaluation of fractionation and Ftransformations and plant management, soil faunal assessing properties and aggregate size pyrolysis-GC/MS to study uptake communities and soil limitations of soils for distribution and compost organic matter processes: a case study cropping and grazing associated phosphorus incorporation into a Kristin Boye in the Black Forest as a function of loamy soil organic matter (Uppsala, Sweden) (Germany) Lothar Mueller landscape position along (Muencheberg, field tramlines Clément Peltre Matthieu Chauvat Germany) (Thiverval-Grignon, (Mont Saint Aignan, Ghasem Rahimi France) France) (Hamedan, Iran) 6) 6) 6) 6) Pyrolysis-GC/MS Pedotransfer functions Organic nitrogen as a Spatial variability on characterization for soil biodiversity potential indicator of runoff and soil regarding the influence of livestock grazing impacts mobilization in vineyards: climate and vegetation Ulfert Graefe on Mediterranean soil comparison between on the composition of soil (Hamburg, Germany) quality plots with different organic matter under disturbance degree natural ecosystems Fotini Stamati (Chania, Greece) María Concepción Karen Vancampenhout Ramos (Leuven, Belgium) (Lleida, Spain)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN) ±
+6 HS 7 +6 +6$ %|FNOVDDO 6) 6) 6) 6%) 6) 6RLOVRIPRXQWDLQRXV 5HPHGLDWLRQDQG 5HWHQWLRQDQGVRLO /RFDODQG5HJLRQDO *HRSK\VLFVDQG2WKHU DQGFROGUHJLRQV 1DWXUDO$WWHQXDWLRQ GHYHORSPHQW &DVH6WXGLHV $X[LOLDU\'DWD ([SORLWDWLRQLQ'60 Chair: Chair: Chair: Chair: Tamas Szegi Volker Franzius Martin Gerzabek Hans-Rudolf Bork Chair: Gödöllö, Hungary Berlin, Germany Vienna, Austria Kiel, Germany Thorsten Behrens Peter Schad Tübingen, Germany Freising, Germany
6) 6) 6) 6%)./ 6) The role of climate and Remediation of PAH- The impact of soil Soils and Societies in Digital mapping of soil vegetation in weathering polluted soils by in-situ- organic matter loss on History: Bridging layers and substrates - a and clay mineral injection of vegetable oil the soil's filtering capacity Approaches, Pooling machine learning formation in Alpine soils of the herbicide 2,4-D Knowledge approach based on GPR Gerhard Soja data Markus Egli (Seibersdorf, Austria) Markus Deurer Verena Winiwarter (Zürich, Switzerland) (Palmerston North, New (Klagenfurt, Austria) Karsten Schmidt Zealand) (Tübingen, Germany) 6) 6) 6) 6) Geochemical distinction The possible use of PAH leaching at the Single line Ground of subalpine soils based soluble humic laboratory scale - Penetrating Radar soil on Al, Fe, and REE substances for Comparison between survey along a remediation of heavy saturated and representative transect in Brice Mourier metal polluted soils unsaturated flow the soilscape of (Le Bourget du lac, Buedingen France) Ole Borggaard Julien Michel (Hesse/Germany) (Frederiksberg, (Nancy, France) Denmark) Christian Albrecht (Giessen, Germany) 6) 6) 6) 6%) 6) Sediment redistribution The effect of biotic and Influence of progressing The sand land soil Gamma-ray as a key to understand abiotic factors on Pb, Zn pedogenesis on the system and society spectrometry; local or soil formation in central and Cd accessibility and buffer function of global calibration? Bhutan. mobility in soil after floodplain soils Ramez Mahjoory remediation with EDTA (East Lansing, United Fenny van Egmond Thomas Caspari soil leaching Georg Lair States) (Groningen, Netherlands) (Freiburg, Germany) (Vienna, Austria) Metka Udovic (Ljubljana, Slovenia)
6) 6) 6) 6%) 6) Initial soil development in Soil redox changes Leaching of glyphosate Soil conservation in the Use of electrical the foreland of a enhance metal fixation on partly sealed urban Windward Islands, resistivity prospecting to retreating Werenskjold into Fe (hydr)oxides areas Eastern Caribbean, in characterize soil spatial Glacier, SW Spitsbergen the 1930s and 1940s variability links to actual Marco Contin Eva Klingelmann and past hedgerows Cezary Kabala (Udine, Italy) (Berlin, Germany) Lawrence Grossman networks landscape (Wroclaw, Poland) (Blacksburg, United States) Didier Michot (Rennes, France) 6) 6) 6) 6%) 6) The peculiarities of the Monitored Natural Transport of Reactive The "Great Leap Is systematic EMI two automorphic loamy soils Attenuation of nutrients Anions and Cations in a Forward" - a soil erosion dimensional soil survey of the east european at river basin scale - the Volcanic Soil: disaster in Chinese suitable for vineyard tundra Fcase of Evrotas river Experiments and history? Results of a production basin Modelling case study on the management? A test on Alexander Pastukhov Chinese Loess Plateau two pedologically- (Syktyvkar, Russian Ourania Tzoraki Julie Sansoulet contrasted Federation) (Chania, Greece) (Saint-Denis, la Réunion, Christine Dahlke Mediterranean vineyards France) (Goettingen, Germany) Guillaume Coulouma (Montpellier, France) 6) 6) 6%) 6) An innovative, Oxidation of anoxic soils Reclamation history as Regionalisation of soil biologically based in situ and sediments: how can explaining factor for soil data as basis for the remediation procedure we evaluate the risk of organic matter content in evaluation of natural soil for chlorinated solvent- heavy metal release? agricultural landscapes functions contaminated sites: first steps of establishment in Valérie Cappuyns Nynke Schulp Markus Tusch Austria (Brussels, Belgium) (Wageningen, (Innsbruck, Austria) Netherlands) Kerstin Scherr (Vienna, Austria)
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN* ±
+6 )HVWVDDO +6 +6 +6 6* 6* 6* 6* 6* 6RLO2UJDQLF0DWWHU 3KRVSKRUXVDQG6RLO 7KHQDWXUHRIPLFURELDO &KDOOHQJHVIRUVRLO 0HDVXUHPHQWVRIVRLO 3URSHUWLHV )HUWLOLW\ ELRPDVV LQGLFDWRUGHYHORSPHQW HURVLRQ
Chair: Chair: Chair: Chair: Chair: Rienk Smittenberg Diogenes Antille Genevieve Grundmann Sigbert Huber Peter Laszlo Zürich, Switzerland Bedfordshire, United Villeurbanne cedex, Vienna, Austria Budapest, Hungary Kingdom France Zornitsa Popova Martin Potthoff Sofia, Bulgaria Göttingen, Germany Dalia Feiziene Dotnuva, Lithuania 6* 6* 6* 6* 6* Can we use Agronomic potential of P- The contribution of fungi Soil indicators for Comparing soil erosion benzenepolycarboxylic fertilisers made from and bacteria to the chemical soil pollution in and sediment production acids as molecular sewage sludge ashes - microbial biomass in soil Switzerland - a critical in two contrasted markers to trace the The EU-Project SUSAN review and proposal for catchments from 137Cs formation temperature of Rainer Joergensen future soil indicators measurements wood char? Judith Schick (Witzenhausen, (Braunschweig, Germany) Reto Meuli Claude Bernard Maximilian Schneider Germany) (Zürich, Switzerland) (Québec, Canada) (Zürich, Switzerland) 6* 6* 6* 3DQHOGLVFXVVLRQ 6* Use of bidirectional Land-use evoked Influence of pH- on needs for further Prediction of the Surface reflectance rpectroscopy changes in soil heterogeneity of fertiliser indicator development Soil Shear Strength in (BRS) to predict organic phosphorus fractions effects on microbial towards optimal soil Semiarid rangeland carbon content in biomass in a long-term information Using PTFs volcanic soils Helena Soinne field trial of ecological (Helsinki, Finland) agriculture Sigbert Huber Bijan Khalilmoghadam Michele Vincenzo Sellitto (Vienna, Austria) (Isfahan, Iran) (Campobasso, Italy) Stefanie Heinze (Witzenhausen, Germany) 6* 6* 6* 6* How good is 13C isotope Fertilization effect on Soil microbial community Assessment of soil analysis in assessing phosphorus fractionation structure, diversity and erosion through the use dynamics of organic accumulation and functionality in integrated of 137Cs-method at compounds in soil? - The release in Greek Alfisols livestock-corp production Mochovce site, Slovakia example of lignin systems compared to Marina Bastounopoulou continuous cotton Emil Fulajtar Alexander Heim (Athens, Greece) (Bratislava, Slovakia) (Zürich, Switzerland) Veronica Acosta- Martinez (Lubbock, United States) 6* 6* 6* 6* Relationship between Soil phosphorus status Microbial-biogeography Soil detachment under carbon dynamics and and turnover in a central- of France by the use of vegetation - kinetic microbial communities European beech forest molecular tools applied energy of splash erosion determined by the ecosystem to the French soil quality under forest as a function natural 13C abundance monitoring network of different tree and of SOM and lipid Ulrike Talkner (RMQS) shrub species biomarkers (Göttingen, Germany) Lionel Ranjard Thomas Scholten Thomas Lerch (Dijon, France) (Tübingen, Germany) (Thiverval-Grignon, France) G
MON TUE THU FRI 6\PSRVLD±7XHVGD\$XJXVW±%ORFN* ±
+6 HS 7 +6 +6$ %|FNOVDDO 6* 6* 6* 6%* 6* +XPDQVDVVRLOIRUPLQJ 5HPHGLDWLRQDQG 3UDFWLFDOH[SHULHQFHV &RQFHSWXDO,VVXHVLQ 3HGRPHWULFDO IDFWRU 1DWXUDO$WWHQXDWLRQ DQGPLWLJDWLRQ 6RLO+LVWRU\ $SSOLFDWLRQV FRQW G Chair: Chair: Chair: Chair: Peter Schad Chair: Alessandro Piccolo Verena Winiwarter Lubos Boruvka Freising, Germany Volker Franzius Portici, Italy Klagenfurt, Austria Prague, Czech Republic Tamas Szegi Berlin, Germany Gödöllö, Hungary
6* 6* 6* 6%* 6* Long-term liming effects Soil solution composition Wastewater irrigation European soils: natural A multi-scale study on in Irish soils may have as a criterion of soil affects soils' filtering of vs. anthropogenic organic carbon stock been underestimated remediation atrazine: A laboratory entities? - examples from variability in forest soils study Central Europe Thomas Cummins Irina Smirnova Ingo Schöning (Dublin, Ireland) (Moscow, Russian Karin Mueller Stefan Dreibrodt (Jena, Germany) Federation) (Hamilton, New Zealand) (Kiel, Germany)
6* 6* 6* 6%* 6* Hydropedological Anaerobic Release of Cd, Pb and Ecosystem Challenge Exploring spatial Implications of Iron- biodegradation of organic Zn from substrates of a and Creative Human variation of soil organic Manganese Nodules in pollutants in former Pb smelter site Response to Soil matter fractions to Rice-Growing Ultisols groundwater: a novel, Salinity: Role in the Rise optimize a subsequent under Different low-cost in-situ Sylvia Meißner and Possible Decline of sampling Anthraquic Conditions bioremediation approach (Jena, Germany) Ancient Mesopotamian Civilization Carolin Cordova Zueng Chen Dragana Todorovic (Harpenden, United (Taipei, Taiwan) (Tulln, Austria) Bruce James Kingdom) (College Park, United States) 6* 6* 6* 6%* 6* Effect of wheat and Effect of Canola Oil Modifications of pH- Ontological and Mapping phreatic ryegrass on addition on the dependent heavy metal epistemological groundwater dynamics in recrystallisation rate of degradation behaviour of solubility through mineral considerations on soil - a the Dijle Valley pedogenic carbonates polycyclic aromatic and organic amendments soil scientist perspective hydrocarbons in soil Johan Van de Wauw Martina Gocke Bernd Marschner Ion Munteanu (Ghent, Belgium) (Bayreuth, Germany) Marion Hasinger (Bochum, Germany) (Bucharest, Romania) (Tulln, Austria)
6* 6* 6* 6%* 6* Formation of cabonate Effectiveness of Influence of pig slurry on Inner and Outer Soil֥ Short-range soil spatial precipitates in a marsh CLEANSOIL system in sorption and transport of Depth Psychology of variability structures and soil of northwest remediation of heavy medicinal sulfonamide Human Soil Relation soil sampling for change Germany metal polluted soils antibiotics in soil systems detection Nikola Patzel Luise Giani Galina Koptsik Marc-Oliver Aust (Frick, Switzerland) Rossano Ciampalini (Oldenburg, Germany) (Moscow, Russian (Rostock, Germany) (Florence, Italy) GFederation)
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN+ ±
+6 )HVWVDDO +6 +6 +6 6+ 6+ 6+ 6+ 6+ 6RLO2UJDQLF0DWWHU 3RWDVVLXP/LPLQJDQG )DFWRUV,QIOXHQFLQJ 6RLOPRQLWRULQJJHQHUDO 6RLOPRLVWXUHUHJLPHV, 6WRFNVDQG6WRFN :DVWHV /DQG8VH LVVXHV &KDQJHV Chair: Chair: Chair: Chair: Ildefonso Pla-Sentis Chair: Armin Keller Franc Lobnik Judit Berényi Üveges Lleida, Spain Michael Schmidt Zürich, Switzerland Ljubljana, Slovenia Budapest, Hungary Zürich, Switzerland Kristin Boye Uppsala, Sweden Abbas Samadi Urmia, Iran 6+ 6+ 6+./ 6+./ 6+./ Sequestration of organic Potassium dynamics and Land Use and Soil Recent advances in soil Soil water - storage carbon in soil by contribution from soil Protection in Europe monitoring and unsolved potential, accessibility chemical technology resources in a 30 year issues and flux as key functions grass rotation experiment Luca Montanarella for land use planning at Alessandro Piccolo (Ispra, Italy) Dominique Arrouays various scales - do we (Napels, Italy) Ingrid Öborn (Olivet, France) need a paradigm (Uppsala, Sweden) change? 6+ 6+ Estimate of changes in Mineralogical speciation Rainer Horn carbon balance of of soil potassium - a (Kiel, Germany) Russia, 1990-2005 basis for sustainable management options for Irina Kurganova grassland soils (Pushchino, Russian Federation) Ylva Andrist-Rangel (Uppsala, Sweden)
6+ 6+ 6+ 6+ 6+ Composition and Comparison of kinetics of Land use and landscape Soil monitoring - a basic Modeling the soil turnover of soil organic non-exchangeable effects on carbon tool for protection of soils moisture regime under matter fractions and potassium release from sequestration in and land use Mediterranean conditions aggregation in semiarid profile samples of cultivated and pasture steppe topsoils as driven mineralogically varying soils Jozef Kobza Ildefonso Pla-Sentis by organic matter input benchmark soil series (Banska Bystrica, (Lleida, Spain) Nadia Doaei Slovakia) Markus Steffens Nanak Pasricha (Hamedan, Iran) (Freising, Germany) (Dundahera, Gurgaon, India) 6+ 6+ 6+ 6+ 6+ Organic carbon content Lime use, requirement Land degradation as Harmonization of Risk Pedo-hydrologic of forest and agricultural and pH values on affected by deforestation Assessment indicators evaluation soils in Slovenia grassland soils in Ireland in northern Jordan Methodologies for Soil through pedo- based on statistics and Threats in Europe hydrographic balance Milan Kobal soil database results Sa'eb Khresat sheet simulation models (Ljubljana, Slovenia) (Irbid, Jordan) Christy van Beek at hydrographic basin Hubert Tunney (Wageningen, level using georeferential (Wexford, Ireland) Netherlands) data base
Elena Luminita Grigore (Bucharest, Romania) 6+ 6+ 6+ 6+ 6+ Early evolution of the soil A case study of olive oil Land suitability and crop European soil monitoring Field scale variability of organic matter pool as mill waste water distribution in an versus mapping - the measured and estimated measured on aH high application in corn fields: irrigation district of the importance of scale hydraulic properties: alpine chronosequence Soil and groundwater Ebro valley (Spain) stochastic analysis of quality assessment Clemens Reimann hydraulic behaviour Rienk Smittenberg José Martínez- (Trondheim, Norway) sensitivity and (Zürich, Switzerland) Daniel Moraetis Casasnovas investigation on spatial (Chania, Greece) (Lleida, Spain) structures of the data
Piero Manna (Portici (Napoli), Italy) 6+ 6+ 6+ 6+ 6+ Changes in soil carbon Response of pasture and Factors influencing land Correcting temporal Relevance of using soil contents in long-term vetch-cereal crops to use and public instabilities of chemical moisture simulation for experimental grassland sugar foam waste perception of land use measurements in long- farming decision support plots in Northeast applications in a changes in Slovenia term forest soil England between the mediterranean Palexerult monitoring André Chanzy 1980s and 2006 ³UDxD´VRLO Marina Pintar (Avignon, France) (Ljubljana, Slovenia) Andreas Papritz David Hopkins Pedro González- (Zürich, Switzerland) (Dundee, United Fernández Kingdom) (Córdoba, Spain)
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN+ ±
+6 +6 +6 +6$ %|FNOVDDO 6+ 6+ 6+ 6+ 6+ 9HJHWDWLRQ6RLO 6RLOVDQG&OLPDWH 8UEDQYV 6RLOVDQG*02V 5KHRORJLFDOSURFHVVHV ,QWHUDFWLRQV &KDQJH $QWKURSRJHQLF6RLOV LQVRLOVDVVWUXFWXUHG Chair: V\VWHPV Chair: Chair: Chair: Angela Sessitsch Klaus Katzensteiner Viliam Pichler Jaroslava Sobocka Seibersdorf, Austria Chair: Vienna, Austria Zvolen, Slovakia Bratislava, Slovakia Márta Birkás Gödöllö, Hungary Rainer Horn Kiel, Germany 6+./ 6+./ 6+./ 6+./ 6+./ Climate - vegetation - soil Do soils change when Services from Soils in Impact of transgenic Effects of Soil interactions: Changes in climate changes ? Urban Areas potato lines on microbial Compaction on Soil Biota forest soil properties and functions in the and Soil Biological function in a changing Anthony Dexter Wolfgang Burghardt rhizosphere Processes environment (Olivet, France) (Essen, Germany) Michael Schloter Berndt-Michael Wilke Helga Van Miegroet (Neuherberg, Germany) (Berlin, Germany) (Logan, United States)
6+ 6+ 6+./ 6+ 6+ Impact of tree species on Investigating the use of Anthropogenic soils, Molecular diversity of Rheological the release from forest Bayesian Belief what they are, their potato associated investigations in soil floor of organic and Networks to assess the properties, behaviour bacterial isolates with in micro mechanics: inorganic carbon and influence of climate and functionality vitro antagonistic activity structuring processes on nitrogen change on soil quality influenced by site, a micro scale Andreas Lehmann cultivar and genetic Florence Trum Rupert Hough (Stuttgart, Germany) modification Wibke Markgraf (Louvain-la-Neuve, (Aberdeen, United (Kiel, Germany) Belgium) Kingdom) Kornelia Smalla (Braunschweig, Germany) 6+ 6+ 6+ 6+ Nitrogen mineralization Temperature sensitivities Impact of transgenic Elasticity of pre- pathways in the humic of greenhouse gas potato producing consolidated soils under epipedon along formation processes antibacterial substances monotonic increasing chronosequences of a on plant-associated and cyclic loads pure beech and a mixed Sophie Zechmeister- microbial communities in oak-hornbeam even-high Boltenstern comparison to effects Stephan Peth forests (Vienna, Austria) caused by other (Kiel, Germany) parameters Jean Trap (Rouen, France) Angela Sessitsch (Seibersdorf, Austria) 6+ 6+ 6+ 6+ 6+ Decomposition and Temperature sensitivity Deconstructing Detection of impacts by The elasto-plastic nutrient loss of bilberry of soil respiration in a Technosols in World genetically modified behaviour of a variously litter under threeH different sandy soil from Sahel Reference Base (WRB) plants to the rhizosphere grazed steppe soil from dominant tree species region by molecular-chemical Inner Mongolia, P.R. Alan Kosse screening and China, under cyclic Tiina Nieminen Martial Bernoux (Urbana, United States) comparison to loading (Vantaa, Finland) (Montpellier, France) conventional techniques Julia Krümmelbein André Schlichting (Cottbus, Germany) (Groß Lüsewitz, Germany) 6+ 6+ 6+ 6+ 6+ Structure, functioning Interactions of Soil Transformation Transport und deposition Compaction of cultivated and impact of young teak Pedogenesis, Nitrogen Peculiarities in the City of a genetically modified soils: compressibility (Tectona grandis) and Carbon Stocks on a Forest Park (Case Study Pseudomonas according to soil suction plantation on coal mine Transect Study Across in Moscow). fluorescens in saturated spoil in a dry tropical the Qinghai-Xizang porous media Pauline Défossez environment, India (Tibet) Plateau Vadim Poputnikov (Reims, France) (Moscow, Russian Erwin Klumpp Anand Singh Frank Baumann Federation) (Jülich, Germany) (Chandigarh, India) (Tuebingen, Germany)
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN, ±
+6 )HVWVDDO +6 +6 +6 6, 6, 6, 6, 6, 6RLO2UJDQLF0DWWHU %LRGHJUDGDWLRQDQG 6RLO'HJUDGDWLRQ 'HYHORSPHQWRI 6RLOPRLVWXUHUHJLPHV,, &OLPDWH&KDQJH %LRDYDLODELOLW\ QDWLRQDOVRLOPRQLWRULQJ Chair: V\VWHPV Chair: Chair: Chair: Franc Lobnik Catalin Simota Frank Hagedorn Helena Soinne Ljubljana, Slovenia Chair: Bucharest, Romania Birmensdorf, Switzerland Helsinki, Finland Jozef Kobza Nanak Pasricha Banska Bystrica, Dundahera, Gurgaon, Slovakia India Marina Bastounopoulou Athens, Greece 6, 6, 6, 6, 6, Soil organic matter Fate of fluorescent Organic C storage and Project ,,Development of Using randomised decomposition in tropical dissolved organic matter organic fractions in the Croatian soil moving plots to quantify forests: a translocation (FDOM) released from carbonate-rich semi-arid monitoring programme the spatial variability of experiment along an organic manures applied soils after 20 years of ZLWKDSLORWSURMHFW³ soil water dynamics in altitudinal transect in in cultivated soils: A continuous irrigation in LIFE05 small forest areas Peru. biodegradation study NE Spain TCY/CRO/000105 Yvonne Morgenstern Michael Zimmermann Muhammad Bilal Iñigo Virto Andreja ýidiü (Freiburg, Germany) (of Edinburgh, United (Rennes, France) (Pamplona, Spain) (Zagreb, Croatia) Kingdom) 6, 6, 6, 6, 6, Temperature sensitivity Bioavailability of Si in Research of soil and Options for a UK Soil Database of soil- of SOM decomposition long-term cultivated soils water conservation Monitoring Network to hydraulic properties of with depth: influence of measures for land use assess status and forest soils in Baden- SOM protection Flore Guntzer planning change in soil indicators Württemberg/Germany (Aix-en-Provence, Jeroen Gillabel France) Jana UhlíĜová Helaina Black Heike Puhlmann (Heverlee (Leuven), (Brno, Czech Republic) (Aberdeen, United (Freiburg, Germany) Belgium) Kingdom)
6, 6, 6, 6, 6, Effects of a simulated Distribution and Identifying risk area for Advances in long-term Electrical resistivity summer drought on the transformation of soil degradation of rural chemical soil monitoring tomography monitoring contributions of new and different forms of zinc in area in of Switzerland of water deficit along old carbon to the CO2- acid soils of Iran Wysokomazowiecka pedological efflux of Swiss grassland Upland - Poland André Desaules toposequence related to soils Sogol Rasouli (Zürich, Switzerland) hedgerow (Zanjan, Iran) Antoni Szafranek Ottmar Joos (Warszawa, Poland) Didier Michot (of Zürich, Switzerland) (Rennes, France) 6, 6, 6, 6, 6, Elevated CO2 stimulates Sedimentation in paddy Categorizing European An Issues and Goals of Functional parameter microbial growth and fields: A neglected issue soils according to the Development of a Soil pedo-transfer functions exoenzymes in soil associated with land use ability to retain or Monitoring for Bulgaria of soil water aggregates intensification transmit diffuse source characteristic curve in pollutants Toma Shishkov western Iran Maxim Dorodnikov Petra Schmitter (Sofia, Bulgaria) (Stuttgart, Germany) (Hohenheim, Germany) Metka Suhadolc Mohammad Reza (Ljubljana, Slovenia) Mosaddeghi I (Hamadan, Iran)
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN, ±
HS 6 HS 7 +6 +6$ %|FNOVDDO 6, 6, 6, 6, 6, &DUERQ 6RLOVDQG&OLPDWH 8UEDQ6RLOV 6RLOVDQG*02V 6WUHVVVWUDLQHIIHFWV &KDQJH &RQWDPLQDWLRQ Chair: Chair: Chair: Jiri Kulhavy Chair: Chair: Kornelia Smalla Stephan Peth Brno, Czech Republic Viliam Pichler Wolfgang Burghardt Braunschweig, Germany Kiel, Germany Zvolen, Slovakia Essen, Germany Milan Kroulik Prague, Czech Republic
6, 6, 6, 6, 6, Influence of six European Long-term trends (1959- Reflecting spatial Glyphosate modified Mechanical behaviour of tree species on soil 2006) in soil heterogeneity in heavy rhizobacterial activities of structured and respiration, rates of temperature, evidence metal distribution of transgenic soybean homogenized paddy soils carbon turnover and for sub-soil warming and Technosols performing under cyclic loading carbon stocks in a microbial responses soil column tests Su-Jung Kim common garden (Seoul, Republic of Imke Janßen experiment David Hopkins Lutz Makowsky Korea) (Kiel, Germany) (Dundee, United (Osnabrueck, Germany) Lars Vesterdal Kingdom) (Hoersholm, Denmark) 6, 6, 6, 6, 6, Are soil organic carbon Factors controlling C Pollutant dispersion of Adsorption and Stress transmission in stocks affected by forest mineralisation in topsoil alluvial soils in the desorption of monomeric soil: Effects of tyre size, management? and subsoil are different industrialized region of Bt (Bacillus thuringiensis) inflation pressure and Pernik, Bulgaria Cry1Aa toxin on two wheel load Erik Grüneberg Naoise Nunan reference minerals : (Jena, Germany) (Thiverval Grignon, Helmut Meuser montmorillonite and Mathieu Lamandé France) (Osnabrück, Germany) kaolinite (Aarhus, Denmark)
Nordine Helassa (Montpellier, France) 6, 6, 6, 6, 6, Effects of thinning and Climate warming induced Historic waste disposal Evaluation of some soil- Effect of the inflation clear-felling on changes in temperature and present day dependent direct and pressure on stress greenhouse gas fluxes in regimes of the East contamination in Chat indirect, inner and outer distribution and soil Japanese cedar forest on European Cryosols and Moss, near Manchester, mycorrhizosphere physical properties under Brown Forest soils associated soils UK parameters at field- dynamic load grown GMO corn Tomoaki Morishita Galina Mazhitova Nicola White Alexander Zink (Tsukuba, Japan) (Syktyvkar, Russian (Nottingham, United Borbála Biró (Kiel, Germany) Federation) Kingdom) (Budapest, Hungary) 6, 6, 6, 6, Soil carbon and nitrogen Soil organic carbon Accumulation and Evaluation of frequency pools after clear-cutting stocks in the Canadian transport of lead in and total area of and scarification permafrost region and roadside soils machinery passages in their role in climate the field when using Sirpa Piirainen change Stéphanie Roulier different tillage systems (Joensuu, Finland) (Zürich, Switzerland) Charles Tarnocai Milan Kroulik (Ottawa, Canada) I (Prague, Czech Republic
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN- ±
+6 )HVWVDDO +6 +6 +6 6- 6- 6- 6- 6- 6RLO2UJDQLF0DWWHU ,QRUJDQLFDQG2UJDQLF 6RLO3URWHFWLRQ 5HVXOWVFRPLQJIURP 0RLVWXUHIORZLQVRLOV /DQGXVH 3ROOXWDQWV VRLOPRQLWRULQJ Chair: V\VWHPV Chair: Chair: Chair: Stephen Nortcliff Eduard Klaghofer David Hopkins Judih Schick Reading, United Chair: Petzenkirchen, Austria Dundee, United Kingdom Braunschweig, Germany Kingdom Jozef Kobza Ingrid Öborn Banska Bystrica, Uppsala, Sweden Slovakia Daniel Moraetis Chania, Greece 6- 6- 6- 6- 6- Intensive grazing leads Effect of soil tillage and Fertilization Loads of National Soil properties Tracing preferential to degradation and fertilization on Less Common Elements monitoring by means of flowpaths using electrical spatial homogenization micronutrients and heavy to Arable Soils in Austria the French soil test conductivity of topsoils in two major metals concentrations in database measurements: What are steppe types in Inner a soil cultivated with corn Manfred Sager the constraints? Mongolia, P.R. China and winter cereal (Vienna, Austria) Nicolas Saby Martin Wiesmeier (Olivet, France) Cindy Hugenschmidt (Freising- Jorge Paz-Ferreiro (Stuttgart, Germany) Weihenstephan, (La Coruña, Spain) Germany) 6- 6- 6- 6- 6- Is soil organic matter the Input of organic Biological methods of Detecting changes in Deriving point pedo- link between soil micropollutants in soil fertility reproduction of 6FRWODQG¶VVRLOUHVRXUFH transfer functions of management and soil through compost and antropogene degraded water retention for resilience in agricultural sludge application: irrigated soils in Allan Lilly important soil series in soils in England? possible transfer to Azerbaijan dry subtropics (Aberdeen, United Hamadan Province, plants Kingdom) western Iran Andrew Gregory Firoza Ramazanova Sabine Houot Mohammad Reza (Harpenden, United (Baku, Azerbaijan) (Thiverval-Grignon, Mosaddeghi Kingdom) France) (Hamadan, Iran) 6- 6- 6- 6- 6- Soil organic matter Factors controlling the Trace elements in the The Collection of Significance of tree roots dynamics in a long-term biodegradation of 17b- soil of some specific Improved Soil Datasets to preferential flow in field experiment estradiol, estrone and localities on Mt. for Soil Quality soils with stagnic comparing conventional 17a-ethinylestradiol in Medvednica Monitoring properties and organic farming: different natural soils Evidence from Darko Baksic %RUXW9U þaj Benjamin Lange fractionation and Britta Stumpe (Zagreb, Croatia) (Ljubljana, Slovenia) (Birmensdorf, modelling (Bochum, Germany) Switzerland) Jens Leifeld (Zürich, Switzerland) 6- 6- 6- 6- 6- Conversion of cropland Principal component Effect of conventional Elaboration of the soil Snowmelt infiltration into grassland: Potential analysis of the heavy and reduced tillage monitoring module of the through frozen forest soil for soil organic carbon metals distribution in systems on some Hungarian Agro- sequestration? soils physical and Environmental Program Raimo Sutinen microbiological (Rovaniemi, Finland) Axel Don Biljana Skrbic properties of silt loam József Szabó (Jena, Germany) (Novi Sad, Serbia) and heavy loamy sand (Budapest, Hungary) soils Ewa Czyz J(Rzeszów, Poland) 6- 6- 6- 6- 6- Impact of tillage on Arsenic, cadmium and Nutrient balances as The estimation of heavy The usefulness of the carbon and nitrogen uranium in soil solution required by the EC metal mobility in soil stable isotope 18O, 2H storage of two Haplic extracts of forest and Nitrates Directive and monitoring and 15N for a better Luvisols agricultural soils national Fertiliser understanding of the soil- contaminated by uranium Ordinances. How to get Saglara Mandzhieva water-plant system. Anna Jacobs mining activities from a farm level to a (Rostov-on-Don, Russian (Witzenhausen, regional approach? Federation) Peggy Macaigne Germany) Sylvia Kratz (Vienna, Austria) Sylvia Warnecke (Braunschweig, (Vechta, Germany) Germany) 6- 6- 6- 6- Nitrogen retention and Zinc speciation and The undercutter method Measurement of soil plant uptake on a highly exchangeability in six of dryland wheat farming hydraulic properties with weathered central polluted soils to control wind erosion in a simple evaporation Amazonian Ferralsol the western United approach amended with compost Emmanuel Frossard States and charcoal (Zürich, Switzerland) Uwe Schindler William Schillinger (Müncheberg, Germany) Christoph Steiner (Lind, United States) (Athens, United States) MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN- ±
+6 HS 7 +6 +6$ %|FNOVDDO 6- 6- 6- 6- 6- )RUHVWRSHUDWLRQV 6RLOVDQG&OLPDWH 6SHFLILFSURSHUWLHVRI 3HGRJHQHVLVDQG5DWHV 'HIRUPDWLRQSURFHVVHV LPSDFWVRQQXWULWLRQ &KDQJH 8UEDQ6RLOV RI3HGRJHQLF DQGPRGHOOLQJ 3URFHVVHV Chair: Chair: Chair: Chair: Stefan Leitgeb Viliam Pichler Jaroslava Sobocka Chair: Jerzy Lipiec Graz, Austria Zvolen, Slovakia Bratislava, Slovakia Victor Targulian Lublin, Poland Moscow, Russian Ferdo Basic Federation Zagreb, Croatia
6-./ 6- 6- 6-./ 6- Element budgets for Soil carbon sequestration Using magnetic Pedogenetic gold A universally applicable silvicultural management potential in newly properties to compare nuggets term to express the schemes - a tool for established prairies in impact of atmospheric stress situation in soils preserving ecosystem previously cultivated dust influx to O-horizon Richard Arnold and its use sustainability Mollisols soils and terrestrial moss (Washington, United along a transect through States) Rainer Horn Klaus vonWilpert Mahdi Al-Kaisi Oslo (Kiel, Germany) (Freiburg, Germany) (Ames, United States) Clemens Reimann (Trondheim, Norway) 6- 6- 6- Long-term monitoring of Spatial Distribution and Evolution of structural C dynamics in a Leaching of Selected soil properties after temperate grassland Heavy Metals in the Soils compaction and varying ecosystem via stable of Urban Areas management practices isotopes (13C) in a Free Air CO2 Enrichment Mert Guney Peter Weisskopf (FACE) experiment (Istanbul, Turkey) (Zürich, Switzerland)
Katharina Lenhart (Gießen, Germany) 6- 6- 6- 6- 6- Synthesis of research on Free air CO2 enrichment- PAHs in river floodplain Rare - Earth Elemental Predicting thermal the nutritional induced life form- and soils: sequestration by Analysis as a Tool for conductivity based on sustainability of variable- species-specific carbonaceous Assessment of Chemical soil strength and texture retention harvesting as responses of geosorbents Weathering Rates of an alternative to collembolans in arable Eocene Flysch Deposits Jerzy Lipiec clearcutting in northern soil Thilo Hofmann in Two Catchments in (Lublin, Poland) forests (Vienna, Austria) Istria, Croatia Christine Sticht Lucie Jerabkova (Braunschweig, Ozren Hasan (Vancouver, Canada) Germany) (Zagreb, Croatia)
6- 6- 6- 6- 6- Effects of different soil Cereal-based plant Soil pollution with arsenic Rates and characteristic A method to assess the preparations methods on production systems to in the area of former gold periods of soil-forming risk of soil compaction in the foliage N dynamics in mitigate greenhouse gas and arsenic mining processes activated due france using a soil water Finnish boreal forests; emissions- a Danish centre in Zloty Stok, SW to windthrows in spruce model 15N natural abundance perspective Poland forests at the Central isotopic method region of Russia Marie-Pierre Lefebvre approach Lars Munkholm Anna Karczewska (Olivet, France) (Tjele, Denmark) (Wrocáaw, Poland) Ivan Vasenev Shambhu Sah (Moscow, Russian (Helsinki, Finland) JFederation) 6- 6- 6- 6- 6- Aspects of the nutritional Effect of Silicate Fertilizer Bacterial and fungal Weathering and soil Continuous on-field sustainability of forest and Tillage Systems on abundances and formation along a tillage force monitoring management in Bavaria, Mitigating Methane diversities in a soil volcanic climosequence Southern Germany Emission during Rice resulting from urban in Northern Taiwan Mátyás Csiba Cultivation storm water infiltration (Mosonmagyaróvár, Wendelin Weis Franz Zehetner Hungary) (Freising, Germany) Pil Joo Kim Anne-Laure Badin (Vienna, Austria) (Jinju, Republic of Korea) (Lyon, France) 6- 6- 6- 6- 6- Sustainable site Changes in total soil C Soil fauna influences the Soil history reconstructed Soil Compaction productivity - is the under different crop water and nutrient by sediment analyses in Modeling, Hand and expertise derived from management systems dynamics in urban soils the French Alps Numerical Solving, agricultural long-term and in never-tilled soil in Comparisons and field experiments a long-term experiment Silvia Pieper Brice Mourier Applications relevant to (intensively) (Berlin, Germany) (Le Bourget du lac, managed forests? Alexandra Kravchenko France) Petru Cardei (East Lansing, United (Bucharest, Romania) Heide Spiegel States) (Vienna, Austria) MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN. ±
+6 )HVWVDDO +6 +6 +6 6. 6. 6. 6. 6. 6RLO2UJDQLF0DWWHU 8QIDYRUDEOH6RLO /DQG0DQDJHPHQW 5HVXOWVFRPLQJIURP 6RLOSK\VLFV 0RGHOOLQJ &RQGLWLRQV VRLOPRQLWRULQJ Chair: V\VWHPV Chair: Chair: Chair: Luca Montanarella Kimmo Rasa Jens Leifeld Milan Mesic Ispra, Italy Chair: Helsinki, Finland Zürich, Switzerland Zagreb, Croatia Judit Berényi Üveges Rok Mihelic Budapest, Hungary Ljubljana, Slovenia Jorge Paz-Ferreiro Coruña, Spain 6. 6. 6. 6. 6. Soil structure dynamics Alleviation of salt stress A qualitative multi- Topsoil-structure Shrinkage properties of and carbon sequestration in carrots with salt attribute model for damages in forest soils - clay soils of Finland tolerant rhizosphere assessing the impact of a survey based on the Uwe Franko bacteria in arid soils of management options on Level I - soil monitoring Kimmo Rasa (Halle, Germany) Uzbekistan soil sustainability in Baden-Wuerttemberg (Helsinki, Finland)
Laziza Gafurova Bryan Griffiths Jürgen Schäffer (Tashkent, Uzbekistan) (Wexford, Ireland) (Freiburg, Germany) 6. 6. 6. 6. 6. Micro-scale modelling of Growth and mineral What would we like our Relevance of different Evaluating single carbon turnover driven status of barley plants as soils to do and how do soil fauna and microflora spherical aggregate by microbial succession affected by drought and we decide? groups in the monitoring (SSA) model in a saline at a biogeochemical foliar fertilization of soil biodiversity: silty clay soil interface Willie Towers RMQS-Biodiv, a french Refat Youssef (Aberdeen, United Pilote area experience Mohammad Neyshabouri Joachim Ingwersen (Egypt, Egypt) Kingdom) (Tabriz, Iran) (Stuttgart, Germany) Guénola Pérès (Paimpont, France) 6. 6. 6. 6. 6. A model of the formation Soils of Georgia in living The loss of fertile land Comparison of soil Discretization of spatial and movement of space: problems and due to urbanisation organic matter and and temporal soil water Dissolved Organic perspectives process in the last microbial respiration variability into Nitrogen (DON) in soil decade - the case of measurements at homogeneous zones Tengiz Urushadze slovenian cities different scale based on electrical Andrew Whitmore (Tbilisi, Georgia) resistivity measurements (Hertfordshire, United Anka Lisec Anita Gál at the field scale Kingdom) (Ljubljana, Slovenia) (GödöllĘ, Hungary) Arlène Besson (Olivet, France)
6. 6. 6. 6. 6. RothC-Biota - a carbon A novel microwave- Implementation of the Perspectives for regional Optimization of the drain- accounting tool assisted technique for concept of reference monitoring of soil organic Regulation in hinterlands measuring soluble soils (RefeSols) matter in mineral soils of low Mountain ranges Bente Foereid organic N in soil extracts under the aspect of (Aberdeen, United Karlheinz Weinfurtner Marjoleine Hanegraaf natural flood retention Kingdom) Farshid Nourbakhsh (Schmallenberg, (Wageningen, (Isfahan, Iran) Germany) Netherlands) David Bertermann K(Erlangen, Germany)
MON TUE THU FRI 6\PSRVLD±7KXUVGD\$XJXVW±%ORFN. ±
+6 HS 7 +6 +6$ %|FNOVDDO 6. 6. 6. 6. 6. )RUHVWRSHUDWLRQV 6RLOVDQG&OLPDWH 8UEDQ6RLOVWKHLU 6RLO6\VWHPVDQG6RLO &RQVHTXHQFHVRIVRLO LPSDFWVRQQXWULWLRQ &KDQJHW 4XDOLW\DQG)XQFWLRQV %RG\ GHIRUPDWLRQRQ SK\VLFDOSURSHUWLHV Chair: Chair: Chair: Chair: Stefan Leitgeb Viliam Pichler Wolfgang Burghardt Richard Arnold Chair: Graz, Austria Zvolen, Slovakia Essen, Germany Washington, DC, United Márta Birkás States Gödöllö, Hungary Rainer Horn Kiel, Germany 6. 6. 6. 6../ 6. Dynamic modelling of Assessing long-term A method for soil Soil and Soil-Like Subsoil compaction as a forest management management and climate environmental quality Systems and Bodies: climate damage indicator effects on N retention effects for comparing evaluation for its Soil-Functioning and and output at three local adaptation management and Soil-Forming Processes Márta Birkás catchments at the Harz strategies planning in urban areas (Gödöllö, Hungary) Mountains, Germany Victor Targulian Vladimir Romanenkov %RUXW9U þaj (Moscow, Russian Bernd Ahrends (Moscow, Russian (Ljubljana, Slovenia) Federation) (Göttingen, Germany) Federation) 6. 6. 6. 6. 6. Evaluation of forest sites Modelling green house Tool of environmental Pedogenesis on two Soil moisture and with regard to nutrient emissions associated risk assessment in urban sequences of marine thermal regimes of soil export by whole tree with application of areas terraces in Southern Italy cover with spatially harvesting in Lower biowaste to land distributed soil Saxony, Germany, using Jaroslava Sobocka Stephen Wagner compacted layers a nutrient depletion index Ruben Sakrabani (Bratislava, Slovakia) (Stuttgart, Germany) (Cranfield, United Evgeny Shein Karl Josef Meiwes Kingdom) (Moscow, Russian (Göttingen, Germany) Federation) 6. 6. 6. 6. 6. Reduction of ungulate Effect of elevated CO2 Soil function living space Pedogenic properties of Assessing the density in mixed on the N cycle in grazed for plants in urban land surface deposit as reversibility of soil mountain forests of the pasture use planning evidences on landscape displacement after Bavarian Limestone Alps formation of the Tadu wheeling on restored results in improved soil Tobias Rütting Silke Höke tableland in central soils fertility (Giessen, Germany) (Osnabrück, Germany) Taiwan Silvia Tobias Jörg Prietzel Heng Tsai (Birmensdorf, (Freising- (Changhua, Taiwan) Switzerland) Weihenstephan, Germany) 6. 6. 6. 6. 6. Does Cd promote the Quantification of gross N Ecoengineering soil by Physical and chemical Obtaining more effects of wood ash on transformation rates in reinforcement with plant properties of soils on information from soil bulk enchytraeids in soils via 15N tracing roots IDUPHU¶VILHOGVIHUWLOL]HG density depth function coniferous forest soil? by solid urban wastes in using classical soil Christoph Mueller Paul Hallett the peri-urban area of mechanics Jari Haimi (Dublin, Ireland) (Dundee, United Ouagadougou, Burkina (Jyväskylä, Finland) Kingdom) Faso Susanne Woche (Hannover, Germany) Edmond Hien (Ouagadougou, Burkina KFaso)
MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN/ ±
+6 )HVWVDDO +6 +6 +6 6/ 6/ 6/ 6/ 6/ 2UJDQR0LQHUDO 6RLO,QIRUPDWLRQ 2YHUYLHZRI6RLO &OLPDWHDQGVRLO :DWHUUHODWLRQV ,QWHUDFWLRQV, V\VWHPVWKH6WDWHRI 'HVHUWLILFDWLRQDQG K\GURORJLFDOSURFHVVHV $UW 6DOLQLVDWLRQ3URFHVVHV Chair: Chair: Chair: Klaus vonWilpert Ruben Kretzschmar Chair: Chair: Thomas Lenhart Freiburg, Germany Zürich, Switzerland Michael Englisch Tibor Tóth Koblenz, Germany Willem van Riemsdijk Vienna, Austria Budapest, Hungary Wageningen, Christine Le Bas Netherlands Olivet, France 6/./ 6/./ 6/./ 6/ 6/./ Mineral-organic Soil Information Systems Soil salinity: a coin with Effects of climate change Excursion in South associations in soil: a - as an unifying factor in two sides including on soil hydrological Moravia - Lack and riddle wrapped in a Soil Science desertification and processes - A simple risk surplus of water in conundrum inside an preservation of the assessment floodplain forests and its enigma ? Josef Kozak natural resources impact on physiological (Praha, Czech Republic) Thomas Lenhart processes and tree Klaus Kaiser José Álvarez-Rogel (Koblenz, Germany) survival (Halle-Wittenberg, (Cartagena, Murcia, 6/ Germany) Spain) Soil management impact Jan ýermák on soil water status (Brno, Czech Republic) under climate change
Grazina Kadziene (Dotnuva-Akademija, Lithuania)
6/ 6/ 6/ 6/ 6/ Stabilization of dissolved Towards the European Soil salinity in Veneto Impact of climate Soil water budget and organic matter by Soil Data Centre plain uncertainties and soil sap flow measurements sorption to amorphous Al characteristics on maize of a 9-yr-old short hydroxide Marc Van Liedekerke Francesca Ragazzi irrigation requirements in rotation poplar plantation (Ispra, Italy) (Castelfranco Veneto, South Bulgaria in Saxony (Germany) Karsten Kalbitz Italy) (Bayreuth, Germany) Zornitsa Popova Rainer Petzold (Sofia, Bulgaria) (Tharandt, Germany)
6/ 6/ 6/ 6/ 6/ Precipitation or co- Development of the Assessment and Pedological change Soil moisture regime of precipitation of organic Croatian Soil Information mapping of area prone detection of Nile River Silver birch (Betula matter by Al - controls System desertification processes course and its islands, pendula) and Norway and impacts in the saline rangelands Egypt spruce (Picea abies (L.) Marija Bajica of Southern Caspian Sea Karst.) during variable Thorsten Scheel (Zagreb, Croatia) Alaa ElDin El Nahry weather conditions (Bayreuth, Germany) Majid Ownegh (ElNozha ElGedida, (Gorgan, Iran) Egypt) Karl Gartner (Vienna, Austria) 6/ 6/ 6/ 6/ 6/ Humic substances A database for the Desertification and Soil Head balance elements Spatial distribution of adsorption to iron oxides monitoring of forest soils Degradation in the evaluation of the soil and temperatures and water and its effects on overL Europe: data southern forest steppe cannopy by remote dynamics in the soil of a adsorption of cations and management for the zone of Western Siberia sensing small clear fell anions Biosoil Project Burghard Meyer Nikola Kolev Daniel Fröhlich Willem van Riemsdijk Eva Lacarce (Dortmund, Germany) (Sofia, Bulgaria) (Göttingen, Germany) (Wageningen, (Olivet, France) Netherlands) 6/ 6/ 6/ 6/ Sorption of Cr(III) on A high-resolution digital Salinization of paddy Dynamics of redox mixed montmorillonite Al- conceptual soil mapsoil fields in Northeastern potential and mobilisation Fe humic acid complexes map based on soil-relief Thailand of heavy metals in flood relationships retention basins Claudio Massimo Jean-Pierre Montoroi Colombo Detlef Deumlich (Bondy, France) Claudia Kreschnak (Campobasso, Italy) (Muencheberg, (Stuttgart, Germany) Germany)
MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN/ ±
HS 6 HS 7 +6 +6$ %|FNOVDDO 6/ 6/ 62,/IURPUHDOLW\WR 0DQDJHPHQWRI YLUWXDOLW\ &RQWDPLQDWHG6RLOV FRQFHSWVDQGSROLF\ Chair: GHYHORSHPHQW, Monika Tulipan Vienna, Austria Chair: Mireille Dosso Harald Kasamas Montpellier, France Vienna, Austria 6/./ 6/./ To raise soil awareness - European policy a hard job, but worth to developments for the go for it management of contaminated land Günther Miehlich (Hamburg, Austria) Joop Vegter (Amstelveen, Netherlands)
6/ 6/ Experience of making Management of soil ecology excursions: contaminated soils in what is in the future? Turkey: Legal framework and national programme Andrey Babenko development (Tomsk, Russian Federation) Burcu Özkaraova Güngör (Samsun, Turkey) 6/ 6/ (Forest) Soil Education Development of a 7UDLO³7DIHUONODXVH´ decision making tool for remediation of Edwin Herzberger contaminated sites in (Vienna, Austria) Austria
Thomas Reichenauer (Seibersdorf, Austria) 6/ 6/ SoilWeb: An Interactive, Sustainable On-Line Teaching Tool management of trace element contaminated Maja Krzic soils - The SUMATECS (Vancouver, Canada) project
MarkusL Puschenreiter (Vienna, Austria) 6/ 6/ E-learning tools in soil The detection of outliers physics in trace element content in soils based on the Beatrice Kulli Honauer French Soil Quality (Zürich, Switzerland) Monitoring Network
Véronique Antoni (Orleans, France)
MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN0 ±
+6 )HVWVDDO +6 +6 +6 60 60 60 60 60 2UJDQR0LQHUDO $SSOLFDWLRQRI*,6RQ $VVHVVPHQWRI6RLO ,UULJDWLRQ :DWHUUHODWLRQV,, ,QWHUDFWLRQV,, VROYLQJRIVRLOUHODWHG 'HVHUWLILFDWLRQDQG SUREOHPV 6DOLQLVDWLRQ Chair: Chair: Chair: Lobna Gharbi Tarchouna Klaus vonWilpert Ruben Kretzschmar Chair: Chair: Toulon, France Freiburg, Germany Zürich, Switzerland Michael Englisch Jozef Deckers Willem van Riemsdijk Vienna, Austria Leuven, Belgium Wageningen, Christine Le Bas Netherlands Olivet, France 60 60./ 60 60 60 Monte Carlo simulation Where is the information Risk assessment The influence of irrigation Mapping of soil water of TPP+ arrangements in from 100 years soil methods of salinization in on a calcic chernozem in regime of forest sites the interlayer space and surveying and research Europe: a quick look the eastern region of based on spatially at the external surface of in Europe? Romania distributed process Na-montmorillonite Tibor Tóth modeling Rainer Baritz (Budapest, Hungary) Florian Statescu Florian Jeschke (Hannover, Germany) (Iasi, Romania) Kai Schwärzel (Hannover, Germany) (Tharandt, Germany) 60 60 60 60 Adsorption of HDPy+ to Evaluation of an index for Canola, Brassica napus, Climatic water balance muscovite- and spatial assessment of L., plant growth and available soil water montmorillonite-aqueous environmental sensible characteristics and storage capacity as solution interface: A areas to desertification at productivity in response indicators for possible Monte Carlo study national scale to adaptation, moisture climate change effects and soil salinity on forest ecosystems Artur Meleshyn Catalin Simota (Hannover, Germany) (Bucharest, Romania) Salah Zarad Henning Meesenburg (Cairo, Egypt) (Goettingen, Germany) 60 60 60 60 60 Increasing pH drives the Mapping of trace element Soil salinization and Improvement of Salt- Influence of management release of organic matter contents and enrichment alkalinization in the affected Soils: 1-Acidify on soil moisture content in wetlands soils under factors in topsoils in the Lower Cheliff valley of irrigation water and and soil solution quality reductive conditions Nord-Pas de Calais (Algeria) soil water movement in the forests in the region (France) Dinaric karst Malgorzata Grybos Abdelkader Douaoui Mohamed Salem (Rennes, France) Denis Baize (Chlef, Algeria) (Cairo, Egypt) 3ULPR 6LPRQþiþ (Olivet, France) (Ljubljana, Slovenia) 60 60 60 60 Study of the surface soil Impact of seawater Soil-type impact on water Reliability of field tests geochemistry in the flooding caused by the and nitrogen distribution for ferrous iron (FeII ) to Neretva River Valley 26 December 2004 in the root zone of peach identify compaction (Croatia) using GIS and tsunami disaster on trees under drip- damages in forest soils geostatistics physico-chemical and fertigation microbial properties of Ernst Hildebrand Monika Zovko arable soils in Banda Kouman Koumanov (Freiburg, Germany) (Zagreb, Croatia) Aceh, Indonesia (Plovdiv, Bulgaria)
Stephan Wirth M(Müncheberg, Germany)
MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN0 ±
HS 6 HS 7 +6 +6$ %|FNOVDDO 60 60 : $ZDNHQLQJ 0DQDJHPHQWRI FRQFLRXVQHVVDQG &RQWDPLQDWHG6RLOV UDLVLQJDZDUHQHVV FRQFHSWVDQGSROLF\ DERXWVRLO GHYHORSHPHQW,,
Chair: Chair: Monika Tulipan Joop Vegter Vienna, Austria Amstelveen, Netherlands
60 60 How much land do we Advancing Innovative possess - how much land Remediation do we consume Technologies in Europe through Networking Othmar Nestroy (Graz, Austria) Dietmar Müller (Vienna, Austria)
60 60 Standards for soil topics Feasibility in Application in education in Europe of Different Remediation Methods of Petroleum Karin Geyer Pollutants in soil and its (Vechta, Germany) Algorithm in Industrial Case
Soheila Ebrahimi (Tehran, Iran) 'LVFXVVLRQ 60 Towards a European Former/present and network on soil future risks of excess awareness? heavy metal input to terrestrial ecosystems Gabriele Broll (Vechta, Germany) Sergey Koptsik (Moscow, Russian Federation) 60 Effect of endophytic fungi on Cd tolerance of Festuca arundinacea and Festuca Peratensis grown in a hydroponic system
Mohsen Soleimani M(Isfahan, Iran)
MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN1 ±
+6 )HVWVDDO +6 +6 +6 61 61 61 61 61 2UJDQR0LQHUDO $SSOLFDWLRQRI*,6RQ 0HFKDQLVPVRI6RLO 6RLOZDWHUSODQW %LRJHRFKHPLVWU\ ,QWHUDFWLRQV,,, VROYLQJRIVRLOUHODWHG 'HJUDGDWLRQDQGWKH UHODWLRQVKLSV SUREOHPV 0HDQVIRU Chair: Chair: 5HFXSHUDWLRQ Chair: Helga Van Miegroet Ruben Kretzschmar Chair: Laura Hathaway-Jenkins Logan, UT, United States Zürich, Switzerland Christine Le Bas Chair: Cranfield, United Willem van Riemsdijk Olivet, France José Álvarez-Rogel Kingdom Wageningen, Michael Englisch Cartagena, Murcia, Netherlands Vienna, Austria Spain 61 61 61 61 61 Bradford reactive soil A digital soil mapping Changes in soil physical Yield - water relationship Soil moisture influence protein, glomalin, application for (hydraulic and of soybean on carbon and nitrogen accounts for a large delineating landscape mechanical) properties of mineralization in two proportion of organic pattern in France grassland soils as Alexander Matev adjacent coniferous matter in forest soils of affected by grazing (Plovdiv, Bulgaria) forest types on northern Martinique, French West Véronique Antoni intensity at Stipa grandis Vancouver Island Indies (Olivet, France) steppe in Inner Mongolia Toktam Sajedi Siobhán Staunton Agnieszka Reszkowska (Vancouver, Canada) (Montpellier, France) (Kiel, Germany) 61 61 61 61 61 Characterization of Dynamic soil data Chemical degradation of Subsoil compaction, DOC properties of forest organo-mineral management facilitating soils caused by structure degradation floor solutions under associations by harmonisation, access agronomic practices in a under the effect of Norway spruce and sequential density and communication of zone influenced by specific water regime in Douglas fir on a fractionation of two soil data in web-based mining activities soil land-reclamation Cambisol (Morvan, contrasting soils distributed systems constructions over a France) Carmen Perez-Sirvent period of 20 years Alain Plante Einar Eberhardt (Murcia, Spain) Hugues Titeux Aminat Umarova (Philadelphia, United (Hannover, Germany) (Louvain-la-Neuve, (Moscow, Russian States) Belgium) Federation) 61 61 61 61 61 Weathering of ferric- Web municipal SIS for Microbial use of organic Effect of no tillage on Evaluation of silicon oxyhydroxides in the evaluation of human amendments in saline Vertisol hydrodynamic stocks and uptake in five humid tropics : a story of health risk due to soil soils monitored by properties forest stands on an acid interactions between pollution and urban soil changes in the 13C/12C brown soil bacteria-organic matter management ratio Rachid Moussadek and mineral (Ghent, Belgium) Jean-Thomas Cornélis Laura Poggio Khalid Khan (Louvain-la-Neuve, Jacques Berthelin (Ispra, Italy) (Witzenhausen, Belgium) (Vandoeuvre les Nancy, Germany) France) 61 61 61 61 61 The hydromechanical Development of a Reducing the effect of A comparison of the Weathering state of response of soils with bottom-up approach for salinity impact on two effects of conventional coarse soil fragments different clay mineralogy soil indicators: organic wheat cultivars using and organic farming affects nutrient uptake by to biological exudates carbon and soil loss biofertilization,antioxidant practices on soil physical tree seedlings assessment for the and micronutrients and hydraulic properties Pierre Barré Italian territory in the UK Nina Koele (Dundee, United Maybelle Gaballah (Freiburg, Germany) Kingdom) Paolo Giandon (Cairo, Egypt) Laura Hathaway-Jenkins (Castelfranco Veneto, (Cranfield, United Italy) Kingdom) 61 61 61 Pouloud, a modelN to Nutrient movement and Hidden fluxes of organic predict the soil aggregate losses from irrigated matter- the importance of stability dynamics after warm climate vineyards canopy-derived the input of an organic in Australia particulate organic matter product (POM) in forest Jonathan Holland ecosystems Samuel Abiven (Wagga Wagga, Beate Michalzik (Zürich, Switzerland) Australia) (Jena, Germany) 61 61 Modelling of water and Calcium and magnesium nitrate dynamics in sandy content in throughfall and soils in consideration of seepage waters under forage cropping systems Norway spruce stands in - integration of dynamic a mountain area affected plant growth for by liming grassland and maize in a soil - plant - atmosphere Jiri Kulhavy - transfer model (Brno, Czech Republic)
Yvonne Conrad (Kiel, Germany) MON TUE THU FRI 6\PSRVLD±)ULGD\$XJXVW±%ORFN1 ±
+6 HS 7 +6 +6$ %|FNOVDDO 61 &RQQHFWLQJ6RLOWR 6RFLHW\
Chair: Mireille Dosso Montpellier, France
61 Soils and Soil related Subjects on Stamps
Hans-Peter Blume (Kiel, Germany)
61 Ecological aesthetics as catalyst for the discovery of soil as living space
Beatrice Voigt (Muenchen, Germany)
61 Soil and Art- on the aesthetics of dirt
Gerd Wessolek (Berlin, Germany)
61 Connecting soil to society - experiences of different approaches from Scotland
Willie Towers (Aberdeen, United Kingdom)
61 N Action Soil of the Year in Germany
Monika Frielinghaus (Müncheberg, Germany)
&ORVLQJ of the session
Monika Tulipan (Vienna, Austria)
MON TUE THU FRI 3RVWHUV
7KHUHDUHIRXUGLIIHUHQWSRVWHUVHVVLRQV
3RVWHU6HVVLRQ 6HVVLRQ 6HVVLRQ 6HVVLRQ 6HVVLRQ 'LVSOD\'DWH Monday, August 25 Tuesday, August 26 Thursday, August 28 Friday, August 29 3RVWHU1XPEHU 3±3 3±3 3±3 3±3 3UHVHQFHDW3RVWHU 3RVWHU0RXQWLQJ7LPH 3RVWHU5HPRYDO7LPH
3RVWHU%RDUGYou will find your poster board number in the author index at the end of the abstract book as well as in this programme. Staff at the poster service desk will assist you to find your poster board and provide you with adhesive material.
3UHVHQFH DW SRVWHUV In order to enable discussion and interaction with other participants, we request the main author or another member of the group to be at the poster board at the times noted above. If this is not possible, we request the authors to leave a note on the poster indicating the times when they will be present at the board.
3OHDVHQRWH that the organisers cannot assume any liability for loss or damage of posters displayed in the poster area. Posters that are not removed by 18.00 hrs on the day of the respective Session, will be removed by staff and will not be stored or sent to the author after the meeting.
3OHDVHILQGDOLVWRIWKHWRSLFVSUHVHQWHGLQWKHUHVSHFWLYHVHVVLRQEHORZ
3RVWHU6HVVLRQ666666666 3RVWHU6HVVLRQ66666$6%6 3RVWHU6HVVLRQ666666 3RVWHU6HVVLRQ666666666 Poster plan Poster Award Poster Award Finalists Area to Registration Area to Registration D Poster Area 3 Exhibition Poster Area 2 Level 1 Level 0 Poster Area 1 Poster Session 1 (Monday, 25 August, 2008)
P014 Prediction of soil retention curve in some S20 Soil Classification (Poster Area 1) saline-sodic soils of Iran by using of Rosetta software Hojat Emami (Karaj, Iran) P001 Genesis and classification of some soils derived P015 Modeling soil permeability based on fuzzy system from gypsiferous and calcareous material in Wadi el- for calcareous soils in Marbore watershed, Iran Sheikh, Beni Suef, Egypt Hojjat Ghorbani Vaghei (Tehran, Iran) Gamil Ageeb (Cairo, Egypt) P016 Response of soil dehydrogenase activity to varied P002 Spectrophotometric method of Soil Classification conditions of water potential and oxygen availability Ali Jafarov (Baku, Azerbaijan) Agnieszka Wolinska (Lublin, Poland) P003 Using a geopedologic approach to increase soil- P017 Evaluating local soil-root interactions with 3D plant map unit purity: a case study of Aqqaleh area, Iran scale models Siros Shakeri (Tehran, Iran) Tom Schröder (Jülich, Germany) P004 An optimal approach for quantitative land suitability P018 Soil micromorphological features in soil hydraulic evalution using geostatistics, remote sensing (RS) properties obtained using three various techniques and geographic information system (GIS) Radka Kodesova (Prague, Czech Republic) Mostafa Emadi (Shiraz, Iran) P019 Verification of capillary crumbling model for P005 Proposed Canadian approach for enhanced A estimation of optimum soil water content for tillage in horizon designations for characterizing topsoil western Iran quality Mohammad Reza Mosaddeghi (Hamadan, Iran) Catherine Fox (Harrow,ON Canada) P020 Physical-statistical model of dielectric permittivity in P006 The system of the land-capability classification in soil Poland Boguslaw Usowicz (Lublin, Poland) Piotr Sklodowski (Warsaw, Poland) P021 Model analysis of water balance sensitivity to P007 Burnt soils and proposal of their position in National uncertainty in plant root distribution under different classification climate, moisture and soil conditions Izet ýengiü (Sarajevo, Bosnia and Herzegovina) Gernot Bodner (Vienna, Austria) P008 Correlation problems with WRB of some soils of the P022 Monitoring soil solution electrical conductivity in Sopron- Neusiedler See region agricultural field Márta Fuchs (GödöllĘ, Hungary) Raimo Sutinen (Rovaniemi, Finland) P023 A 3D structural model of a lignitic mine soil based on classification and interpolation of profile images Horst Gerke (Muencheberg, Germany) S30 Micromorphological and mineralogical features P024 Rainfall electrical conductivity evaluation in two (evidence) of soil environmental change (Poster Area 1) different locations in South Brazil Francine Calil (Santa Maria, Brazil) P009 Major problems in quantifying amorphous silica in P025 The effect of debris layers on the water balance of soils an urban soil profile Anna Danilova (Stuttgart, Germany) Katharina Appel (Berlin, Germany) P010 Impact of pollution on the clay mineralogical P026 Laboratory-scale modelling and observation of composition of some soils from Zlatna zone LNAPL - APL transport in porous media (Romania) Svatopluk Matula (Prague, Czech Republic) Constantin Craciun (Bucharest, Romania) P027 Design and analysis of structures in and on P011 Clay mineralogy influence on the physical and expansive soils chemical properties of vertisols from Romania Hussein Elarabi (Khartoum, Sudan) Victoria Mocanu (Bucharest, Romania) P028 The occurrence of soil water repellency under P012 Black carbon fall out impact on soil life in Copsa different vegetation and land uses in central Iran Mica-Romania Mohammad Hajabbasi (Isfahan, Iran) Daniela Raducu (Bucharest, Romania)
S19 Soil Forming Processes and Soil Morphology 66RLODQG:DWHU±7KHRU\ 3RVWHU$UHD (Poster Area 1)
P013 Derivation of Pedo-transfer functions for predicting P029 Surface water chemistry: the key to partitioning soil retention curve in some saline and saline-sodic matter sources and assessing carbon cycle soils of Iran parameters Hojat Emami (Karaj, Iran) Mikhail Semenov (Irkutsk, Russian Federation)
MON TUE THU FRI Poster Session 1 (Monday, 25 August, 2008)
P030 Soil evolution in a dune coastal ecosystem of north- P047 Influence of podzolization soil-forming process on eastern Sardinia physical and chemical transformation of the quartz Gian Franco Capra (Nuoro, Italy) grains surface Józef Chojnicki (Warszawa, Poland) P031 Chronosequential alterations of properties of post- agrogenic sandy southern taiga soils of Russia under self-restoration Olga Kalinina (Oldenburg, Germany) P032 Genesis and characteristics of clay rich subsoil S23 Rhizosphere Processes (Poster Area 1) horizons in two soils on limestone at the Teutoburg Forest/Germany Klaus Mueller (Osnabrück, Germany) P048 The effect of Rhizobium phaseoli and Plant Growth Promoting Rhizobacteria (PGPR) on Yield and Yield P033 Unmixing parent materials of soils using linear Components in Bean [Phaseolus vulgaris] Seeds combination of sand fractions on a catena in western Mehrab Yadegari (Shahrekord, Iran) France Celine Collin Bellier (Orleans, France) P049 Changes in inorganic phosphorus fractions and availability in rhizosphere of rice in P-fertilized soils P034 Phosphorus compaunds in soils with bog iron ore Nosratollah Najafi (Tabriz, Iran) horizons or iron precipitations Lidia Oktaba (Warsaw, Poland) P050 Screening different wheat genotypes for improving Fe and Zn efficiency P035 The impact of carbon management on the soil's MirHassan Rasouli Sadaghiani (Urmia, Iran) macropore structure in an orchard Markus Deurer (Palmerston North, New Zealand) P051 Using stable isotope techniques to investigate above- and below-ground carbon transformation P036 Soils of temporary ponds in the Doñana National processes in model plant-soil ecosystems Park (SW Spain) - Morphological traits and water Juergen Esperschuetz (Neuherberg, Germany) persistence Patricia Siljeström (Sevilla, Spain) P052 Evaluation of phosphorus efficiency in Iranian cereals in a P-defficient calcareous soil P037 Soil development on spongilitic marlstones in natural Ebrahim Sepehr (Tehran, Iran) and human impacted systems at selected localities of Prague (Czech Republic) P053 Biocontrol of Gaeumannomyces graminis and Anna Zigova (Prague, Czech Republic) Rhizoctonia solani by Azotobacter chroococcum. Reza Ghorbani Nasrabadi (Gorgan, Iran) P038 Meliorative memory of gypsic pedofeatures Marina Lebedeva-Verba (Moscow, Russian P054 The impact of PGPR on soybean plants Federation) development Marius Stefan (Iasi, Romania) P039 Formation of Cambic B horizons in Western Carpathians, their characterization and classification P055 Effects of crops on solute transport in undisturbed Emil Fulajtar (Bratislava, Slovakia) soil Sarah Garre (Juelich, Germany) P040 Pedogeochemical correlation of evoluated soils on secondary volcanic products from Gurghiu and P056 Micro push-pull tests to investigate rhizosphere Hargita Mountains (Eastern Carpathians, Romania) processes Constantin Rusu (Iasi, Romania) Kajsa Knecht (Zürich, Switzerland) P041 The mineralogy and geochemistry of some hortic P057 ::7)SURMHFW³0DWKHPDWLFVDQGUKL]RWHFKQRORJ\ antrosols - case study: glasshouses from Iasi and Mathematical methods for upscaling of rhizosphere Bacau Cities (Romania) FRQWUROPHFKDQLVPV³ Feodor Filipov (Iasi, Romania) Sabine Klepsch (Vienna, Austria) P042 The contetnts of easily mobile forms of Mn, Cr and P058 Interaction of phosphate and organic acids in soil: Ni in rankers on the serpentinite masiffs in Serbia adsorption and desorption dynamics Aleksandar Djordjevic (Belgrade/Zemun, Serbia) Eva Oburger (Vienna, Austria) P043 Shrinkage behaviour of organic soils in a North P059 Does carbon flow from mycorrhizal fungi stimulate German catchment affected by water table bacterial antibiotic production? drawdown Eleni Siasou (Aberdeen, United Kingdom) Stephan Gebhardt (Kiel, Germany) P060 Characterization of plant-growth promoting P044 Assessing the soil structure dynamics under diazotrophic bacteria isolated from the rhizosphere sustainable agricultural management, by the of field-grown Chinese cabbage identification of biogenic and physicogenic features Woo Yim (Chungbuk, Republic of Korea) Denis Piron (Rennes, France) P061 Effect of Azospirillum and Azotobacter inoculation P045 Mineralogical contents of Vertisol type soils from the with microelements as foliar and soil application on South of Serbia qualitative and quantitative traits of four wheat Sladjana Golubovic (Belgrade/Zemun, Serbia) cultivars after corn planting in Iran Abdollah Bahrani (Ramhomoz, Khozastan, Iran) P046 Some aspects of the soil cover in the eastern part of the Romanian Plain Gherghina Carmen-Alina (Bucharest, Romania) MON TUE THU FRI Poster Session 1 (Monday, 25 August, 2008) P062 Flavonoids of white lupin roots participate in Phosphorus mobilization from soil Giancarlo Renella (Florence, Italy) S27 The Influence of Soil Quality on Human Health and Food Security (Poster Area 1) P063 Cellulase activity in rhizosphere of some agronomical plants Ali Akbar Safari Sinegani (Hamadan, Iran) P078 Evaluation of distance cultivation effects and ethylen spray on fruit and seed production in squash P064 The effect of soil pollution on some rhizospheric Mehrab Yadegari (Shahrekord, Iran) biological properties Ali Akbar Safari Sinegani (Hamadan, Iran) P079 Antibiotic uptake by plants from soil amended with antibiotic-treated swine slurry P065 Influence of ectomycorrhizae on heavy metal uptake Youngho Seo (Chuncheon, Republic of Korea) by Populus tremula Ingrid Langer (Vienna, Austria) P080 Distribution and biological availability of Rare Earth Elements in soils of Hesse, Central Germany P066 Rhizosphere alkalisation: a major process controlling Mareike Loell (Giessen, Germany) Cu (bio)availability for durum wheat cropped in a former acidic vineyard soil P081 Potential influencing factors on Nitrate accumulation Matthieu Bravin (Montpellier, France) in Rocket salad: Field experiment in Battipaglia, Italy Gorana Rampazzo Todorovic (Vienna, Austria) P067 Comparison of different methodical approaches to evaluate the plant root growth P082 The Effects Of MSW Compost Applications On The Olga Muter (Riga, Latvia) Yield And Heavy Metal Accumulation In Potato Plant (Solanum Tuberosum L.) P068 Fungal denitrification in arable soil Bulent Topcuoglu (Antalya, Turkey) Miriam Herold (Dundee, United Kingdom) P083 The Effects Of Sewage Sludge On The Plant P069 Magnetic resonance imaging technique to study the Nutrients And Heavy Metal Contents Of Strawberry distribution of nickel in rhizosphere (Fragaria X Ananassa Duch) Plant Ahmad Moradi (Zürich, Switzerland) Mehmet Onal (Antalya, Turkey) P070 The interactions of soil microorganisms with plant roots: implications for trace element biofortification Monica Marchetti (Zürich, Switzerland) P071 Soil-dependent, opposite colonization tendency of 66RLO(FRORJ\±6RLODV/LYLQJ6SDFH 3RVWHU$UHD symbiotic- and food-safety important microbes in the rhizosphere of green-pea at long-term sewage sludge applications P084 Effects of arbuscular mycorrhizal fungi on mineral Borbala Biró (Budapest, Hungary) composition and yield of tomato under salinity condition P072 Mathematical Modeling of Sorption Competition Mohsen Barin (Urmia, Iran) between Phosphate and Root Exudates Daniel Leitner (Vienna, Austria) P085 Effects of Azospirillum, Azotobacter, Mesorhizobium and Pseuodomonas inoculants on growth, yield and nutrient uptake of chickpea (Cicer arietinum L.) under field conditions Asad Rokhzadi (Tehran, Iran) S25 Memory Function of Recent and Paleosoils P086 Changes of biological properties of soils the South of (Poster Area 1) Russia under influence of electromagnetic fields Tatyana Denisova (Rostov-on-Don, Russian Federation) P073 Memory function of carbonates: use of carbonate pedofeatures for paleoreconstructions P087 The role of the biological potential of the microflora Irina Kovda (Moscow, Russian Federation) in ensuring the soil fertility in natural and anthropic influenced ecosystems P074 Subalpine-alpine soil formation during lateglacial Geanina Bireescu (Iasi, Romania) period? Results from the archaeological site Ullafelsen in the Fotscher Valley (Tyrol, Austria) P088 Mountainous Greek soils and status of nutrients in Clemens Geitner (Innsbruck, Austria) native vegetation and perennial plants Theodore Karyotis (Larissa, Greece) P075 An approach for studying phytolith profiles of recent soils in different landscape zones of Hungary - P089 Increasing incubation time enhances cadmium Methods and first results toxicity on soil alkaline phosphatase activity Ákos PetĘ (GödöllĘ, Hungary) Farshid Nourbakhsh (Isfahan, Iran) P076 Quantitative analysis of relief-soil memory P090 Impact of eco-physiologically different earthworms Andrey Mitusov (Kiel, Germany) on soil water characteristics Gregor Ernst (Trier, Germany) P077 The "Red Outcrop" of Langenlois: soil and rock mineralogy, geochemistry, micromorphology and P091 Organic amendments influence nitrification and paleopedology denitrification in restored semiarid soils: a genetic Edith Haslinger (Vienna, Austria) and functional approach Alfredo Pérez-de-Mora (Neuherberg, Germany)
MON TUE THU FRI Poster Session 1 (Monday, 25 August, 2008) P092 Shifts in soil microbial biomass and enzyme P108 Soil microbial biomass indicators and primary activities due to different combined additions of succession on a spoil heap manure and the antibiotic sulfadiazine Tibor Szili-Kovács (Budapest, Hungary) Sören Thiele-Bruhn (Trier, Germany) P109 Differences in soil yeast communities reflect human P093 Influence of rape oil on the phenanthrene degrading impact on forest biotope soil community structure in a Haplic Czernozem-a Andrey Yurkov (Bochum, Germany) 13C PLFA study Maren Mellendorf (Vienna, Austria) P110 The changes of soil reaction after application of fly ash pellets P094 Effects of Land Use Change on Soil Chemical and Jan Hrubý (Troubsko, Czech Republic) Biological Properties in Tropical Mexico Violette Geissen (Villahermosa, Mexico) P111 Functional and genetic diversity of bacterial communities in reclaimed and spontaneously P095 The effect of the preparation for straw developing mine soils decomposition acceleration and different tillage on Maria NikliĔska (Kraków, Poland) soil enzyme activity Borivoj Sarapatka (Olomouc, Czech Republic) P112 Changes in bacterial communities along a Latosol- Podzol sequence of the upper Amazon basin P096 Decomposition and diffusion of plant litter products Marion Bardy (Paris, France) Roland Fuß (Oberschleißheim, Germany) P113 Uses of compost from urban refuse (CUR) to P097 Establishment of ecologically safe concentration of recover the soil biological activity after the pollution chernozem by ordinary heavy metals (Cr, afforestation of a burnt forest area. Cu, Ni, Pb) in modelling experiment Carlos Rad (Burgos, Spain) Mariya Zharkova (Rostov-on-Don, Russian Federation) P114 Soil ecosystem modelling by means of PCA metasyntactic variable evaluation of metabolomics, P098 Influence of heavy metals (Pb, Cu, Cr, Ni) and faunal diversity,and bioactivity screening petroleum on biological properties of brown deserted Gert Bachmann (Vienna, Austria) soil Natalia Spivakova (Rostov-on-Don, Russian P115 Management-induced microbial dynamics in paddy Federation) soils of SE-China Thilo Eickhorst (Bremen, Germany) P099 Changes in soil microbial community structure during repeated vegetable oil applications and P116 Characterization of soil fungal communities in different soil water contents using [13C] PLFA samples representing different agricultural and forest techniques soils Andrea Fuhrmann (Vienna, Austria) Lelde Grantina (Riga, Latvia) P100 Seasonal variations in soils enzyme activity P117 Effect of Imicyafos on nematode and microbial Evgeniya Dadenko (Rostov-on-Don, Russian communities in soil Federation) Satoko Wada (Naka-cho Koganei Tokyo, Japan) P101 Influence of magnetic fields on germination of seeds P118 Thiosulfate oxidation pathway and plant growth of redish promotion potential of Proteobacteria and Alexandra Fursova (Rostov-on-Don, Russian Actinobacteria isolated from crop plants Federation) Woo Yim (Chungbuk, Republic of Korea) P102 Biological parameters of the hydrogenic soil of P119 Contributions to heavy metals removal from Caspian lowland contaminated soil using acid and chelating agents Yulia Kuznetsova (Rostov-on-Don, Russian Mihaela Ulmanu (Pantelimon, Romania) Federation) P120 Characterization of cultivable methylotrophic P103 The detritusphere as biogeochemical interface for bacterial communities associated with traditionally bacterial and fungal degradation of MCPA and cultivated field-grown rice cultivars - population phenanthrene dynamics and potential for plant-growth promotion Holger Pagel (Stuttgart, Germany) Tong Sa (Cheongju, Republic of Korea) P104 Restoration of a soil grassland microbial community P121 Isolation, characterization of phosphate solubilizing with respect to carbon accumulation and bacteria from the rhizosphere and their inoculation mineralization after previous fertilization effect of encapsulated cells on plant growth and Stanislav Maly (Brno, Czech Republic) nutrient uptake In Hong (Chungbuk, Republic of Korea) P105 Effect of mineral fertilization with azote and phosphorous on earthworms (Lumbricidae) in P122 Colonization of plant roots and leaves by plant- conditions of a mollic preluvosoil from west of growth promoting Methylobacterium characterized Romania by confocal and scanning electron microscopy and Madalina Iordache (Timisoara, Romania) its persistence in the rhizosphere Tong Sa (Cheongju, Republic of Korea) P106 Long term effects of sewage sludge disposal on organisms in an arable soil P123 Potential for nutrient solubilization and plant growth Sylvia Kratz (Braunschweig, Germany) promotion by bacterial strains isolated from crucifer specialist - Plutella xylostella (Lepidoptera: P107 Biological and biochemical parameters in the plutellidae) gut rhizosphere at a heavy metal polluted floodplain In Hong (Chungbuk, Republic of Korea) Tibor Szili-Kovács (Budapest, Hungary) MON TUE THU FRI Poster Session 1 (Monday, 25 August, 2008) P124 Recovering of fungal wastes: a soil microscale P139 Investigation of Existence and Probability of monitoring on ammonia oxidizers Hydrocarbon Pollution in Groundwater around Sari Paolo Nannipieri (Firenze, Italy) Antibiotic Factory Soheila Ebrahimi (Tehran, Iran) P125 Linking N2O concentrations in different soil depths to denitrification genes abundances under the P140 Methodology of rating of anthropogenic influence on influence of an elevated atmospheric CO2 soil on the basis of infringement of its ecological concentration functions Ellen Kandeler (Stuttgart, Germany) Sergey Kolesnikov (Rostov-on-Don, Russian Federation) P126 Effect of management regime on the soil enzymatic activities in a mediterranean grassland P141 New developments in standardisation of leaching Olga Gavrichkova (Viterbo, Italy) procedures in Germany Ute Kalbe (Berlin, Germany) P127 Abundance and community composition of nitrifiers and denitrifiers in various agricultural soil habitats P142 Mechanochemical transformation of organic Katrin Ripka (Seibersdorf, Austria) pollutants: the catalytic efficiency of phyllomanganate in catechol and pentachlorophenol P128 Examination the properties of soils originating from degradation different hungarian regions Maria Pizzigallo (Bari, Italy) Ágnes Zsupos Oláh (Debrecen, Hungary) P143 The impact of technogenic iron compounds of P129 Influence of earthworms, mycorrhiza and plant roots industrial dusts on the formation of magnetic and on soil bacterial metabolic community pattern geochemical anomalies of forest soils in south Roxane Milleret (Neuchâtel, Switzerland) Poland and the border areas (Czech Republic, P130 Use of biological parameters for diagnostics of Germany) pesticid pollution of the south Russia soils Zygmunt Strzyszcz (Zabrze, Poland) Ekaterina Loseva (Rostov-on-Don, Russian P144 Effects of waterlogging and organic matter on Federation) stabilization of Zn in two Zn-spiked soils with P131 Enhancement of soil functional stability by organic different reaction amendment and possible contribution of aggregated Shahin Oustan (Tabriz, Iran) soil structure P145 Ecotoxicological assessment of a vegetable oil Koki Toyota (Koganei, Japan) based in-situ remediation technique for PAH P132 Influence of vegetation on enzyme activity of contaminated soils ordinary chernozem Berndt-Michael Wilke (Berlin, Germany) Alexander Larikov (Rostov-on-Don, Russian P146 Pollution effect by black oil on biological properties Federation) of soils P133 In situ unsaturated transport of cow manure-borne Elena Rotina (Rostov-on-Don, Russian Federation) E. coli through the soil P147 Modelling pollution of the leeching compact Mohammad Bagher Farhangi (Hamadan, Iran) chernozem by black oil to establish ecological save P134 N mineralization-nitrification indicators in 50 beech concentration forests (Fagus sylvatica L.) in Northeastern France Vladimir Gaivoronskiy (Rostov-on-Don, Russian Kasaina Andrianarisoa (Nancy, France) Federation) P135 Effect of nitrogen source and period of application P148 Cu and other metals mobilization from polluted soil on some soil biological properties under common by various chelating agents, and their uptake by bean maize and Indian mustard in the experiment on Talles Dos SANTOS (Coruña, Spain) induced phytoextraction Anna Karczewska (Wrocáaw, Poland) P136 Microbial processes in soils at the micro-scale - )LQGLQJWKHQHHGOHLQWKHKD\VWDFNRU³2KDFWLYLW\ P149 Assessing the P retention capacity of a low value ZKHUHDUWWKRX"´ soil sealant from an acid mine drainage site Anke Herrmann (Newcastle, United Kingdom) Owen Fenton (Wexford, Ireland) P137 Soil biological activity along an elevation gradient in P150 Development of model substances for heavy metal the Chatkal Biosphere Reserve in Uzbekistan contaminated soil constituents Laziza Gafurova (Tashkent, Uzbekistan) Anna Danilova (Stuttgart, Germany) P151 Remediation of a site contaminated with heavy fraction-hydrocarbons using biopiles Jessica López Olvera (Distrito Federal, Mexico) S11 Management of Contaminated Soils (1): practical P152 Evaluation of phytotoxicity of soils contaminated with applications (Poster Area 3) fuel hydrocarbons by using cluster analysis method Daniel Tunega (Vienna, Austria) P138 Serbian soil uranium contamination and complex P153 Chrysene adsorption on a Portuguese loamy sand strategy for remediation soil Stojanoviü Mirjana (Belgrade, Serbia) Aline Schneider Teixeira (Braga, Portugal) P154 Heavy metal uptake by grass biomass after amelioration of contaminated acid soil Maya Benkova (Sofia, Bulgaria) MON TUE THU FRI Poster Session 1 (Monday, 25 August, 2008) P155 Mercury contamination of soil, stream and overbank P173 Dynamic of metals (Ni and Cr) in elution waters from sediments associated with cinnabar mineralization ultramafics ores columns, implications in the (Trsce, Croatia) revegetalisation of nickel mining sites Helena Bakic (Zagreb, Croatia) Sophie Raous (Nancy, France) P156 Field Experiments of Induced Phytoextraction - P174 Spatial distribution and vertical gradient of Cu and Case Study in Hungary Zn near a valley rim in grey forest soil Viktóra Cser (Szeged, Hungary) Peter Shary (Pushino, Russian Federation) P157 Immobilization of heavy metals in soil using P175 Vertical migration of heavy metals in soils nanoparticles produced from zeolitic tuff contaminated by sewage sludge Ayoup Ghrair (Stuttgart, Germany) Tatiana Bolysheva (Moscow, Russian Federation) P158 Influence of experimental boundary conditions on P176 Speciation and phytoavailability of copper from the release of PAHs during column percolation tests vineyard soil as influenced by bacterial siderophores Wolfgang Berger (Berlin, Germany) Jean-Yves Cornu (Colmar, France) P159 Effects of N and P on degradation of crude oil in two P177 Heavy metal contamination and health risk soils assessment in soils from Portman bay Syafruddin Syafruddin (Vienna, Austria) Carmen Perez-Sirvent (Murcia, Spain) P160 Heavy Metals in Hortisols of the Holy Mountain P178 Biodegradable product using for enhancincing the Athos, Greece bioremediation efficiency of petroleum hydrocarbons Peter Trueby (Freiburg, Germany) polluted soils Anca-Rovena Lacatusu (Bucharest, Romania) P161 Monitoring of heavy metals contents (Cu, Zn, Pb and Ni)in the surrounding soils of thermal power plants in Romania Loredana Popescu (Bucharest, Romania) P162 Effects of methill-parathion, carborfuran and lambbacyhalotrina insecticides on soil biological activity Duilio Torres (Barquisimeto, Venezuela) P163 Effects of Oxifluorfen, Fluaxifop and Pendimentalin Herbicides on soil biological activity Nectali Rodriguez (Coro, Venezuela) P164 Immobilization of As(V) in aqueous solutions by zerovalent irons Jae E. Yang (Chuncheon, Republic of Korea) P165 The estimation of the pollution degree in the vicinity of the industrial area near Bucharest Teodor Velea (Pantelimon, Romania) P166 Gold mining in Apolobamba (Bolivia) and heavy metals pollution: Diagnosis according to different legislations Tania Terán-Mita (Cartagena (Murcia), Spain) P167 Effect of salinity on the plant germination in the context of soil toxicity Olga Muter (Riga, Latvia) P168 Biogeochemical approaches to estimating permissible inputs of acidifying compounds and heavy metals in the urban ecosystems Irina Priputina (Pushchino, Russian Federation) P169 A model of pollutant transport along the land surface Olga Mitusova (Kiel, Germany) P170 Effect of a large copper ore tailings impoundment on heavy metal concentrations in soils Cezary Kabala (Wroclaw, Poland) P171 An approach to diminish ecological risks of soil contamination by a liquid pollutant Andrey Mitusov (Kiel, Germany) P172 Phytoremediation of polluted soils: interactions between roots and heavy metals Arnaud Gauthier (Villeneuve d'Ascq, France)
MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008)
P196 Use of NIRS technology for the determination of S01 Soil Organic Matter (Poster Area 1) į13c in soils with 16 years of application of different tillage and residue management systems P179 Tillage-induced carbon inputs in soil in rice-wheat Inmaculada González-Martín (Salamanca, Spain) FURSSLQJV\VWHP)DUPHU¶s participatory studies P197 Vermicomposting influences solid wastes Nanak Pasricha (Dundahera, Gurgaon, India) decomposition kinetics in soils P180 Physical protection of soil organic matter in Nasim Reshadi-nezhad (Isfahan, Iran) aggregates of forest soils with mechanized P198 Elemental composition and molecular weights of harvesting and site preparation techniques humic acids physically independent components Nahia Gartzia Bengoetxea (Derio, Spain) Evgeny Milanovskiy (Moscow, Russian Federation) P181 Oxidability of soil organic matter of forest soils with P199 Cropping system effects on carbohydrate content in potassium permanganate. Application to the two soils of central Iran fractionation of organic carbon forms Mohammad Hajabbasi (Isfahan, Iran) Marisa Ibargoitia (Derio, Spain) P200 Study of organic matter effects on physico-chemical P182 Study of the relationship between oxidability of soil changes of different Soils organic matter of forest soils with potassium Akbar Forghani (Rasht, Iran) permanganate and main functional groups Marisa L. Ibargoitia (Bizkaia, Spain) P201 Determination of soil organic carbon using near- infrared spectroscopy P183 Influence of compost on morphological and Mima Todorova (Stara Zagora, Bulgaria) chemicalproperties of sandy soils, Egypt Monier Wahba (Cairo, Egypt) P202 Managing soil organic carbon in irish agricultural systems P184 Soil Organic Matter and Aggregate stability as Marta Dondini (Dublin, Ireland) affected by land-use and soil management Hermine Dameni (Beijing, China) P203 Impact of litter quality on mineralization processes in top soils of South Ecuador P185 Comparison of composting and vermicomposting Karin Potthast (Tharandt, Germany) processes during decomposition of solid wastes Kazem Hashemimajd (Ardebil, Iran) P204 Concentrations of carbon, nitrogen, phosphorus and sulphur and activities of some hydrolytic enzymes in P186 Changes in organic carbon distribution in different a Luvisol fertilized with farmyard manure and sizes of soil aggregates in semi-arid regions of Iran mineral nitrogen Mostafa Emadi (Shiraz, Iran) Jan Koper (Bydgoszcz, Poland) P187 Spatial variability of different soil organic carbon P205 The fate of phenolic constituents during peat pools in a high-elevation Norway Spruce forest humification processes Sandra Spielvogel (Freising, Germany) Teodoro Miano (Bari, Italy) P188 Organic compounds related to soil hydrophobicity in P206 Influence of the peat humic fraction on Br and Hg total extracts from accelerated solvent extraction cycles (ASE) Teodoro Miano (Bari, Italy) Irena Atanassova (Swansea, United Kingdom) P207 Soil organic matter content in top-soils of Germany P189 Soil organic matter stabilization and land-use Jens Utermann (Hannover, Germany) change in tropical ecosystems Joseph Kimetu (Ithaca,NY United States) P208 Quantification and characterisation of aerial and underground litter of Miscanthus, a perennial energy P190 Effects of tillage and N fertilization on soil respiration crop: ability to soil biodegradation in a mediterranean semiarid agroecosystem Norbert Amougou (REIMS, France) Francisco Joaquín Morell-Soler (Lleida, Spain) P209 Humification degree in Chernozems determined by P191 Soil aggregation as affected by tillage in fluorescence spectroscopy mediterranean semiarid agroecosystems Lubica Pospisilova (Brno, Czech Republic) Jorge Álvaro-Fuentes (Lleida, Spain) P210 Influence of different types of organic matter on the P192 1H-NMR and 13C-NMR spectroscopy of chernozem soils reducing conditions soil humic acid fractionated by tandem SEC-PAGE Franco Ajmone-Marsan (Grugliasco, Italy) Oleg Trubetskoj (Pushchino, Russian Federation) P211 Estimation of DOC fluxes under Miscanthus and P193 Tandem ultrafiltration - PAG electrophoresis as a Lolium pasture; effects of land use change tool for isolation of soil humic acid fluorescence Niamh Smyth (Dublin, Ireland) species Olga Trubetskaya (Pushchino, Russian Federation) P212 Fluorogenic assay of N-acethylglucosaminidase and its spatio-temporal variability in the litter layer of P194 The role of photo-degradation in the global carbon coniferous forest cycle Carolin Penne (Hannover, Germany) Bente Foereid (Aberdeen, United Kingdom) P213 Rendzins humus conditions of the Black Sea coast P195 Impact of applaying different tillage and residue Mihail Kutrovski (Rostov-on-Don, Russian management systems after 16 years on soil carbon Federation) using į13C abundance Mariela Fuentes (Texcoco, Mexico) MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008) P214 Content of total carbon and nitrogen in fractions of P230 Soil organic matter storage in tropical soils under no- humus after long-term fertilization tillage systems (Madagascar) Jolanta Janowiak (Bydgoszcz, Poland) Martial Bernoux (Montpellier, France) P215 Soil organic matter stability and radionuclides P231 Isolation of humic acids from SOM by use of soil availability to plants microorganisms Anastasiya Tulina (Pushchino, Russian Federation) Alexey Stepanov (Moscow, Russian Federation) P216 Characterization of Soil Organic Matter (SOM) from P232 Soluble organic carbon in solutions of various soils Brazilian Umbrisol by 13C NMR spectroscopy and inhibits phosphatase activity ; quantification and oxidative degradation identification of inhibitors using fluorescence Marta Velasco-Molina (Santiago de Compostela, spectroscopy Spain) Siobhán Staunton (Montpellier, France) P217 15N-DNA Stable isotope probing and active soil P233 Soil humic substances and microbial communities microbial community in plant residue decomposition as functions of parent material, slope exposure and process stand age in spruce forests Mingrelia Espana (Stuttgart, Germany) Giuseppe Concheri (Legnaro, Italy) P218 Fertilizer type and rate: effects on labile carbon and P234 On the possibility of a low-temperature LOI method nitrogen pools in a long-term trial on a sandy to an assessment of soil organic matter Cambisol Karel Fiala (Rapotin, Czech Republic) Felix Heitkamp (University of Kassel, Germany) P235 Changes of content of soil organic matter of P219 Soil organic carbon and nitrogen dynamics in soils chernozems in Middle Moravia region amended with organic residues VítČzslav Vlþek (Brno, Czech Republic) Vasileios Antoniadis (Orestiada, Greece) P236 Evaluation of 1H NMR relaxometry for the P220 Decomposition of tropical tree litters: Impact of litter assessment of SOM swelling in soil samples quality on C mineralization kinetics and soil organic Fabian Jaeger (Koblenz, Germany) matter characteristics Isabelle Bertrand (Reims, France) P237 Does the Rothamsted Carbon Model (RothC 26.3) properly predict soil carbon turnover and storage in P221 The Role of Organic Matter in Improving the arable soils under Pannonian climate conditions? Physico-chemical and Biological Properties of Gorana Rampazzo Todorovic (Vienna, Austria) Agricultural Soils Soheila Ebrahimi (Tehran, Iran) P238 Estimation of the lignin content in plants and soils - literature review and experimental approaches P222 Mineralization rates of SOC in forest Andosols of the Samuel Abiven (Zürich, Switzerland) Canary Islands Antonio Rodríguez Rodríguez (La Laguna, Spain) P239 Soil Organic Carbon Fractions and Aggregate Stability in Carbonated and No Carbonated Soils in P223 Effect of temperature and depth on peat soil ability Tunisia for methane oxidation Abdelhakim Bouajila (El Manar II, Tunisia) Anna Szafranek-Nakonieczna (Lublin, Poland) P240 Effects of soil organic matter conformation on the P224 Effect of soil tillage systems on soil organic matter formation and release of bound residues of (SOM). Evaluation with traditional and advanced xenobiotics analytical techniques Anastasia Shchegolikhina (Bochum, Germany Rosa Francaviglia (Roma, Italy) P241 Composition and distribution of physical organic P225 Influence of long organic and mineral fertilization on matter fractions in steppe soil profiles (Calcic soil fertility Chernozems) as influenced by grazing intensity Rossitza Mitovska (Sofia, Bulgaria) Angelika Kölbl (Freising, Germany) P226 Advanced solutions for non-invasive spectroscopic P242 Soil carbon dynamics in a 200-years forest techniques for the characterization of soil organic chronosequence matter (SOM) quality - Investigation on the lipid Mickael Hedde (Versailles, France) fraction composition in soils from the Grand-Duchy of Luxembourg P243 Interactions of colloidal silver with soil and dissolved Christophe Hissler (Belvaux, Luxembourg) organic matter Stephan Walch (Koblenz, Germany) P227 The effect of climatic conditions and whole tree harvesting on the properties and stability of soil P244 Antioxidant capacity of soils as related to the organic matter, application of pressurized hot water chemical composition of their organic matter and net extraction N mineralization rates Hannu Ilvesniemi (Vantaa, Finland) Sabine Heumann (Hannover, Germany) P228 Potential of organic products from the peri-urban P245 Dynamics of the evolution of carbon in the soil and area of Antananarivo (Madagascar) for crop of co2 emissions, under two cropping systems production in a low fertility soil Rosa Carbonell (Córdoba, Spain) Hélène Fonteneau (Cergy, France) P229 Dynamics of soil aggregation and stability in soils under organic manure application and conservation tillage Nicolas Bottinelli (Rennes, France) MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008) P246 Long- term land use and landscape effects on P264 Soil organic matter under long-term cereals growing aggregate stability and carbon fractionation Tamara Dryslova (Brno, Czech Republic) Nadia Doaei (Hamedan, Iran) P265 Chemical characterisation of soils using near- P247 Contribution of microbial biomass carbon to the infrared reflectance spectroscopy formation of soil organic matter Joanna Cloy (Edinburgh, United Kingdom) Anja Miltner (Leipzig, Germany) P266 The soil organic matter content related to soil tillage, P248 Does animal manure fertilization enhance DOM- culture and field slope leaching and co-transport of veterinary antibiotics? A Petru Gus (Cluj-Napoca, Romania) risk assessment for Luxembourg Martina Arenz (Esch-sur-Alzette, Luxembourg) P267 The role of compost use in food security improvement and climate change mitigation: the P249 Role of humic and fulvic acids toward the mobility of case of small holder farmers in Ethiopia PTE (Pb, As, Zn) from mining contaminated soils Hailu Tedla (Addis Ababa, Ethiopia) Marilyne Soubrand (limoges, France) P268 Pyrogenic transformation of soil cover and dynamics P250 Mineralization of microbial carbon and nitrogen in of carbon pools in open forests of North-East soils Eurasia Lorraine Murtagh (Stirling, United Kingdom) Nikita Mergelov (Moscow, Russian Federation) P251 Ectomycorrhizal roots and litter decomposition as P269 Changes in dissolved organic carbon (DOC) in part of the forest soil carbon pool upland catchments in Scotland Tine Grebenc (Ljubljana, Slovenia) Caroline Morrison (Stirling, United Kingdom) P252 Effect of organic substrates based on sugarcane P270 Carbon sequestration by soil aggregates under phlegm and composted coffee pulp over the coffee different management practices vegetative growth initial phase Mamadou Traoré (Bobo Dioulasso, Burkina Faso) Miguel Arizaleta (Cabudare, Venezuela) P271 Agricultural valorisation of de-inking paper sludge as P253 Arable (C3) to Miscanthus grassland (C4); derivation component of substrates of carbon within soil fractions Gabriel Gascó (Madrid, Spain) Darren McCabe (Harpenden, Hertfordshire, United Kingdom) P254 Quantification and characterisation of charred materials in two recently burned pine forest soils in Tuscany, Central Italy S13 Buffering Function of Soils (Poster Area 2) Caterina Nocentini (Firenze, Italy) P255 The dynamic of organic matter in hortic antrosols P272 Geochemistry of major and trace elements in conditioned with polymeric materials tropical serpentine soils Feodor Filipov (Iasi, Romania) Zeng Hseu (Pingtung, Taiwan) P256 The effect of intrinsic soil properties on satiability P273 Enhanced in situ degradation of chemicals in soils and instability indices of aggregates Reiner Schroll (Neuherberg, Germany) M Nikpour (Hamadan, Iran) P274 A composting process model coupling organic P257 Organic matter stabilisation as affected by land use matter and organic micropollutants dynamic Chiara Cerli (Grugliasco, Italy) Patricia Garnier (Thiverval Grignon, France) P258 Effect of burning and addition of municipal waste P275 Dynamic (redox) interfaces in soil - Carbon turnover compost on carbon forms of a forest soil in microbial food webs and impact on soil organic Francisco Lafuente (Palencia, Spain) matter Esther Cyrus (Leipzig, Germany) P259 Large-scale validation of the Roth-C model for Japanese paddy soils P276 Buffering function of soils in prevention of ground Mayuko Jomura (Tsukuba, Ibaraki, Japan) water contamination by pesticides Radka Kodesova (Prague, Czech Republic) P260 A system approach to investigation of waterstable soil aggregates and comprising physical P277 Do buffer methods predict lime requirements for components thereof Greek soils? Nadezhda Vassilieva (Moscow, Russian Federation) Pantelis Barouchas (Messolonghi, Greece) P261 Relationship between soil density and soil organic P278 Vapor phase sorption on soil organic matter matter in first and second rotation areas with Pinus components: Influence of moisture and type of taeda L. in Rio Grande do Sul-Brazil organic contaminant Eduardo Londero (Santa Maria, Brazil) Daniel Tunega (Vienna, Austria) P262 Litter mass loos and nutritional variation, during the P279 The influence of soil reaction change after deccomposition process, from Eucalyptus urophylla application of fly ashes from fluid coal combustion x E. globulus maidenii in Rio Grande do Sul - Brazil on the humus content Mirian Valente (Santa Maria, Brazil) Barbora Badalíková (Troubsko, Czech Republic) P263 Soil organic matter under no-tillage and minimum tillage at the field scale in tropical humid climate Mariléia Furtado (La Coruña, Spain)
MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008) P280 Changes in PO43- and NO3- concentrations in sulfide mine wastes flooded during 17 weeks with S21B Soils and Societies in History (Poster Area 2) eutrophicated water María González Alcaraz (Cartagena (Murcia), P297 A Study of Soil Formation in Colluvial Layers Spain) Iraj Emadodin (Kiel, Germany) P281 Compost amendments affects on retention and P298 Economic, political and social factors in changes in leaching of isoproturon in soil the Czech agricultural landscape (1970-1989) Valérie Pot (Thiverval-Grignon, France) Nicholas Orsillo (Brno, Czech Republic) P282 Buffering capacity of drainage canals and P299 Aliphatic hydrocarbons (n-alkanes) as molecular phytoremediation potential for agro-pollutants markers in soils for prehistoric biomass burning Fotini Stamati (Chania, Greece) Eileen Eckmeier (Zürich, Switzerland) P283 Thermodynamical properties of benchmark hydrogen-bonded systems using molecular dynamics and Monte Carlo methods +DVDQ3D DOLü (Vienna, Austria) 6$6RFLHW\¶V'HPDQGVIRUDQG3HUFHSWLRQVRI6RLO P284 Effects of pH, Ca- and SO4-concentrations on Conservation (Poster Area 2) surface charge properties of goethite and hematite - consequences for sorption properties Jochen Walsch (Hannover, Germany) P300 Landslides and soil distribution, soil conservation and the risk of landslide remobilization. Geba-Werei P285 Cylinder experiment with Lepidium sativum to water divide, Tigray, Ethiopia assess the bioavailability of arsenic in contaminated Jan Moeyersons (Tervuren, Belgium) alluvial soils Juliane Ackermann (Halle, Germany) P301 Soil evaluation and evaluation of areas in landscape planning as a contribution to reduce soil sealing and P286 Sorption of organic compounds in soil: modifications improve sustainable land use planning by their molecular characteristics and the soil Friedrich Rueck (Osnabrueck, Germany) solution Ursula Haas (Seibersdorf, Austria) P287 Speciation of zinc in solutions extracted from different Zn-polluted substrates Eleonore Couder (Louvain-la-Neuve, Belgium) 63HGRPHWULFVDQG'LJLWDO6RLO0DSSLQJ 3RVWHU$UHD P288 Assessing the effects of preferential flow in grassland soils P302 A precision farming application - spatial distribution Gaelene Kramers (Wexford, Ireland) in an onion field in El-Saff district, Giza governorate, Egypt P289 Effect of citric acid on the amounts of Mn and Co Khaled Darwish (Cairo, Egypt) species desorbed from soils developed on two different serpentinite rocks P303 Comparison of spatial variability methods for Vassilios Tsatiris (Athens, Greece) mapping soil properties in Arsanjan plain, southern Iran P290 Impact of hexachlorocyclohexane in agricultural soils Mostafa Emadi (Shiraz, Iran) of Galicia, NW of Spain Roberto Calvelo Pereira (Santiago de Compostela, P304 Spatial prediction of surface soil properties in Spain) Arsanjan plain using terrain and remote sensing data P291 Effects of grass species diversity on soil nitrate Mostafa Emadi (Shiraz, Iran) leaching Anthony Mazzocca (Halifax,NS Canada) P305 Estimation of the soil particle size distribution based on the electrical conductivity of the soil P292 Effect of soil properties on bioavailability and Stefan Hinck (Osnabrück, Germany) phytotoxicity of nickel and copper in soils Zlata Tonkova (Moscow, Russian Federation) P306 Ground tests and ENVISAT images interpretation for SMOS validation P293 Rainfall pH comparation in two different locations in Mateusz Lukowski (Lublin, Poland) south Brazil Marcio Navroski (Santa Maria, Brazil) P307 'LJLWDOPDSSLQJRIWUDFHPHWDOFRQFHQWUDWLRQVLQ regional top soils in the Swiss Plateau P294 Assessment of nickel availability in natural and Kirsten Rehbein (Zürich, Switzerland) serpentine soils from the North-east of Portugal Sheila Alves (Lisboa, Portugal) P308 Spatial variability of soil texture and wetness: effects on thermal conductivity P295 Geochemical and microbiological controls on the Boguslaw Usowicz (Lublin, Poland) fate of depleted U in soil Dote Stone (Cranfield, United Kingdom) P309 &RPSDULVRQRIWHFKQLTXHVXVHGLQ*,6IRU'(0 generation from contours P296 Chemical and biological responses as induced by a Stanislav Bek (Prague, Czech Republic) biomimetric catalyst for enhancing carbon sequestration in soil: a microcosm experiment P310 Application of multi objective regression models to Antonio Gelsomino (Reggio Calabria, Italy) map the resilience characteristics of soil Paul Hallett (Dundee, United Kingdom) MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008) P311 Digital soil mapping in forest reserves: towards the P328 Use of the 137Cs technique under tropical development of forest site mapping conditions: Estimation of medium-term soil Gábor Illés (Budapest, Hungary) redistribution rates in Ibadan, Nigeria Birte Junge (Ibadan, Nigeria) P312 Different approaches to spatial prediction of soil properties in mountainous areas P329 Soil and plant responses to biosolids application in Radim Vasat (Prague, Czech Republic) an abandoned agricultural land Ingrid Walter (Madrid, Spain) P313 Multi-layer soil description for crop management by electric conductivity mapping P330 Quantitative analysis of gully erosoin and sediment Horst Domsch (Potsdam, Germany) yield in the Busmange Chay basin to manage it (Iran- Azerbayjan) P314 Feasibility of bioindication approach to soil spatial Mousa Abedini (Ardabil, Iran) variability Cristiano Ballabio (Milano, Italy) P331 Soil erosion by water in Aleppo pine stands (Pinus helepensis Mill.)after fire P315 Chernozems data set analysis: implications for a Lukrecija Butorac (Split, Croatia) detailed soil allocation model Lubos Boruvka (Prague, Czech Republic) P332 The effect of wildfires on soil erosion and runoff under mediterranean conditions P316 Digital soil mapping at regional level using the Sid Theocharopoulos (Athens, Greece) knowledge derivate from existing soil maps at medium and large scales P333 The experience of the monitoring of erosion Blandine Lemercier (Rennes, France) processes on cultivated soils of the Republic of Belarus P317 Characterisation of the spatial variability of bare soil Andrei Chernysh (Minsk, Belarus) respiration from plot to field scale Michael Herbst (Jülich, Germany) P334 Digital erosion mapping and quantification of mass movement in tropical areas, Sierra Norte de Oaxaca, P318 Spatial variability of available phosphorus at the Mexico one-hectare scale in Misiones, Argentine Abel Ibañez-Huerta (Mexico D. F., Mexico) Jorge Paz-Ferreiro (Coruña, Spain) P335 Flocculation behaviour of soil suspension in relation P319 Soil reaction variability under forest and arable land to the polyacrylamide application, shaking time and Vit Penizek (Praha, Czech Republic) temperature P320 High resolution soil sensing of multiline transects in Mari Räty (Helsinki, Finland) the Wetterau region (Hesse/Germany) P336 Spatial rill initiation and rill development on terraced Till Reckling (Giessen, Germany) agricultural fields in Angereb Sub-watershed, P321 Mapping spatial variability of soil texture in precision Ethiopia agriculture Gizaw Desta Gessesse (Debre Birhan, Ethiopia) Vojtech Lukas (Brno, Czech Republic) P337 Effects of palm-leaf geotextile mats on the P322 Geophysical auxiliary data and soil water content conservation of temperate agricultural soils in the spatial prediction: the multi-collocated co-kriging United Kingdom approach Ranjan Bhattacharyya (Wolverhampton, United Giuliano Langella (Portici, Italy) Kingdom) P338 Mapping soil erodibility using geostatistics and GIS techniques in Baleghli Chay watershed, Ardabil, Iran Abazar Esmali Ouri (Ardabil, Iran)
S03 Soil Erosion (Poster Area 3) P339 Modeling and validation of rainfall erosion index in Lake Urmia basin Alidad Karami (Shiraz, Iran) P323 Investigation of evaluation sediments in natural forest under management in 14 years period, P340 Rill and interril erosion produced by a single-storm Caspian forest, north of Iran event in an olive grove in central Spain Seyed Armin Hashemi (Lahijan, Iran) Ramon Bienes (Madrid, Spain) P324 Erosive degradation of a soil cover of the Azerbaijan P341 Interrill erosion in a bare soil. An experience of 12 Republic years Magerram Babayev (Baku, Azerbaijan) Ramón Bienes (Madrid, Spain) P325 Analyses of relations between variable factors and P342 Ecologo-genetic peculiarities of soils of Ukrainian water erosion changes (case study: Yamchi dam Carpathians and their protection drainage basin, Ardabil, Iran) Taras Yamelynets (Lviv, Ukraine) Abazar Esmali Ouri (Ardabil, Iran) P343 Loss of total and organic C in a wheat crop under P326 A decision support tool for soil erosion assessment direct drilling and conventional tillage in Switzerland Rafaela Ordóñez (Córdoba, Spain) Volker Prasuhn (Zürich, Switzerland) P344 Assesement of the soil nutrients losses by sheet P327 Quantification of erosion process through plot water erosion from Bulgarian agricultural land, value measurements and radioisotopic methods (137Cs, of the appropriate anti-erosion practises 210Pb) Diana Nekova (Sofia, Bulgaria) Lionel Mabit (Seibersdorf, Austria) MON TUE THU FRI Poster Session 2 (Tuesday, August 26, 2008) P345 Tillage erosion in young moraine landscapes of P362 Estimation of Ecological Condition of Soils germany Elena Pivovarova (Barnaul, Russian Federation) Monika Frielinghaus (Müncheberg, Germany) P363 Comparison of soil respiration, humic substances P346 Risk assessment methods of soil erosion by water in quality and optical indexes in Eutric Cambisol the European Union Lubica Pospisilova (Brno, Czech Republic) Luis Recatala (Albal. Valencia, Spain) P364 Potentially mineralizable nitrogen under different P347 Soil aggregate stability under two rainfall modes tillage systems Aïcha Rochdi (Settat, Morocco) Diana Martin (Madrid, Spain) P348 Agricultural measures for flood protection and P365 Inorganic polyphosphates as an indicator of soil erosion control - a comparison of different methods fungal activity for visualisation and application Mikhail Makarov (Moscow, Russian Federation) Norbert Billen (Stuttgart, Germany) P366 A field spade test for visual scoring of soil structure P349 Validation and further development of the EROSION Lars Munkholm (Tjele, Denmark) 3D model for simulation of high water effecting surface runoff P367 Phytoindication of soil conditions of mountain beech Marcus Schindewolf (Freiberg, Germany) sites in Slovenia Mihej Urbanþiþ (Ljubljana, Slovenia) P350 The role of the soil physical and chemical properties in the erosion processes dynamics. Case study: P368 Soil physical quality in the Tutovei Hills region Tutovei Hills, Eastern Romania (Romania) Iulian Catalin Stanga (Iasi, Romania) Ionut Vasiliniuc (Iasi, Romania) P351 Statistic and simulation approaches to evaluation of P369 Evaluating soil suitability for vineyard in Jerez zone, erosion and nutrient content in runoff water in Italy Southern of Spain - Preliminary analysis of soil hills agroecosystems quality indicators Maria Cristina Velardo (Milano, Italy) Maria Anaya (Seville, Spain) P352 Estimating soil erosion rates for Hungary - an P370 Rendzin biological activity of different natural zones application of the PESERA model of the Nothewest Caucasus Istvan Waltner (Godollo, Hungary) Artem Polyakov (Rostov-on-Don, Russian Federation) P353 Relationship between P surface richness and soluble P concentration in runoff in plots under P371 Indicators and indices integrated in Agenda 21 for conventional tillage the assessment of desertification processes in Antonio Rodríguez-Liza (Seville, Spain) Mediterranean environments Luis Recatalá (Albal. Valencia, Spain) P354 Soil erosion in Albania Lushaj Sherif (Tirana, Albania) P372 Magnetic fingerprint for the source area of an alluvial Vertisol in southern Mali P355 Pilot object for soil erosion protection land use in Andreas Gehring (Zürich, Switzerland) South-East Bulgaria A Lazarov (Sofia, Bulgaria) P373 How to manage and analyse a large biodiversity GDWDVHWWKHFDVHRIWKHUHJLRQDO³5046%LR'LY´ P356 Soil erosion, carbon and nutrient elements leaching experience control by reduced tillage on chromic luvisol Guénola Pérès (Paimpont, France) Elka Tcvetkova (Sofia, Bulgaria) P374 Assessment of soil friability by the volume- dependence method in selected Hamadan soils Homa Bahmanzadeh (Hamadan, Iran) P375 Soil Degradation as a Catastrophic Event S16 Soil Indicators (Poster Area 3) Alexander Klevzov (Sofia, Bulgaria) P376 Application of fractal theory to describe soil P357 Enzymatic activity of forest soils and their aggregate stability for different land uses productivity Mohammad Hajabbasi (Isfahan, Iran) Ewa BáoĔska (Cracow, Poland) P358 The ecological characterization through indicators of quality of the soil resources in forestry and agroecosystems from North-Eastern Romanian Lazar Bireescu (Iasi, Romania) P359 Soil quality evaluation indicators Virginijus Feiza (Dotnuva, Lithuania) P360 Prediction of soil physical quality index by pedo- transfer functions in some saline and saline-sodic soils of Iran Hojat Emami (Karaj, Iran) P361 N/S ratios in Ribwort Plantain (Plantago lanceolata) as indicator plant Zeljka Zgorelec (Zagreb, Croatia) MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008)
P394 Dehydrogenase and cellulase activities in the S28 Soil Fertility and Environment (Poster Area 1) arable-humic horizon of an acidic soil Jacek Dlugosz (Bydgoszcz, Poland) P377 Evaluation of Sorghum Response to Different Sources and Rates of Phosphorus Fertilizers P395 The effect of different fertilization systems on Camilia El-Dewiny (Cairo, Egypt) content of some micro and macro nutrients in soil and seed of oilseed rape (Brassica napus L.) P378 Impact of Nitrogen Fertilization on Iron Uptak by Hossein Sabahi (Tehran, Iran) Maize Growing in Calcareous Soil Safaa Mahmoud (Giza, Egypt) P396 Comparison of effect of azola and azola compost on nitrogen mineralization of paddy soil P379 Kinetics of Some Micronutrients Desorption by Pirouz Azizi (Rasht, Iran) DTPA from Calcareous Soils Adel Reyhanitabar (Tabriz, Iran) P397 Remote sensing data for small rivers basins soil and vegetation mantle assessment P380 Effect of phosphorus rates and methods of zinc Tatiana Trifonova (Moscow, Russian Federation) application on maize yield and its components Hanan Siam (Giza, Egypt) P398 Use of NIRS technology with a fibre-optic probe for the determination of total carbon, total nitrogen, pH P381 Influence of saline water irrigation and compost plant and yields in soils after 16 years of applying different residues on yield and nutrient uptake by fodder beet tillage and residue management systems grown on a sandy soil José Hernández Hierro (Salamanca, Spain) Ahmed Taalab (Giza, Egypt) P399 The effect of zinc and boron interaction on the P382 Effects of zinc and irrigation intervals on yield and concentration and uptale of phosphrus and component yield of sunflower potassium in corn grain Mohamad Rahimi (yasouj, Iran) Farshid Aref (Fars province, Iran) P383 Study of density and activity of native VA P400 Search of ecological ways preservation and mycorrhizal related with soil phosphorus in some increasing of soil fertility farmlands of Marand Olga Klymenko (Yalta, Ukraine) Parisa Aizadeh Okuei (Marand, Iran) P401 Grouping of common soil varieties by cluster P384 Effects of nitrogen, phosphorus and boron on some analysis on the basis of data for main soils' growing Charactristcs of polianthus tuberose L. properties and their thermal characteristics Shahram Baghban Sirus (Marand, Iran) Vesselina Ilieva (Sofia, Bulgaria) P402 Sequential Extraction of Different Forms of Zinc in P385 Textile industry wastes, a real threat to agricultural Several Soils of Guilan Province environment in Egypt Akbar Forghani (Rasht, Iran) Wafaa Abd El-Rahim (Cairo,, Egypt) P403 Leaching of some heavy metals into drainage water P386 Optimum Rate of Top Dressing of Nitrogen Fertilizer in Croatia on Red Pepper by Ground-Based Remote Sensing Ivan Simunic (Zagreb, Croatia) Soon-Dal Hong (Cheongju, Chungbuk, Republic of P404 The selenium content in soil and red clover Korea) (Trifolium pratense L.) affected by organic P387 Effect of FeSO4/Ca(OH)2 addition on phosphate fertilisation exchangeability and iron forms in an acid soil Katarzyna Borowska (Bydgoszcz, Poland) submitted to different redox conditions P405 Use of phosphorus applied with animal manure to Emmanuel Frossard (Zürich, Switzerland) organically and conventionally managed soils P388 Effects of Zn and Fe on yield and yield components Astrid Oberson (Lindau, Switzerland) of sunflower P406 Development of a sewage sludge ash based Moahmad Rahimi (yasouj, Iran) phosphate fertilizer (PHOSKRAFT): characterization P389 GIS Evaluation of nitrates concentration in of ashes and potential for phosphorus-fertilization groundwater. A case study in Central Italy Simone Nanzer (Lindau, Switzerland) Chiara Piccini (Rome, Italy) P407 Synthetic siderite is effective to prevent iron P390 Olive mills solid waste soil application in olive crops: deficiency Effect on herbicide fate Inmaculada Sánchez-Alcalá (Córdoba, Spain) Lucia Cox (Seville, Spain) P408 Screening tests of epiBS P391 Thermal properties of some Bulgarian soils Liudmila Voronina (Moscow, Russian Federation) Vesselina Ilieva (Sofia, Bulgaria) P409 The agronomic value of composed sludge. 1- Effect P392 Loads and fate of fertilizer derived uranium in of compost combined with N, Pand K applicationon agricultural soils yield, nutrient and heavy metal concentrations of Sylvia Kratz (Braunschweig, Germany) wheat in newly reclaimed soil Mahmoud Hozien Mahmoud (Cairo, Egypt) P393 Profile distribution of enzyme activities in relation to some physico-chemical parameters of intensively used soils of the Wielkopolska Lake District (Poland) Anna Piotrowska (Bydgoszcz, Poland) MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008) P410 Distribution of Forms of Copper and their P428 Soil Sustainability Indicators under Rice- Relationship with Soil Properties in Agricultural Soils Winter Cover Crops Cropping Systems in No-tillage of Central Greece Paddy Field Evangelia Golia (Nea Ionia Magnissias, Greece) Young Lee (Jinju, Republic of Korea) P411 Study on the Effects of Macro and Micro Nutrients on Yield and Quality of Sesame (Sesamum indicum L.) P429 Kinetics of Zinc Desorption from Calcareous Soils Farshid Aref (Firouz Abad, Iran) Marjan Padidar (Hamadan, Iran) P412 Aftereffect duration of residual amounts of P430 Contributing areas to P-losses from grassland - phosphorus fertilizer hydrological risk areas Vitali Lapa (Minsk, Belarus) Claudia Hahn (Zürich, Switzerland) P413 Towards a sustainable agriculture in Cuba P431 Evaluation of iron and manganese speciation in poor Olegario Muñiz Ugarte (Havana, Cuba) forest soils using the sequential extraction method Barbara Walna (Mosina, Poland) P414 Geochemical atlas of the Republic of Croatia P432 Clay mineralogy and soil potassium status in some Lidija Galoviü (Zagreb, Croatia) Alfisols of Golestan Province, Iran P415 Using pedological information in establishing Sofia Zaer Nomali (Gorgan, Iran) conservation measures concerning soil fertility and environmental protection in south-western Romania P433 Fertility status and hazardous and harmful residues in Dorin Tarau (Timisoara, Romania) the soils of Srem Ljiljana Nesic (Novi Sad, Serbia) P416 Content of phosphorus in soil under corn grown in monoculture P434 Ammonium acetate and ammonium chloride Barbara Murawska (Bydgoszcz, Poland) comparative soil K extraction potential Orlando Rodríguez-Rodríguez (Barquisimeto, P417 Fertilization with nitrogen and sulphur as a factor Venezuela) determining sulphur richness in soil in different types of soil P435 Evolution of soil acidity in the preluvosoil from North- Ewa Spychaj-Fabisiak (Bydgoszcz, Poland) Western part of Romania in long term fertilizers field experiments P418 Effect of organic matter and copper on chemical Gheorghe Ciobanu (Oradea, Romania) forms of copper and copper concentration in corn in two calcareous soils P436 3HGRORJLFDOIDFWRU¶VUROHLQUHFRQVWUXFWLRQPHDVXUHV Azadeh Esmaili (Tehran, Iran) establishing in Arad County, Romania soils Vlad Horia (Arad, Romania) P419 Rock phosphate availability to oats plants in two inoculated with bacteria soils P437 Thermodynamic parameters of zinc sorption in some Kostadinka Nedyalkova (Sofia, Bulgaria) calcareous soils Alireza Hosseinpur (Shahrekord, Iran) P420 Nutrient balance in organic rice farming area in Korea Geunhwan Gil (Iksan, Republic of Korea) P438 Effect of cover crops as green manure on nutrient balance and potato yield in organic crop rotation P421 Soil physicochemical properties of reclaimed land in Totka Mitova- Trifonova (Sofia, Bulgaria) southwestern coast in Korea Kyeongbo Lee (Iksan, Republic of Korea) P439 Risk assessment for nitrogen contamination of groundwater under Haplic Chernozems P422 Quantifying Bioactive P Pools in Fertilized and Dimitranka Stoicheva (Sofia, Bulgaria) Manure-amended Soils by Purified Phytic-Acid High Affinity Aspergillus Phosphohydrolases P440 CEC and K critical level determined by ammonium Thanh Dao (Beltsville,MD United States) acetate and ammonium chloride Orlando Rodríguez-Rodríguez (Barquisimeto, P423 Distribution of polycyclic aromatic hydrocarbons in Venezuela) urban, suburban and arable areas of the Vojvodina Province, Serbia P441 Evaluation of chosen characteristics of luvic Natasa Djurisic-Mladenovic (Novi Sad, Serbia) chernozem topsoil in south part of the Hornomoravsky uval P424 Interaction effect of organic, inorganic and Martin Brtnický (Brno, Czech Republic) biofertilizers on the growth and yield of wheat plants in newly reclaimed soil P442 Effect of organic materials on rice development and Medhat Tawfik (Dokki, Egypt) soil properties in an acid saline paddy soil Roland Poss (Montpellier, France) P425 Effects of low-molecular-weight organic acids on desorption Kinetics of Copper from soils P443 Soil nitrate content evolution with leguminous cover Marjan Padidar (Hamadan, Iran) crops in organic farming Cristina Alcántara (Córdoba, Spain) P426 Microbial transformation of diphenylarsinic acid in Japanese agricultural soils P444 Soil weathering stage of volcanic ash soils directly Yuji Maejima (Tsukuba, Japan) impacts the silicon status of banana (Musa spp.) Bruno Delvaux (Louvain-la-Neuve, Belgium) P427 Intercropping has a high potential to reduce environmental impacts of agriculture P445 Contributions to the knowledge of soil pollution with Valentini Pappa (Edinburgh, United Kingdom) fluorine Stefan Ispas (Targoviste, Romania)
MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008) P446 Assessment of organic micro-pollutant speciation in Orlando Rodríguez-Rodríguez (Barquisimeto, composts using 14C-labelled molecules Venezuela) Gwenaëlle Lashermes (Thiverval-Grignon, France) P463 Comparative Effect of Two Different Types of P447 Changes of some chemical parameters of cambisol Phosphate on Cadmium Phytoextractability in the influenced by twenty years use in wine growing Field Soil Affected by Mine Activity Natalija Perovic (Podgorica, Montenegro) Pil Joo Kim (Jinju, Republic of Korea) P448 Leaching of nitrates and base cations under P464 Nitrogen and carbon release from organic residues Fluvisols in different crops growing and nitrogen by extraction with KCl: effect of temperature and rates acidification Dimitranka Stoicheva (Sofia, Bulgaria) João Coutinho (Vila Real, Portugal) P449 Soil amendment with activated charcoal can reduce P465 Micronutrient levels in natural stands of European aromatic arsenicals uptake by rice from soil oaks in northwest of Iberian Peninsula: a contaminated by diphenylarsinic acid comparative study Tomohito Arao (Tsukuba, Japan) A Rodríguez-Campos (Lugo, Spain) P450 Scaling-up nutrient balances from plot to village level P466 Comparison between the chemical properties and under small-holder settlement schemes in sub- the macronutrient content of natural stands of humid Zimbabwe Quercus petraea Liebl. and Q. pyrenaica Willd. soils Juan Cobo Borrero (Stuttgart, Germany) in Galicia, NW Spain A Rodríguez-Campos (Lugo, Spain) P451 Application of microelements in plant growing of Belarus P467 Effect of fertilization treatments and water regime on Mihail Rak (Minsk, Belarus) Fodder beet productivity E Abdallah (Giza, Egypt) P452 An easy incubation method for measuring nitrogen mineralization from soils and organic residues Tânia Teixeira (Lisboa, Portugal) P453 Enhancement of earthworm biomass and maize production. S04 Soil Compaction (Poster Area 2) Esperanza Huerta (Villahermosa, Mexico) P454 Phytoremediation of soils contaminated by liquid P468 Oxygen Diffusion Rate in Vertisol beef cattle manure Rayna Dilkova (Sofia, Bulgaria) Nadejda Fless (Moscow, Russian Federation) P469 Effect of agricultural activity on soil deformation on P455 Doses and Ammonium acetate and ammonium Estonian grasslands chloride comparative soil Ca extraction potential Endla Reintam (Tartu, Estonia) Orlando Rodríguez-Rodríguez (Barquisimeto, Venezuela) P470 The effects of conservation tillage on soil physical and biological properties in maize monoculture P456 Comparison of colorimetric and ICP determination of Peter Laszlo (Budapest, Hungary) phosphorus extracted by the Melich-3 procedure in plots with organic and mineral fertilization P471 Mechanical models for the dynamic of the cone Eva Vidal Vázquez (Coruña, Spain) penetrometer Petru Cardei (Bucharest, Romania) P457 The role of plant growth regulators in cadmium toxicity for plants P472 Assessing effect of plant residuals on reduction and Ekaterina Morachevskaya (Moscow, Russian prevention of soil compaction in afforested parks Federation) Soheila Ebrahimi (Tehran, Iran) P458 The small-scale pattern of nitrate concentration in P473 Influence of different nutrients on rheological seepage water below the main rooting zone in an N parameters with special regard to potassium saturated homogeneous mature spruce forest is Doerthe Holthusen (Kiel, Germany) regulated by net N mineralization in the organic layer P474 The effect of compaction and reduced tillage on the Boris Matejek (Garmisch-Partenkirchen, Germany) macro- and microscale gas transport in a loess soil P459 Influence of mineral and organic fertilizer inputs on Asko Simojoki (Helsinki, Finland) soil nutrient fluxes in eucalypt ecosystems P475 Soil compaction in vineyards of Slovakia Valerie Maquere (Nancy, France) Maria Mrazikova (Nitra, Slovakia) P460 Effect of nitrogen, phosphorus and potassium P476 Defining soil compaction stages by the fertilization on the growth and development of 'Packungsdichte' method pedunculate oak seedlings (Quercus robur L.) Tamás Bucsi (GödöllĘ, Hungary) Ivan Seletkoviü (Jastrebarsko, Croatia) P477 How do conventional and conservation tillage P461 Mineral and organic contribution to nutrient pool in practices with organic manure application affect the black anthropogenic soils from the African Great seasonal variation of topsoil hydraulic conductivity? Lakes Region Nicolas Bottinelli (Rennes, France) Séverine Delstanche (Louvain-la-Neuve, Belgium) P478 Soil mechanical and soil hydraulic parameters on a P462 Proportion ammonia / nitrate in nursery plants recently established agricultural recultivation site in Hartón Plantain (Musa AAB subgroup Plantain cv. Eastern Germany Hartón). Julia Krümmelbein (Cottbus, Germany) MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008) P479 Patterns of soil structure in spruce stands in south- P495 Constructozems of golf courses as new soil western Germany - natural and anthropogenic differences causes Sergey Gorbov (Rostov-on-Don, Russian Klaus von Wilpert (Freiburg, Germany) Federation) P480 Influence of mountain pasture landuse on soil P496 Soil PAHs contaminats analysis using fluorescence structure and its related physical parameters spectroscopy Nicola Rampazzo (Vienna, Austria) *DEULHOD3DYHOHVFX 0DJXUHOH5RPDQLD P481 Effects of different compaction impacts and varying P497 Heavy metal content in soil near sedimentation subsequent soil management practices on soil ponds, North-Western Romania microbiological parameters *DEULHOD3DYHOHVFX 0DJXUHOH5RPDQLD Hans-Rudolf Oberholzer (Zürich, Switzerland) P498 Development of improved urban soil evaluation P482 The strength of plant roots and their impact to soil methods shear strength in disturbed and undisturbed Jürgen Schneider (Hannover, Germany) grassland soils Katrin Trükmann (Tartu, Estonia) P499 Classification of soils in Szeged based on anthropogenic diagnostic properties P483 Monitoring root growth alteration caused by heavy ,UpQ3XVNiV 6]HJHG+XQJDU\ forest machinery P500 Microbial properties of sandy mine soils afforested %RãWMDQ0DOL /MXEOMDQD6ORYHQLD with different tree species P484 Mechanical behaviour of a clay soil under different 0DUFLQ&KRGDN .UDNRZ3RODQG buffer zone management practices in Finland P501 Impact of the urbanization on soil conditions 0DUL5lW\ +HOVLQNL)LQODQG 0DUHN'HJRUVNL :DUV]DZD3RODQG P485 The efect of aggregate for minibeds forming on physical and mechanical propertys on soil P502 Evaluation of metals mobility and phytoavailability from mine tailing technosoils (Massif Central - 2QGUHM3RQLFDQ 1RYL6DG6HUELD France) P486 In situ characterization of the structural 1DVWDVLD:DQDW /LPRJHV)UDQFH heterogeneity of a compacted tilled soil by electrical and mechanical methods P503 Testing of engineered nanoparticles colloidal stability for mobility prognosis 0DXG6HJHU $XELqUH)UDQFH Stephanie Ottofuelling (Vienna, Austria) P487 Tillage and crop rotation influence over soil physical properties P504 Heavy metals in urban soils of Belgrade, Serbia 0DULXV*KHUHV &OXM1DSRFD5RPDQLD 1HJRYDQ,YDQNRYLF %HOJUDGH6HUELD P488 Impact of soil tillage practices on the spatial P505 Source identification of polycyclic aromatic organisation of earthworm biostructures hydrocarbons (PAHs) in river bank soils Thilo Hofmann (Vienna, Austria) 'HQLV3LURQ 5HQQHV)UDQFH P506 The distribution and migration of cadmium and lead in hortic antrosoils conditioned with polymeric materials 'XPLWUX%XOJDULX ,DVL5RPDQLD S18 Urban and Anthropogenic Soils (Poster Area 2) P507 Spatial variation of surface soil pollution in Qingdao, China P489 Phytoremediation of lead in contaminated urban Stefan Norra (Karlsruhe, Germany) residential soils of Portland, Maine, U.S.A. P508 Acidity parameters variation along a permanent 6DPDQWKD/DQJOH\ *RUKDP0(8QLWHG6WDWHV preservation area in a rural-urban stream with P490 Mobility and REE fractionation pattern in natural and different degradation kinds and levels in Santa mining soils in relation to parent material Maria, RS 0DVVLPR$QJHORQH 5RPH,WDO\ 'HQLVH6]\PF]DN 6DQWD0DULD%UD]LO P491 Heavy metal pollution assessment in a Romanian P509 Evaluation and Improving of Urban Soils Fertility mining area State (ULND/HYHL &OXM1DSRFD5RPDQLD 5DGX/DFDWXVX %XFKDUHVW5RPDQLD P492 Influence of compost application and mycorrhization on urban soil characteristics and growth of bigroot geranium (Geranium macrorrhizum L.) -RDQQD1RZDN 6NLHUQLHZLFH3RODQG P493 Levels of Lead and in Roadside Soil Samples of an Agricultural Area of Central Greece (YDQJHOLD*ROLD 1HD,RQLD0DJQLVVLDV*UHHFH P494 The Use of Enrichment Factor for the evaluation of Zinc Pollution in Agricultural and Industrial Soils of Central Greece (YDQJHOLD*ROLD 1HD,RQLD0DJQLVVLDV*UHHFH
MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008) P525 Procedures and protocol for soil biodiversity S24 Soils and GMOs (Poster Area 2) PRQLWRULQJ³5046%LRGLY´D)UHQFK3LORWDUHD experience P510 Fate of Cry1Ab-protein from Bt-maize (MON810) Guénola Pérès (Paimpont, France) during silage and subsequent co-digestion in a P526 Seasonal behavior of soil solutions in a biogas plant, and consequences for agricultural use Mediterranean forest of the remaining biogas manure Stefano Carnicelli (Firenze, Italy) Ulrike Schoebinger (Universität Trier, Germany) P527 Distribution of radionuclides in agricultural soil P511 Mineralizable and total soil C and total N in surface samples of southeast Belgrade, Serbia soil were not affected by 7 years of continuously ,YDQD9XND LQRYLü (Belgrade, Serbia) planted Bt corn Alexandra Kravchenko (East Lansing,MI United P528 Influence of in-situ storage conditions on the States) composition of soil solutions from Norway spruce and Douglas fir forest floors Hugues Titeux (Louvain-la-Neuve, Belgium) P529 Development of a Decision Support System (DSS) for generating reliable hazard quantifications of S10 Advances in Soil Monitoring (Poster Area 3) mudslides Friederike Meyer (Neubiberg, Germany) P512 Uncertainties in pesticide monitoring using suction cups: Evidences from numerical simulations Lutz Weihermüller (Jülich, Germany)
P513 Long-Term Monitoring of Soil Physical and S17 Land Use and Soil Protection (Poster Area 3) Biological Properties Peter Schwab (Zürich, Switzerland) P530 Influence of soil usage and soil tillage system on soil P514 Application of laser diffraction method for properties determination of grain size distribution of soils on Teodor Rusu (Cluj-Napoca, Romania) example of brown soil Magdalena RyĪak (Lublin, Poland) P531 Changes in soil chemical properties under modern and traditional farming system at Khagrachari, P515 Selection of optical parameters in grain size Chittagong Hill Tracts, Bangladesh distribution measurement of brown soil by laser Shampa Biswas (Vienna, Austria) diffraction method Andrzej Bieganowski (Lublin, Poland) P532 Evaluation of the meliorative effect of waste products in soils damaged by coal mining P516 Background concentrations of trace elements in the Rayna Dilkova (Sofia, Bulgaria) groundwater recharge of northern Germany Wilhelmus Duijnisveld (Hannover, Germany) P533 Heavy metals and selected physicochemical properties of Rendzic Leptosols of the Ponidzie P517 The soil quality monitoring network for French soils Region (southern Poland) (RMQS): state of progress and first results Anna Swiercz (Pedagogical University of Kielce, Claudy Jolivet (Olivet, France) Poland) P518 Long-term soil monitoring in the federal state of P534 Land use planning as an instrument of soil Schleswig-Holstein (Northern Germany) conservation in reclamation areas (a case study of Rainer Nerger (Kiel, Germany) Belarusian Polesye) P519 Development of laboratory analytical procedures to Valentin Yatsukhno (Minsk, Belarus) determine thermal properties in soils P535 The role of soil components in association of heavy Carlos Rubio (Cervera, Spain) metals in agricultural soils P520 The French soil sample archiving, memory of our Halina Dąbkowska-Naskret (Bydgoszcz, Poland) soils P536 Soil loss in Slovenia due to the permanent land use Line Boulonne (Olivet, France) changes in the last 15 years P521 Seasonal alterations of soil properties and nutrients Blaz Repe (Ljubljana, Slovenia) concentrations in a small Mediterranean river P537 Soil stability affected by different land use catchment Ewa Czyz (Pulawy, Poland) Yorgos Amaxidis (Anavissos - Athens, Greece) P538 Development of a GIS-based model for the P522 Frequency dependent dielectric loss as the indicator assessment of regional element balances of of bulk soil electrical conductivity agricultural soils Andrzej Wilczek (Lublin, Poland) Charis Theodorika (Zürich, Switzerland) P523 $VVHVVPHQWRIPHWDOV¶SK\WRDYDLODELOLW\IURPYDULRXV P539 Building military facilities in earthquake zones on soils: conventional extraction procedures versus collapse prone loess soils in Afghanistan DGT technique Claas Meier (Neubiberg, Germany) Jessica Peyrical (Limoges, France) P540 6RLOFRYHUHYROXWLRQLQWKH&RUWLQDG¶$PSH]]RYDOOH\ P524 DONECOSOL: A software tool to manage (Italy) between geomorphological fragility and ELRGLYHUVLW\¶VGDWD sustainable management Guénola Pérès (Paimpont, France) Claudio Bini (Venice, Italy) MON TUE THU FRI Poster Session 3 (Thursday, August 28, 2008) P541 Compaction of loamy soils due to tillage and P555 Effectiveness of soil conservation measures on soil chemicals operations in vineyards and its effect on degradation - A survey in selected case studies in soil oxygen content in Bozcaada (SW Turkey) the EU Sakine ÖzpÕnar (Çanakkale, Turkey) Nicole Heyn (Müncheberg, Germany) P542 Maize (Zea mays L.) response to tillage systems P556 Effect of herbicide on the chlorophyll content and after winter vetch on a clay loam soil in Western growth of herbaceous and broadleaf Weeds Turkey Hung-Yu Lai (Changhua, Taiwan) Sakine ÖzpÕnar (Çanakkale, Turkey) P557 A method for the assessment of soil functions based P543 Validation of an assessment tool for heavy metals in on the German agricultural land evaluation soils using site-specific heavy metal balances (Bodenschätzung) Dorit Zoerner (Giessen, Germany) Sven Gönster (Bochum, Germany) P544 Numerical analysis of water and soil properties and P558 Temporal impact of soil conservation on crop environmental potentials of touristy Ormieh lake production and soil fertility in the highlands of NE basin and shorelines for land planning (North West Thailand of Iran) Wanwisa Pansak (Stuttgart, Germany) Mousa Abedini (Ardabil, Iran) P559 Biological mechanisms involved in stabilization of P545 Schatkamer Aarde, a tool for improving integration sandy soils of the machair of soil in spatial planning Maja Thorsen (Dundee, United Kingdom) Hanneke van den Ancker (Ede, Netherlands) P560 Updating land evaluation data using remote sensing P546 /RZLQSXWDJULFXOWXUDOV\VWHPV,QWHUFURSSLQJ¶VUROH and expert knowledge integrated in a GIS in resource use efficiency Orr Gvili (Beer Sheva, Israel) Valentini Pappa (Edinburgh, United Kingdom) P561 Soil cover changes under the influence of land use P547 The challenge of sustaining coils: An integrated in the hilly area of Eastern Romania perspective Lilian Niacsu (Iasi, Romania) Verena Winiwarter (Vienna, Austria) P562 Soils, a natural resource between sustainability and P548 Case study on arsenic enrichment in agricultural soil commercial efficiency and food chain in an arsenic affected area in Inner Tomaz Prus (Ljubljana, Slovenia) Mongolia, China Harald Neidhardt (Karlsruhe, Germany) P563 Ecological valuation of soils effected by Norilsk Nickel smelter P549 Qualitative and quantitative soil protection in the Sergey Kudryashov (Moscow, Russian Federation) Czech republic in connection with proposed Soil Framework Directive P564 Land classification in Ciuc Depression (Romania) according to the natural limitations and anthropic Milan SáĖka (Brno, Czech Republic) degradations P550 Reducing agri-environmental problems through Ion Rasnoveanu (Bucharest, Romania) conservation agriculture Emilio Gonzalez-Sanchez (Cordoba, Spain) P565 Effects of plant species richness and functional group diversity on soil stability P551 Land evaluation from the natural resources and Guénola Pérès (Paimpont, France) cadastral classification viewpoint Tomaz Prus (Ljubljana, Slovenia) P566 Climate impact on soil: causes, effects Marinela Gheres (Cluj Napoca, Romania) P552 Historical view on land-use changes in the Dragonja river valley P567 Conservation tillage for vegetable growing Marina Pintar (Ljubljana, Slovenia) Irina Calciu (Bucharest, Romania) P553 The influence of the climate conditions from Oradea, P568 Evaluation of soil microbial indices along the Romania on the biodegradation of oil on a polluted revegetation chronosequence in grassland soils on soil the Loess Plateau, Northwest China Cornel Sabau (Oradea, Romania) Shaoshan An (Yangling, China) P554 The effects of types and amounts of organic matter on soil aggregate stability Alidad Karami (Shiraz, Iran)
MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008)
P587 Influence of meteorological factors during vegetation S02 Soils and Climate Change (Poster Area 1) period on the yield and evapotranspiration of irrigated and non irrigated grain corn Alexander Matev (Plovdiv, Bulgaria) P569 Approach to predict soil fertility alteration due to global warming during the 21st century P588 Measurement and analysis of N2O and SF6 Iourii Nikolskii-Gavrilov (Montecillo, Mexico) diffusion coefficients in soils as a function of the spatial scale P570 SOC dynamics in a long-term water-logged single Jürgen Böttcher (Hannover, Germany) rice cropping system WonKyo Jung (Suwon, Republic of Korea) P589 An evaluation of the impact of climate change on soil water balance in a catchment in north-eastern P571 Causes and extent of fluctuations of the gaseous germany - a case study carbon pool in a deeply aerated soil Martin Wegehenkel (Muencheberg, Germany) Helmer Schack-Kirchner (Freiburg, Germany) P590 The late Pleistocene paleosols in the centre of the P572 $QFLHQWDQGUHFHQWVRLOVRIUHVHUYH³$UFDLP´LQ Russian Plain steppe area, Russia Svetlana Sycheva (Moscow, Russian Federation) Valentina Prikhodko (Pushchino Moscow region, Russian Federation) P591 CO2 emission rate in Mediterranean ultisols with different degradation degrees P573 Contribution of the geogenic sources to the methane Rafael Espejo (Madrid, Spain) budget in soil, in hydrocarbon-prone areas Liana Spulber (Cluj-Napoca, Romania) P592 Influence of tillage systems on soil organic matter content - results of long-term research in Baden- P574 Open-N: An open source code for modeling nitrous Wuerttemberg oxide emission from upland and water-logged soils Erich Unterseher (Karlsruhe, Germany) of a spruce forest ecosystem Marc Lamers (Hohenheim, Germany) P593 DOC dynamics in a boreal riparian soil - Implication of a changing winter climate P575 Continuous Measurements of Soil CO2 Profiles Mahsa Haei (Umeå, Sweden) under Miscanthus x giganteus Fabrizio Albanito (Dublin, Ireland) P594 Soil hidrological response under extreme climate situations P576 Impact of tropospheric ozone on soil mesofauna in María Concepción Ramos (Lleida, Spain) the rhizosphere of field-grown winter wheat Stefan Schrader (Braunschweig, Germany) P595 Changes in organic matter and microbial community along a soil climosequence in the Austrian P577 Climate changes and its potential impact on soil Limestone Alps organic carbon stock of selected Slovak agriculture Ika Djukic (Vienna, Austria) farms Gabriela Barancikova (Presov, Slovakia) P596 GIS derived susceptibility of forest soils to drought: example from Slovenia P578 Climate and maize yields in Plovdiv region I. under Milan Kobal (Ljubljana, Slovenia) non irrigated conditions Georgi Stoimenov (Sofia, Bulgaria) P597 Soil carbon sink and land use change in the Emilia- Romagna Region (Italy) P579 Climate and maize yields in Plovdiv region under Rosa Marchetti (San Cesario, Italy) irrigation Georgi Stoimenov (Sofia, Bulgaria) P598 Adaptation of carbon mineralization to climate change in southern and northern areas of the boreal P580 How does tillage affect carbon dioxide emissions forest zone from agricultural soils? Pekka Vanhala (Helsinki, Finland) Gerlinde Trümper (Vienna, Austria) P599 A measuring device for the simultaneous direct P581 Environmental changes and the transformation of determination of N2 and N2O emission from soil soils in case of lowland areas, SE Hungary cores Gyöngyi Barna (Szeged, Hungary) Michael Pfeffer (Vienna, Austria) P582 The effects of global changes on the transformation P600 Effect of N fertilization and tree girdling on soil of soils and landscape in the Great Hungarian Plain greenhouse gas emissions János Rakonczai (Szeged, Hungary) Barbara Kitzler (Vienna, Austria) P583 Carbon budget of peat lands of Southwest-Germany P601 Effect of the composition and degree of stabilization Andrea Ramirez (Stuttgart, Germany) of organic amendments on the enhancement of soil organic C P584 Climate Change - A Challenge for Saxon Soils? Nuria Serramiá (Murcia, Spain) Stephanie Hurst (Dresden, Germany) P602 Rainfall chemical characteristics in native Grass P585 Effects of tillage system on soil microbiological compared to Seasonal Deciduous Forest in Itaara- activity of agriculturally used soil in Austria RS, Brazil Undrakh-Od Baatar (Vienna, Austria) Mauro Schumacher (Santa Maria, Brazil) P586 Impact of modified temperature and precipitation regime on soil microorganisms and carbon cycling in arable soils Christian Poll (Stuttgart, Germany) MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008) P603 Seasonal effects on microbiological methane cycling P618 Preferential flow of water and solutes along in UK forest soils. PDFURSRUHVXQGHUWLOOHGDQGXQWLOOHGORHVVVRLO$ Theresa Hudson (Exeter, United Kingdom) multiple tracing field study P604 Recent organic matter accumulation related to Mandy Brak (Leipzig/ Hohenheim, Germany) nitrogen deposition and climatic factors in four Scottish ombrotrophic peat bogs P619 Infra-red thermometer application for soil and plant Joanna Cloy (Edinburgh, United Kingdom) water regimes Georgi Stoimenov (Sofia, Bulgaria) P605 Impacts of climate changes on rhodic ferrasols and lixisols of Burkina Faso P620 Impact of stony soils on soil water retention and Roger Kissou (Ouagadougou, Burkina Faso) hydraulic conductivity - comparison between field measurements and lab experiments P606 Modelling impacts on soil organic carbon stocks and Nicole Emerstorfer (Vienna, Austria) crop yields under climate change using EPIC - a case study analysis in Slovakia P621 Thermal water exploitation and it's environmental risk in Hungary Juraj Balkoviþ (Bratislava, Slovakia) Kitti Balog (Szeged, Hungary) P607 Changes of microbial activity along altitudinal transects in the volcanic mountains of Central P622 Constructing a soil hydraulic conductivity map using Slovakia SHGRWUDQVIHUIXQFWLRQVDQG*,6 DSSOLFDWLRQWR Erika Gömöryová (Zvolen, Slovakia) +RURLDWDEDVLQ5RPDQLD Ionut Vasiliniuc (Iasi, Romania) P623 P movement to the Missisquoi Bay: Quebec interventions at different scales Marc Laverdière (Quebec,QC Canada) 66RLODQG:DWHU±3UDFWLFDO$SSOLFDWLRQV 3RVWHU$UHD P624 Changes of soybean and wheat yields - I.Under non irrigated conditions P608 $SSURDFKIRUDQLPSURYHGDVVHVVPHQWRILUULJDWLRQ Vera Tsenova (Sofia, Bulgaria) indirect long-term impacts on soil fertility P625 Changes of soybean and wheat yields - II.Under Oktiabrina Bakhlaeva-Egorova (Montecillo, Mexico) optimal irrigation P609 The physical and mathematical analysis of irrigation Vera Tsenova (Sofia, Bulgaria) water optimization in arid conditions P626 Akif Gerayzade (Baku, Azerbaijan) )LHOGDQGODERUDWRU\FDOLEUDWLRQRIWZR7'5VHQVRUV Victoria Kolupaeva (Bolshie Vyazemy/Moscow, P610 Biological activity of water in agriculture problems Russian Federation) Nemat Mamedov (Baku, Azerbaijan) P627 Nitrate loss from tillage land - linking the unsaturated P611 Changes in soil properties due to different soil and and saturated zone responses water conservation methods in a non-terraced Alina Premrov (Dublin, Ireland) sloping oil palm plantation P628 Christopher Teh (Serdang, Malaysia) $JULFXOWXUDOODQGVLUULJDWLRQIHDVLELOLW\RI+DUVRYD 7DEOHODQG'REURJHDDUHD5RPDQLD P612 Ecological-hydrological evaluation of Humic Ion Seceleanu (Bucharest, Romania) Gleysols drained by plastic and ceramic drainage P629 Correlations in the soil-water-plant system in the during 20 years unirrigated and irrigated sugarbeet from Western Ivan Kovalev (Moscow, Russian Federation) Romania P613 $GYDQFHVLQ'HWHUPLQLQJ6RLO:DWHU3RWHQWLDO8VLQJ Cornel Domuta (Oradea, Romania) DQ(QJLQHHUHG3RURXV&HUDPLFDQG'LHOHFWULF P630 Basic guidelines to interpret soil moisture data Permittivity obtained with capacitance probes Bryan Wacker (Pullman,WA United States) Francisco Fonseca Salcedo (Cervera, Spain) P614 Groundwater quality and threshold values for P631 Chemical species of toxic metals in interstitial water irrigation in the River Basin of Pinios, Greece of sediment from the Paldang reservoir in Seoul Theodore Karyotis (Larissa, Greece) Jae E. Yang (Chuncheon, Republic of Korea) P615 'U\ODQGPDL]H\LHOGVDQGZDWHUXVHHIILFLHQF\LQ P632 Thornthwaite and Mather equation modeling to response totillage and nutrient management describe the soil moisture evolution in olive groves practices in China under two types of soil managements: cover crops Xiaobin Wang (Beijing, China) and conventional tillage P616 Characterization of the soil water content profile Ordóñez Rafaela (Córdoba, Spain) along a frequency domain reflectometry probe using P633 Parametric estimation of water retention for advanced forward and inverse modelling techniques gypsiferous soils using Pedotransfer functions Arlène Besson (Louvain-la-Neuve, Belgium) Ahmad Farrokhian Firouzi (Tehran, Iran) P617 Model for evaluating maximum nitrate leaching P634 Predicting water retention curve of gypsum soils fluxes to free aquifers for prevention grounwater using point Pedotransfer functions polution at catchment level according with Nitrate Ahmad Farrokhian Firouzi (Tehran, Iran) 'LUHFWLYH Mihail Dumitru (Bucharest, Romania)
MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008) P635 Correlation between the crop water stress index and P650 Evaluation of the controls on humic acid-mineral irrigation water requirements for apple in a loamy interaction soil: a case study in southern Romania Burcu Özkaraova Güngör (Samsun, Turkey) Cristian Paltineanu (Pitesti-Maracineni, Romania) P651 Wetting-drying cycles effects on persistence of a P636 Field calibration of capacitance soil water content natural mucilage, iron chloride and alum as sensors in expansive clay soils structuring materials José L. Muriel (Alcalá del Río (Sevilla), Spain) Orlando Rodríguez-Rodríguez (Barquisimeto, Venezuela) P637 Use of capacitance soil water sensors to evaluate irrigation scheduling and irrigation distribution P652 Soil aggregate stability assessment based on a uniformity in field crops combination of wet-sieving techniques and Antonio Jesús Espejo-Perez (Alcalá del Río, Spain) turbidimetry Massumeh Nikpour (Hamadan, Iran) P638 Dynamics of the moisture regime of a floodplain forest under original and anthropically affected P653 Testing DRIFT for analyzing organic matter conditions composition at intact flow path surfaces Vitezslav Hybler (Brno, Czech Republic) Martin Leue (Müncheberg, Germany) P639 Reduction in soil evaporation losses due to crop P654 Study of the potentially mineralized nitrogen content residue on soil surface in three soil texture classes and nitrogen supply of a brown forest soil by Reimar Carlesso (Santa Maria - RS, Brazil) incubation method in East Hungary János Kátai (Debrecen, Hungary) P640 Effect of repeated application of composts on the dynamics of water in soil P655 Capability of wheat (Triticum aestivum L.) to uptake Maha Chalhoub (Thiverval-grignon, France) potassium from three K-bearing minerals and its effect on mineral transformation P641 Soil evaporation losses during maize growth Seyed Javad Hosseinifard (Isfahan, Iran) cultivated in different types and amount of crop residue on soil surface P656 Difference of arsenic mobilization processes in Reimar Carlesso (Santa Maria - RS, Brazil) submerged soils of a jute pond and a rice paddy in West Bengal, India P642 Modelling the Hydrological Response of Land Use Syed Farooq (Karlsruhe, Germany) Change in Zanjanrood Basin Golaleh Ghaffari (sanandaj, Iran) P657 A preliminary study of the effectiveness of the sodium pyrophosphate as selective extractant for Al P643 Soil Research in view to introducing irrigations in and Fe organically bound in andic soils Baragan Plain Simona Vingiani (Portici, Italy) Andrei Vrînceanu (Bucharest, Romania) P644 Preferential flow and slow convective chloride transport through the glossic acidic soil of a beech forest (Fougères, France) Arnaud Legout (Champenoux, France) S05 Soil Desertification and Salinisation (Poster Area 2)
P658 Effects of different growing medium salinity on germination and seedling growth stages of canola (Brassica napus L.) S14 Organo-mineral Interactions (Poster Area 1) Vahid Reza Jalali Moakhar (Tehran, Iran) P659 Modeling canola response to salinity under P645 Behavior of heavy metals in the model soil system, vegetative growth stages consisting of mineral, liquid and organic components Vahid Reza Jalali Moakhar (Tehran, Iran) Leonid Perelomov (Tula, Russian Federation) P660 Researches regarding the degraded soils through P646 Thin layer chromatography study of organomineral salinisation for their prevention, control and complexes using the system of bioremediation polyphenol/aluminum hydroxide Eugen-Gabriel Teodorescu-Soare (Iasi, Romania) Martina Franke (Trier, Germany) P661 Long-Term Soil Degradation and Desertification in P647 Effects on suspensions dispersed particles & water Iran purification produced by Cardon Dato mucilage, iron Iraj Emadodin (Kiel, Germany) chloride, alum, and their combinations Manuel Henríquez-Rodríguez (Barquisimeto, P662 reclamation of saline and sodic soils with out using Venezuela) reclamtor via laboratory physical models Anahita Polous (Tehran, Iran) P648 Photodegradation of methanol, glutamic acid and glucose on the surface of iron-bearing minerals P663 Natural risk Management «of sand moves and Maria Andrianaki (Bristol, United Kingdom) desertification" In the region of Ziban - Cases in the region of El Hadjeb & Ain beneoui (Biskra - Algeria) P649 Growth and Nutritional Status of Grapevine Tewfik Mostephaoui (Biskra, Algeria) Inoculated with Arbuscular mycorrhizal (AM) fungi in Chile P664 Desertification Vulnerability in Gorgan Plain, Eduardo von Bennewitz (Curicó, Chile) Northern of Iran Majid Ownegh (Gorgan, Iran)
MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008) P665 Salts dynamics on a soil cropped with muskmelon P679 Preparation of different growing media for apartment under drip irrigation and ornamental plants in the north of Iran Frank Zamora (Coro, Venezuela) Raziyeh Khalili Rad (Tehran, Iran) P666 Saline soil-landscape relationships, Centre-West Senegal Francois Matty (Dakar, Senegal) P667 Progress in developing a process-based model linked to a geographical information system for soil S22 Education in Soil Science and Raising Public salinity assessment at basin scale: the GIS- Awareness (Poster Area 2) SALTIRSOIL model Juan Sanchez (Albal. Valencia, Spain) P680 Soil Museum of Azerbaijan as a center of education P668 Assessment of desertification in Gran Canaria and public awareness (Canary Islands, Spain) from factors and processes Rena Mirzazade (Baku, Azerbaijan) Juan Sanchez (Albal. Valencia, Spain) P681 Media Catalogue for Introduction of Soil-related P669 A proposal for soil chemical indicators in areas Topics in School Teaching characterised by risk desertification in the Klaus Mueller (Osnabrück, Germany) mediterranean region P682 Soil Games in Osnabrück Carmen Perez-Sirvent (Murcia, Spain) Klaus Mueller (Osnabrück, Germany) P670 Reduction of Salt Activity by Green Manure P683 %XEEOLQJWKHPXGDZD\$SXSLOV¶SURMHFWRQ Application in Plastic Film House Soil biological sludge removal from a eutrophic pond Pil Joo Kim (Jinju, Republic of Korea) Holger Ciglasch (Hannover, Germany) P684 SIMSURVEY - A tool for geostatistical analyses of soil contamination data with R on the web Andreas Papritz (Zürich, Switzerland) S29 Time scales of pedogenic processes for predicting soil P685 Soil protection and education - Strategies in Saxony changes in time (Poster Area 2) Stephanie Hurst (Dresden, Germany) P686 Forest Soils of Switzerland: how to use the data for P671 Effects of rye green manure application in soil practical applications physical and chemical characteristics in Maragheh Peter Lüscher (Birmensdorf, Switzerland) dryland condition zone Seyed Bahman Mousavi (Maragheh and Tabriz, P687 Do-It-Your-Soil, a virtual course of applied pedology Iran) Géraldine Bullinger-Weber (Neuchâtel, Switzerland) P672 Effect of Peanut Compost And/or Cobalt Application P688 Soil Analysis Support System for Archaeologists on Cowpea plants Growth, Yield Parameters And (SASSA) Nutrients statues Clare Wilson (Stirling, United Kingdom) Hala Kandil (Giza, Egypt) P689 The Learning Region Concept for Soil and Land P673 Effect of Sewage sludge on Plant Growth in Sandy Werner Kvarda (Vienna, Austria) Soil Ali AlJaloud (Riyadh, Saudi Arabia) P674 Study of the effects of nitrogen fixation system on biochemical's of Agrobacterium tumefaciens in some S12 Management of Contaminated Soils (2): concepts and Medicago cultivars policy development (Poster Area 2) Mohamad Rahimi (yasouj, Iran)
P675 Yield and yield components of two dryland wheat P690 Testing the usefulness of using a generic reference cultivars as influenced by crop residue and nitrogen level for Cu for risk assessment in Mediterranean rates agricultural soils Hossein Sadeghi (Shiraz, Iran) Luis Recatala (Albal. Valencia, Spain) P676 Antimicrobial effects of some egyptian medicinal P691 Influence of Salts in Fractionation of Chromium in plant methanol extracts against some soil-borne Agricultural Soils of central Greece microorganisms Evangelia Golia (Nea Ionia Magnissias, Greece) Essam Hoballah (Giza, Egypt) P692 principal component analysis of potentially toxic P677 Stubble Burning, A Serious Threat to Crop elements in forest soils of bulgaria Production and Soil Fertility in Iran Jaume Bech (Barcelona, Spain) Soheila Ebrahimi (Tehran, Iran) P693 Recent EU Developments in the Management of P678 Effect of azospirillum and azotobacter inoculation Contaminated Soil - a Legal Perspective with farmyard manure and nitrogen application on Aoife Shields (Cork, Ireland) yield and yield components in a wheat cultivar in fars province Abdollah Bahrani (Ramhomoz, Khozastan, Iran)
MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008) P710 Impact of historical fly-ash immission on chemical S15 Soil Information Systems, Regionalisation of Soil Data properties of forest soils including Soil Associations (Poster Area 2) Heiko Fritz (Tharandt, Germany) P711 Spatial variation of enzyme activity in wood soil P694 Identification and regionalization of dominant runoff types of Adygea processes - A GIS-based approach Alexander Larikov (Rostov-on-Don, Russian Christoph Müller (Trier, Germany) Federation) P695 Soil Information in Germany: The 2008 Position P712 Development of Assessment Method for Forest Soil Wolf Eckelmann (Hannover, Germany) Compaction P696 Lost in the triangular diagrams of soil texture Maja Krzic (Vancouver,BC Canada) Anne Richer de Forges (Ardon, France) P713 Does stump harvesting modify forest soil P697 Biomass production potential on saline and sodic decomposer community? soils in Southwest Asia Saana Kataja-aho (Jyväskylä, Finland) Boris Vashev (Stuttgart, Germany) P714 Changes in physico-chemical properties of forest P698 Spatial and thematic improvement of the Digital soils affected by fires in the Osogovo Mountain, Kreybig Soil Information System for specific Bulgaria functional applications Emiliya Velizarova (Sofia, Bulgaria) László Pásztor (Budapest, Hungary) P715 &DWWOH*UD]LQJLQ%ULWLVK&ROXPELD&DQDGD¶V P699 Designation of low-productivity areas for cultivation Forested Rangeland: an Example of Integrated Land of wild growing fungi Use László Pásztor (Budapest, Hungary) Maja Krzic (Vancouver,BC Canada) P700 Spatial interpolating soil organic carbon using P716 Spatial diversity of lead concentration in forest soils several interpolator predictors in the area of Karkonosze National Park Masoud Davari (Tehran, Iran) Katarzyna Szopka (Wroclaw, Poland) P717 Relations of soil and forest vegetation in an area of intensive forest management and land up-lift at the Olkiluoto Island, Finland Anne-Maj Lahdenperä (Vantaa, Finland) S09 Forest Management and Soils (Poster Area 3) P718 Development of soil chemistry on intensively monitored forest ecosystems plots in the Czech P701 Soil quality changes under innovative agroforestry Republic during 1995 - 2005 systems 9tW6UiPHN -tORYLãWČ, Czech Republic) Maria Wolff (Tharandt, Germany) P719 Change in the chemical properties of forest soils two P702 Combination of deterioration rate and weather factor and five years after liming in evaluating durability of small wooden check dams /XFLH9RUWHORYi -tORYLãWČ, Czech Republic) Dang Quoc Dung (Tokyo, Japan) P720 Compaction of forest soils; a traffic experiment with P703 Isolating the effect of soil moisture on the soil heavy forestry machinery - Soil biological, physical respiration - temperature relationship and mechanical aspects Robert Szava-Kovats (Tartu, Estonia) Stéphane Sciacca (Birmensdorf, Switzerland) P704 Effects of parent soil material and tree species on P721 Monitoring of soil parameters after a forest soil litter decomposition in Hyrcanian Forest, Iran restoration Vahid Hosseini (Sanandaj, Iran) Hans Unterfrauner (Graz, Austria) P705 Selection of tree species for the afforestation of P722 Soil conditions on sites of autochthonous European halomorphic soils in Vojvodina black poplar in Slovenia Zoran Galic (Novi Sad, Serbia) Mihej Urbanþiþ (Ljubljana, Slovenia) P706 How reliable are soil water measurements for P723 Seepage water quality before and after clear cutting estimation of water balance components? A of Norway spruce stands at Ballyhooly (Ireland) and comparative experimental study in spruce and Höglwald (Germany) under high sea salt and beech stands in the Tharandt forest (Germany) nitrogen deposition Kai Schwärzel (Tharandt, Germany) Christian Huber (Freising, Germany) P707 Soil Solution Chemistry and Impact of Forest P724 Nutrient cycling and soil properties after harvester Thinning in Temperate Forests in Taipingshan, thinning in an nutrient poor Norway spruce stand Northeastern Taiwan Christian Huber (Freising, Germany) Chen Tsai (Ilan, Taiwan) P725 The evaluation of deforestation effects on some soil P708 Fly ash impact on soil physical properties of forest chemical characteristics in four different regions of soils Guilan province Peter Hartmann (Kiel, Germany) Amir Bahrami (Tehran, Iran) P709 Impact of Mn2+ addition on carbon release (DOC P726 Evaluation of effects of converting forest to tea on and CO2) from forest floor horizons soil fertility characteristics: case study in Guilan Florence Trum (Louvain-la-Neuve, Belgium) province Amir Bahrami (Tehran, Iran) MON TUE THU FRI Poster Session 4 (Friday, August 29, 2008) P727 Effect of clear-cutting on soil carbon pool and CO2 P738 A case study of soil removal affected soil-forest fluxes from boreal forest soil environment in the industrializing area Jukka Pumpanen (Helsinki, Finland) Dang Quoc Dung (Tokyo, Japan) P728 Using dissolved organic carbon for Norway spruce P739 Humus forms under Quercus spp. in Mediterranean transformation conditions Michal Remes (Brno, Czech Republic) Anna Andreetta (Firenze, Italy) P729 Time-related changes in size distribution and quality P740 Spruce resin affects C and N transformations in of charred materials set down on soil following a birch soil wildfire in a pine forest in Central Italy Martti Uusitalo (Vantaa, Finland) Caterina Nocentini (Firenze, Italy) P741 N-P-K retranslocation in Pinus taeda L. needles in P730 Soil temperature and moisture conditions: effect on Rio Grande do Sul-Brazil tree vitality Marcio Viera (Santa Maria, Brazil) Liisa Ukonmaanaho (Vantaa, Finland) P742 Impacts of four tree species on forest soil chemistry P731 Decomposition rate in the floodplain forest and nutrient fluxes: a Sr isotopic approach Helena Lorencová (Brno, Czech Republic) Juliette Herouet (Bruxelles, Belgium) P732 Confrontation of soil quality under limed and non- P743 CH4 uptake of soils of a temperate deciduous forest limed stand in the mountain forest with different abundance of European beech (Fagus Sabina Truparová (Brno, Czech Republic) sylvatica L.) Heiner Flessa (Göttingen, Germany) P733 Forest floor vegetation as indicator for soil deformation P744 Processes of soil solution P supply in a very low P Thorsten Gaertig (Göttingen, Germany) sorbing forest soil David Achat (Villenave d'Ornon, France) P734 Does species composition affect soil carbon pools in Mediterranean mountain forests? P745 Mechanical mixing of moder humus promotes Eugenio Díaz-Pinés (Madrid, Spain) mineralization of older soil organic N Arnaud Legout (Champenoux, France) P735 Spatial and temporal variability of nitrate and other ions and elements in seepage water below a N P746 Polyphenol oxidase, tannase and protease activity in saturated mature spruce stand relation to tannin concentrations in soil under silver Michael Kohlpaintner (Munich, Germany) birch and Norway spruce Bartosz Adamczyk (Lodz, Poland) P736 Effects of thinning on the soil moisture content of Acacia mangium plantations in Northeast Thailand P747 Relations between soil properties and growing Masaharu Sakai (Tsukuba,Ibaraki, Japan) characteristics of Grey alder (Alnus incana L.) stands in Western part of Latvia P737 Natural regeneration of Norway spruce 16-18 years Andis Bardulis (Salaspils, Latvia) after intensive forest management Raimo Sutinen (Rovaniemi, Finland)
MON TUE THU FRI Poster Awards
AWARD by the ECSSS and EUROSOIL 2008 Out of all presented posters one or two (depending on the overall number of posters per Symposium / Topic) for each Symposium / Topic will be nominated by the respective convenors. The selected posters will be marked and moved by the FRQJUHVVVWDIIWRDVSHFLDO³3RVWHU$ZDUG)LQDOLVWV´DUHD PDLQHQWUDQFH 7KH 3RVWHU &RPPLWWHH ZLOO WKHQ VHOHFW WKH WHQ EHVW SRVWHUV RXW RI WKH ³3RVWHU $ZDUG )LQDOLVWV´ DUHD 7KH DXWKRUV RI WKHVH posters will receive a diploma and EUR 200,-. Prices will be awarded in the Closing Session on Friday, August 29, 2008, 17.00 -18.00 hrs. .
Poster Committee: 0DUWLQ*HU]DEHN9LHQQD$XVWULD )HUGR%DVLF=DJUHE&URDWLD Erika Micheli, GödöllĘ, Hungary 5DLQHU6FKXOLQ=XULFK6ZLW]HUODQG
Judging criteria 1) Content UHOHYDQWRULJLQDOXSWRGDWHHWF ±ZHLJKWLQJ 2) Experimental plan and techniques (controls, replicates, accuracy of tKHXVHGWHFKQLTXHVHWF ±ZHLJKWLQJ 3) Presentation GHVLJQFODULW\HWF ±ZHLJKWLQJ
$:$5'E\WKHMRXUQDO³%LRORJ\DQG)HUWLOLW\RI6RLOV´ This award is for the best poster presented by a young scientist LQVHVVLRQVZKRVHVFLHQWLILFDUHDLVFRYHUHGE\WKLVMRXUQDO
1) Soil Organic Matter 2) Soil Ecology- Soil as Living Space 3) Organo-mineral Interactions 5KL]RVSKHUH3URFHVVHV 6RLODQG*02V 6) The influence of soil quality on human health and food security 7) Soil fertility and Environment
The winner will receive all issues of the journal in 2009 and she/he will have free access to the website of the journal.
7KH&RQYHQRUVRIHDFKRIWKHDERYHPHQWLRQHGVHVVLRQVZLOOQRPLnate the best poster of the specific session presented by a \RXQJVFLHQWLVW \HDUVRU\RXQJHU 7KHQDILYHPHPEHUFRPPLttee nominated by the Editor-iQ&KLHIRIWKHMRXUQDODQGWKH Organiser of EUROSOIL will choose the best poster among the overall nominations.
Poster Committee: 3DROR1DQQLSLHUL)ORUHQFH,WDO\ Heike Knicker, Munich, Germany David Hopkins, Dundee, United Kingdom $QJHOD6HVVLWVFK6HLEHUVGRUI$XVWULD .RUQHOD6PDOOD%UDXQVFKZHLJ*HUPDQ\
Judging criteria 1) Content UHOHYDQWRULJLQDOXSWRGDWHHWF ±ZHLJKWLQJ 2) Experimental plan and techniques (controls, replicates, accuracy of tKHXVHGWHFKQLTXHVHWF ±ZHLJKWLQJ 3) Presentation GHVLJQFODULW\HWF ±ZHLJKWLQJ Workshops
:25.6+23±,17(51$7,21$/$1'(862,/32/,7,&6 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Pavol Bielek, VUPU, Slovakia Co-convenor: Winfried E.H. Blum, BOKU, Austria
DESCRIPTION Soil politics is a key issue for sustainable soil use and soil protection, which regrettably are not satisfactory at a national and an international level. Participants of the Workshop are invited to prepare and contribute opinions, arguments and experiences relevant to this topic. As a result of the discussions, we hope to define the main deficits on the scientific level as well as on the decision level. This will also be the topic for the main presentations. At the end, we hope to present new research findings in legal issues and decision making. New ideas and research results which support soil politics are welcome. A central approach could be the protection of specific soil functions, which could possibly improve the progress in research as well as in the development of legal instruments and decision making. We also hope to define priorities in the assessment of soil protection politics and in the definition of new proposals for the implementation of soil politics within the management of natural resources, including the International Conventions.
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ Opening and short introduction into the 14.00-14.20 P. Bielek topics of the workshop International and EU soil protection strategies: 14.20-15.00 L. Montanarella status and future perspectives Soil politics between environmental protection and 15.00-15.30 W.E.H. Blum knowledge-based bioeconomy Towards an European framework for soil sustainability: 15.30-16.00 J. Rubio the role of ESSC 16.00-16.30 Coffee Break 16.30-17.00 UNCCD, UNCBD, UNCCC The role of soils in International Conventions 17.00-18.00 Moderator: P. Bielek Discussion Workshops
:25.6+23±+8086$6$1(&2/2*,&$/,1',&$725 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Klaus Katzensteiner, BOKU, Austria Co-convenor: Augusto Zanella, Univ. Padova, Italy
DESCRIPTION
1. Historical path 2. Recent engagement 3. Issue
1. A network of European humus researchers was founded in Trento (Italy) in 2003. In July 20WKHFRPPLVVLRQ³&ODVVLILFDWLRQ RI (XURSHDQ +XPXV)RUPV´PHWLQ9LHQQD $XVWULD DQGGUDIWHGa key to the main terrestrial humus forms based on response to environmental conditions and specific biological activities. This draft was presented in Freiburg (Germany) at EUROSOIL 2004. From this event, other goals have been achieved: the definitive admission of the Amphi forms at the first level of classification GXULQJWKHPHHWLQJLQ6DQ9LWR 8QLYHUVLW\RI3DGXD,WDO\ ; a draft of a European key of classification was presented in the form of a poster at the 18th Congress of Soil Science (USA, Philadelphia, 2006). It was further agreed to use in the European key of classification international references concerning the structure of soils (as defined in the USDA Soil Survey Manual, 1993, or World Reference Base for Soil Resources, FAO 2006). In succession the attempt was made to apply the classification system to Mediterranean humus forms (Meeting of the Humus Group in Sardinia; University of Cagliari, Italy 2007). The proposed classification key has been implemented into tKHPDQXDORIWKH81(&(±,&3IRUHVW KWWSZZZLFS IRUHVWVRUJ0DQXDOKWP 2. The first general principles of a common classification have been finalized. Protocols for assessment and sampling of ecto- and endorganic layers were set up as well as definitions of specific horizons and their designation. The Humus Group sees the key to humus classification as its common effort, which may contribute to the understanding of ecosystem functioning and may establish humus classification as a diagnostic tool for ecosystem status. The Humus Group sees the description of humus forms as a tool to characterize systems or communities of biota, which evolve together in response to environmental factors and humus forms may be indicative for these. We see the very abstract procedure of classification of humus forms as our common and demanding task, which makes sense especially under the above aspects. 3. The EUROSOIL 2008 is perceived by the Humus Group as a forum which allows us to introduce the wider scientific community to our intentions and to further our efforts towards an internationally agreed classification and standardization of defined humus forms. To achieve these goals a workshop is organized around the theme: "Humus as an ecological indicator". In accordance with the above described points, the workshop is organized into three subthemes: 1. Humus classification (contact: [email protected]), 2. Humus functioning (contact: [email protected]) and 3. Humus as an ecological indicator (contact: [email protected]). Before the workshop each subgroup should prepare a paper on the relevant subgroup topic (as described above), which will be presented to the other teams during the workshop. The final outcome should be a common standardized treatise of the overall theme, which may integrate all three subthemes and may contribute to the overall understanding of humus as an ecosystem indicator.
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ ± ,QWURGXFWLRQ ZK\DZRUNVKRSKRZWRPDQDJHIRUUHVXOWV« ± +XPXVDVDQHFRORJLFDOLQGLFDWRU FRRUGLQDWRU¶VLQWHUYHQWLRQ ± Discussion ± Coffee Break ± +XPXVIRUPVIXQFWLRQLQJ FRRUGLQDWRU¶VLQWHUYHQWLRQ ± Discussion ± +XPXVIRUPVFODVVLILFDWLRQ FRRUGLQDWRU¶VLQWHUYHQWLRQ ± Discussion ± Lunch Break ± Redaction of a common paper (joined units) ± Coffee Break ± Research projects Workshops
:25.6+23±(8)25(6762,/021,725,1*±%,262,/ :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenors: Ernst LEITGEB, Austria; Eric VAN RANST, Belgium
Time Title of Presentation Speaker Authors 08.30-09.00 Keynote talk: Tracy Houston Durrant Tracy Houston Durrant, Luca The European Communities' Montanarella, Jesús San Miguel-Ayanz project BioSoil : Status and EC, JRC, Institute for Environment and Perspectives Sustainability, Land Management and Natural Hazards Unit 09.00-09.15 BioSoil one year inventory Lars Lundin Lars Lundin compared to Swedish special Swedish University of Agricultural Sciences, attention to carbon storage Uppsala 09.15-09.30 Forest soil monitoring in the UK Elena Vanguelova Elena Vanguelova Environmental & Human Sciences Division, Forest Research, Farnham, Surrey, UK 09.30-09.45 Modelling soil spatial variability in Stefano Carnicelli Ciampalini1, R., Andrcetta, A.1, an ICP level II plot Cecchini, G.1, Carnicelli, S.1, Poggio, G.2, Matteucci, G.3 1 University of Firenze, D.S. S.N.P., Italy 2 CNR-ISE, Pisa, Italy 3 CNR-ISAFOM, Rendz, Italy 09.45-10.00 Humus types as indicators of Nicole Wellbrock Nicole Wellbrock, Steffen Schobel, changing environmental Gerhard Milbert, Jan Martin conditions in German forests Federal Research Centre for Forestry and Forest Products, Institute for Forest Ecology and Forest Assessment, Eberswalde, Germany 10.00-10.15 %LR6RLO$XVWULD±LQWHULPUHVXOWV Franz Mutsch Franz Mutsch, Robert Hacker Spatial variability and changes Federal Research and Training Centre for over time Forests (BFW), Vienna 10.15-10.30 Humus characteristics in forest Michael Tatzber soils using FTIR Spectroscopy 10.30-11.00 coffee break 11.00-11.15 Harmonisation and quality Nathalie Cools Nathalie Cools, Bruno De Vos, Jari measures within BioSoil Hinsch Mikkelsen Forest Soil Co-ordinating Centre, Research Institute for Nature and Forest, Geraardsbergen, Belgium 11.15-11.30 Profile description and Jari Hinsch Mikkelsen Jari Hinsch Mikkelsen, Nathalie Cools, classification within BioSoil Bruno De Vos Forest Soil Co-ordinating Centre, Research Institute for Nature and Forest, Geraardsbergen, Belgium 11.30-12.30 Guided discussion on topics Discussion panel : already introduced in the key Tracy Houston Durrant (JRC) talks Nathalie Cools (FSCC) Christine Le Bas (INRA)
Participants José Manuel Grau Lars Lundin Elena Vanguelova Stefano Cannicelli Nicole Wellbrock Franz Mutsch Michael Tatzber Gerhard Milbert Workshops
:25.6+23FRQWLQXHG±(8)25(6762,/021,725,1*±%,262,/ :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 7RSLFVRIGLVFXVVLRQ
1) What should/will be the availability of the BioSoil data? a. Regards timing (when will the database be open?) b. Regards ownerships and accessibility (who will have access to the data and to which level?) c. Type of the data that will be made available: subsets// aggregated data d. Regards the scale (full coordinates available or not)?
2) Quality aspects of the BioSoil data a. Use of laboratory methods (use of reference methods, QDWLRQDOPHWKRGV DQGDQ\µLQEHWZHHQ¶RUDGDSWHGIRUPVRI methods) b. Factors influencing accuracy and precision c. QAQC measures at the different levels 1) field 2) lab 3) data submission (quality checks on the data by JRC/INRA) d. Performance of laboratories based on Interlaboratory Comparisons, FSCC reference material
3) What have been the experiences with the WRB soil classification on the European forest soils? a. General discussion on bottlenecks and advantages b. To which level of detail did it serve the best way the purposes of the project? (N° of qualifiers and specifiers) So at which level of detail is WRB feasible for a European wide inventory? c. Necessity for chemical data (High costs involved => does it pay back?)
4) What are the stratification possibilities of the data? a. Use of WRB? At which level of detail? b. Use of humus classification system? c. 2WKHUVXJJHVWLRQV«
5) Can BioSoil data provide answers to research questions related to carbon storage and sequestration, impact of climate change.
6) What can we do better in the next forest soil survey? How can we use our experience gained in BioSoil in the future? Workshops
:25.6+23±62,/48$,/7< :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenors: Luca Montanarella, Italy; Gergely Tóth, Italy
7LPH 6XEMHFW Speaker 7LWOHRISUHVHQWDWLRQ L. Montanarella Soil Thematic Strategy of the EU: the framework for protecting 2SHQLQJDGGUHVV A. Jones the quality of soils in Europe 8.30-8.50 *HQHUDOFRQFHSW 6RLO4XDOLW\±$FRQFHSWLQVXSSRUWRIWKH7KHPDWLF6WUDWHJ\IRU G. Tóth RI64 Soil Protection Questions All Function of salt affected soils in Europe: biomass production or 7KUHDW, G. Várallyay nature conservation? 8.50-9.20 6DOLQL]DWLRQ T. Tóth Crop yields as affected by soil salinity, sodicity and alkalinity Questions All Soil deformation as a threat to soil functioning - how intense can 7KUHDW,, R. Horn soil functions be influenced and what are the possibilities to 9.20-9.40 &RPSDFWLRQ define critical values L. Montanarella 6RLOVXVFHSWLELOLW\WRFRPSDFWLRQ±HYDOXDWLRQRQ(XURSHDQOHYHO Questions All 7KUHDW,,, %LRGLYHUVLW\ C. Gardi Main threats on soil biodiversity: pressures and driving forces 9.40-10.00 GHFOLQH Questions All 10.00-10.20 Coffee break E. Rusco Soil Erosion: a main threat to the soils in Europe Soil Erosion risk assessment in the Alps area according to the 7KUHDW,9 C. Bosco IPCC scenario 10.20-10.50 (URVLRQ An example of soil threat evaluation: wind erosion assessment H. Reuter using DSM techniques Questions All The landslide threat to development in sloping areas: implications J. Hervas and prevention strategies 7KUHDW9 Landslide Risk Mapping in Urban Spaces by Using High- 10.50-11.20 /DQGVOLGHV R. Seliger 5HVROXWLRQ'(0±D&RPSDUDWLYH$QDO\VLVRI6RLO6WDELOLW\LQ Sarno (South Italy) and Recife (NorthEast-Brazil) Questions All 7KUHDW9, A framework to estimate the distribution of heavy metals in L. Lado 11.20-11.50 &RQWDPLQDWLRQ European Soils Questions All Application of soil organic carbon for policy-decision making in V. Stolbovoy the EU 7KUHDW9,, G. Manni Towards soil carbon status indicators in the Veneto Region 11.50-12.30 62&GHFOLQH Evaluation of the soil organic carbon status in Lombardy Region S. Brenna (Italy) Questions All 12.30-14.00 Lunch break 64,QGLFDWRU MEUSIS, a Multi-Scale European Soil Information System 14.00-14.20 P. Pangos UHSUHVHQWDWLRQ (MEUSIS): novel ways to derive soil indicators through up-scaling All Concept of soil quality description 14.20-15.40 'LVFXVVLRQ All Threat-specific analysis of soil functions 15.40-16.00 Coffee break 'LVFXVVLRQDQG 16.00-18.00 All Options for soil quality assessment in Europe: recommendations FRQFOXVLRQ Workshops
:25.6+23±&217$0,1$17'<1$0,&6,13(5,2',&$//<)/22'('62,/6 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Johannes Barth, Germany Co-convenors: Ruben Kretzschmar, Switzerland; Andreas Voegelin, Switzerland; Kai U. Totsche, Germany
Periodically flooded soils are among the most dynamic biogeochemicDOHQYLURQPHQWVRIWKH(DUWK¶Vsurface. They link terrestrial with aquatic systems and often act as important sinks and/or sources for inorganic and organic contaminants. Periodic flooding causes strong fluctuations in soil redox conditions and leads to complex abiotic and biotic transformations of pollutants, organic matter, and minerals. These processes ultimately control the behavior of contaminants in such systems. The aim of this workshop is to discuss the current state of knowledge and research needs in order to better understand biogeochemical processes that control contaminant speciation, sorption, bioavailability, and mobility in periodically flooded or waterlogged soils. Selected topics include:
5HGR[WUDQVIRUPDWLRQVDQGVSHFLDWLRQFKDQJHVRItrace metals and metalloids during redox cycles ,QWHUDFWLRQRIRUJDQLFDQGLQRUJDQLFPDWHULDOV 5HGR[WUDQVIRUPDWLRQVRIRUJDQLFSROOXWDQWV 5HJXODWLRQDQGG\QDPLFVRIPLFURELDOSURFHVVHVLQIORRGHGVRLOV 0LQHUDOVXUIDFHFDWDO\]HGUHGR[UHDFWLRQV 0LQHUDOIRUPDWLRQDQGWUDQVIRUPDWLRQV HJR[LGHVVXOILGHV &RQWDPLQDQWVRUSWLRQDQGGHVRUSWLRQXQGHUUHGXFLQJFRQGLWLRQV 5HOHDVHRIFROORLGVDQG'20LQGXFHGE\VRLOIORRGLQJRUGUDLQDJH 5KL]RVSKHUHFKHPLVWU\LQIORRGHGVRLOV
.H\QRWHOHFWXUHVZLOOEHSUHVHQWHGE\-|UJ5LQNOHEH7LP0DQVIHOGW.LUVWHQ.VHODQG7KRPDV+RIVWHWWHU
7KHZRUNVKRSLVVXSSRUWHGE\'LYLVLRQRIWKH,QWHUQDWLRQDO8QLRQRI6RLO6FLHQFHVDQGE\WKH(83URMHFW$TXD7HUUD
0RUQLQJ6HVVLRQ
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ .UHW]VFKPDU5 Welcome and introduction 5LQNOHEH- .H\QRWH '\QDPLFVRIPHWDOVLQIORRGSODLQVRLOV 0DQVIHOGW72YHUHVFK0 5HOHDVHRIDUVHQLFIURPD+DSOLF*OH\VROXQGHUYDU\LQJUHGR[ .LQ]H. .H\QRWH conditions &RIIHH%UHDN (IIHFWRIPHWDOUHGXFLQJPLFURRUJDQLVPVRQWKHPRELOLW\RIKHDY\ .VHO. .H\QRWH metals in waterlogged soils +RIDFNHU$:HEHU)$ Effect of temperature on colloidal trace metal release from a 9RHJHOLQ$.UHW]VFKPDU5 submerged contaminated floodplain soil &RQWLQ0+XUWUHO6%HUWRQL$ 6RLOUHGR[FKDQJHVHQKDQFHPHWDOIL[DWLRQLQWR)H K\GU R[LGHV &XGLQL$'H1RELOL0 *U\ERV0'DYUDQFKH0 The role of organic matter release on trace metal mobility in *UXDX*3HWLWMHDQ3 wetland soils under reducing conditions Lunch Workshops
:25.6+23FRQWLQXHG±&217$0,1$17'<1$0,&6,13(5,2',&$//<)/22'('62,/6 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6
3RVWHU3UHVHQWDWLRQ$XWKRUVSUHVHQW±
Poster $XWKRUV 7LWOHRI3UHVHQWDWLRQ Huang, J.-H., Voegelin, A., Influence of arsenate adsorption on iron and aluminum hydroxide 1 Kretzschmar, R. surfaces on microbial arsenate reduction rates Coagulation dynamics of naturally formed iron hydroxide Fritzsche, A., Totsche, K.U., Kögel- 2 nanoparticles after addition of mono-, di- and trivalent cations and Knabner, I. its relevance for arsenic mobility +DUGFRDOVDV3$&VRXUFHVLQIORRGHGVRLOV±7KHTXHVWLRQRI 3 Achten, C., Hofmann, T. bioavailability Baciu, C., Jimenez, C., Costin, D., Dispersion of cyanides and heavy metals in alluvial meterials 4 Roúu, C. FRQVHTXHQWO\WRDQLQGXVWULDODFFLGHQW 5 Overesch, M., Mansfeldt, T. Arsenic solubility and speciation in a Haplic Gleysol Klaver, G.Th, van Os, B.J.H., Négrel, 6 Fractional sedimentation of suspended matter in the Danube P., Petelet, E. Dittmar, J., Frommer, J., Voegelin, A., Spatiotemporal trends of arsenic in irrigated paddy soils in 7 Roberts, L.C., Hug, S.J., Kretzschmar, Bangladesh R. Multi-scale temporal modeling of sediment dynamics and transport Jordan, G., Gerzabek, M. 8 in floodplains. A case study for the Donau-Auen floodplains, Lair, G., Zehetner, F. Austria
$IWHUQRRQ6HVVLRQ
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ Hofstetter, T.B., Neumann, A., Reduction of organic contaminants by ferrous iron species in clay 14.30-15.15 Skarpeli-Liati, M., Lüssi, M., minerals Schwarzenbach, R. (keynote) 15.15-15.35 Rennert, T. Redox processes of iron-cyanide complexes in soils Pagels, B., Totsche, K.U., Kögel- )ORRGHIIHFWVRQFRQWDPLQDQWUHOHDVHLQDOOXYLDOWRSVRLOV±UHVXOWV 15.35-15.55 Knabner, I. from column lysimeter studies 15.55-16.20 Coffee Break Impact of interactions between rhizosphere and temporary 16.20-16.40 Paskiewicz, I., Berthelin, J. waterlogging on the mobility, redistribution and availability of trace metals associated to Fe and Mn oxyhydroxides Klaver, G.Th, Vink, J.P.M., Négrel, 16.40-17.00 Contaminant dynamics in the river Meuse basin P., Petelet, E. 17.00 Barth, J. Concluding Remarks Workshops
:25.6+23±6RLO&ULW=RQH62,/6867$,1$%,/,7<,1(8523( :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Vala Ragnarsdottir, United Kingdom Co-convenor: Prof. Nikos Nikolaidis, Greece
DESCRIPTION In this workshop we will introduce the outcomes of work funded by the European Commission (EC) that has the aim to underpin strategies for soil protection. The EC FP6 Specific Support AcWLRQ HQWLWOHG µ6RLO VXVWDLQDELOLW\ LQ (XURSH DV GHGXFHG IURP LQYHVWLJDWLRQRIWKH&ULWLFDO=RQH¶(SoilCritZone) has several objectives: · To unify the fragmented European Soil Community - research and policy · To quantify the soil life-cycle · To develop European soil research strategy · To underpin European soil conservation efforts · To work with colleagues in the US · To include the soil concerns of the developing world This workshop will explore and debate the outcomes of the first and second workshops of SoilCritZone to be held in Bristol, October 2007, and Sofia, April 2008. These workshops will develop the themes of (i) Soil formation processes/weathering; (ii) 6RLOHURVLRQDQGGHJUDGDWLRQ LLL /LIHF\FOHRIVRLOV±PRGHlling; and (iv) Biodiversity and cross-cutting issues. This EUROSOIL ZRUNVKRSZLOOH[SHFWSDUWLFLSDQWVWRWKLQNµRXWVLGHWKHER[¶ considering fringe soil science, such as permaculture.
The workshop will begin with addresses from keynote speakers who will outline the outcomes of the workshops. Participants will then be invited to contribute to the themes using the World Café working group format.
:25.6+23 ±5,6.%$6(±:+<&$5(2)62,/6,15,9(5%$6,10$1$*(0(17" :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Jos Brils, The Netherlands Co-convenor: Vala Ragnarsdottir, United Kingdom
DESCRIPTION In the EC FP6 Coordination Action project RISKBASE (www.riskbase.info), leading European scientists and representatives of major, European stakeholder groups are reviewing and synthesizing the outcome of EC RTD Framework Program projects, and other major initiatives, related to integrated risk assessment-based management of the water/sediment/soil system at the river- basin scale. The synthesis will lead to the development of integrated risk assessment-based management approaches enabling the prevention and/or reduction of negative impacts caused by human activities on that system. Logically, risk is always connected to an object or area of concern. Within RISKBASE this risk object is defined as the goods and services provided by the soil-sediment-water ecosystem, with a specific focus on resilience of that system.
The workshop participants are challenged to debate the next three statements
Prof. Sue White will trigger the discussion on the 1st statement: "Soil is NOT an essential matrix of concern in a risk-based management approach for river basins and at the scale of catchments".
Prof. Winfried Blum will warm-up the debate on the 2nd statement: "NO scientific, biophysical evidence/indications exist for the resilience of soil systems under anthropogenic pressures".
Dr. Joop Vegter will adress his key-note towards the 3rd statement: "There are NO relevant messages from scientific findings in soil science that should find their way into Water Framework Directive River Basin Management Plans or their update(s)". Workshops
:25.6+23±025(68&&(66,1)37+528*+$1$/<6,62)7+(&$// $1'81'(567$1',1*<285&2175,%87,2172(&32/,&< :HGQHVGD\$XJXVW±KUV /RFDWLRQ%|FNO6DDO Convenor: Stephen Webb, RTD Services ([email protected])
DESCRIPTION The EU Seventh Framework Programme (FP7) has proven to be even more competitive than past Framework Programmes. The competitive edge needed to win an FP7 project begins with really understanding what the EC is looking for, both through what is written in the call text and how your project will contribute to implementation of EC policy. Evaluations are showing that many FP7 proposals are underscoring in the Impact section, which mainly deals with contribution to EC policy. Where do you find policy information and how do you know which are the ke\SROLFLHVUHOHYDQWWR\RXUSURSRVDO":KDW¶VWKHGLIIHUHQFH between the various EC policy papers? How do you properly utilise this information? How do you describe your impact in ³TXDQWLILDEOHDQGYHULILDEOHWHUPV´":KRDUHWKHVWDNHKROGHUVUHOHvant to your proposal and how to you classify and address them? This workshop will deal with: w How to analyse and apply the call text as a basis to formulate of specific scientific and technological objectives for implementation in the work plan w How to identify and utilise policy documents to strengthen the positioning of an FP7 proposal as well as to correctly address stakeholders. w Examples from soil science topics from the current FP7 Environment and/or Food calls 6WHSKHQ:HEEKROGVD0DVWHU¶VGHJUHHLQ(QYLURQPHQWDODQG(QJLneering Geology, an MBA and is currently completing his doctorate at the BOKU. He has over 12 years experience in development and management of FP projects, having worked on more than 100 proposals since FP4. He is an FP evaluator for the European Commission and is managing director of the company RTD Services, which is a management and dissemination partner in five FP projects.
:25.6+23*5((1+286(*$6%8'*(72)62,/6+27632762)(0,66,216&267 :HGQHVGD\$XJXVW±KUV /RFDWLRQ)HVWVDDO Convenor: Robert Jandl, BFW, Austria Co-convenor: Mats Olsson, SLU, Sweden
DESCRIPTION 7KHIRFXVRIWKHZRUNVKRSLVWKHGLVFXVVLRQRIUHSRUWLQJUHTXirements of soil C changes within the Kyoto protocol. Special emphasis is paid to the impact of soil disturbance and land-use change on soil carbon pools, and to the existence of hot spots of green-house gas emissions. We will explore whether or not it is possible and economically feasible to build information on ecosystem disturbance and land-use change in reporting concepts and compare that to the option of providing default values for a range of ecosystems. Moreover, we will explore to what extent the modeling of soil carbon dynamics can substitute for field assessments of soil carbon pool changes. The topics of the workshop are in line with the COST Action 639 (BurnOut; www.cost639.net). The anticipated format is that an introductory presentation is given, followed by a discussion.
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ Objectives of COST Action 639 Greenhouse gas budget of soils 8.30-8.45 Robert Jandl (BFW, Austria) under changing climate and land use (BurnOut) Zoltan Somogyi (Forest Research Keynote Reporting soil carbon stock change information under the 8.45-9.10 Institute, Hungary) UNFCCC and its Kyoto Protocol Chair: Lars Vesterdal (Univ 9.10-10.00 Copenhagen, Denmark) and Jens Discussion Leifeld (ART, Switzerland) 10.00-10.30 Coffee Break Ecosystems posing particular problems to greenhouse-gas 10.30-11.00 Mats Olsson, SLU, Sweden) reporting 11.10-12.30 Chair: Nynke Schulp, Alterra, NL Discussion 12.30-14.00 Lunch Break 14.00-14.30 Jukka Alm, METLA, Finland Quantification of greenhouse-gas emissions from peatland Chair: Ken Byrne, Univ Limerick, 14.30-16.00 Discussion Ireland 16.00-16.30 Coffee break Mediterranean soils, agricultural practices and agroenvironmental 16.30-17.00 Theodore Karyotis, Greece legislation Chair: Stephan Glatzel, Univ Rostock, 17.00-18.00 Discussion Germany Workshops
:25.6+23±1(:)5217,(56,162,/3527(&7,215(6($5&+ 3(563(&7,9(6$1'&+$//(1*(6 (66&:RUNVKRS :HGQHVGD\$XJXVW±KUV /RFDWLRQ%|FNO6DDO Convenor: José L. Rubio, CIDE, Valencia, Spain Co-convenors: Donald Gabriels, Univ. Gent, Belgium; Mike Fullen, Univ. Wolverhampton, United Kingdom
DESCRIPTION Historically, Soil Conservation Science has maintained a clear orientation to agrarian production, with a long and significant record of scientific and applied contributions. These contributions have being of considerable relevance to humanity. However, in recent decades, there have been important epistemological changes towards more holistic objectives, including environmental aspects. It is anticipated that important and new scientific paradigms will develop, owing to the wide recognition of the fundamental role of soil in the support and functioning of terrestrial systems. Particularly there are emerging and important aspects related to soil protection that require scientific analysis and conceptual reflections. These objectives include maintaining biodiversity, regulation of the hydrological cycle and water reserves, implications for the landscape, bioengineering for soil conservation, the tendency towards more ecological agriculture, the implications of global approaches and the role of soil as a source and sink of greenhouse gases and others interactions with climatic change, such as desertification. Together with gaps in knowledge and methodological constrains, there are also new research tools, technologies, equipments and methodologies that require new approaches and visions. The aim of the Workshop is to offer a deep analysis, discussion and orientations on how to meet the social and environmental demand on protecting the soil for the sound functioning of the biosphere.
:25.6+23±,17(*5$7,1*32//87$17)/8;0$1$*(0(17,17263$7,$/'(9(/230(17 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Erwin Hepperle, ETH Zurich, CH ([email protected]) Co-convenor: Stephen Nortcliff, Univ. Reading, UK ([email protected])
DESCRIPTION Large areas of land are affected by diffuse pollution in particular in urban and peri-urban environments. These areas currently require decisions about future use, development and treatment. In many other cases land contamination has originated from locally concentrated inputs, but due to a large number of such spots, again large areas are affected. The problem is that complete clean-up of all these areas is not possible, merely because of the extent of the contamination. Nonetheless health risks need to be limited to tolerable levels, and site disturbance and soil degradation must be prevented in order to avoid pollutant mobilization and further uncontrolled dispersal. Inappropriate treatments may also unnecessarily compromise options for future land use and development. Therefore, tools are needed to support decisions on the treatment of polluted soils with all available information and to integrate these decisions into spatial planning processes and land management. Such tools have to account for the needs and desires of institutional decision-makers and planners. In this workshop we shall discuss potential tools in the context of spatial development and land use of the entire potentially affected area. Workshops
:25.6+23±/2&$/"5(*,21$/"',))86("72:$5'6$'(),1,7,212) %$&.*5281'9$/8(6 )2525*$1,&&203281'6 ,162,/6 :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Bernd. M. Bussian, UBA, Germany Co-convenor: Clemens Reimann, NGU, Norway
DESCRIPTION Different definitions of the term background are used in geo-science, exploration geochemistry and environmental chemistry where "background" often defines the natural variation of element concentrations as opposed to high values caused by anthropogenic contamination. For naturally occurring elements it is impossible to define global background values, or better global threshold values although regulators desire such values. Background has a strong spatial component and this spatial component needs to be considered when defining the range of background or the threshold value for any one area. In case of persistent organic pollutants (POPs) the exposure of the environment is predominantly due to anthropogenic sources. For many of these components the natural background is actually "0" (with notable exceptions, e.g. PAHs due to forest fires) and not a variation. How are then such data to be treated statistically? Key-questions of the workshop will be: w ,VWKHWHUP³QDWXUDOEDFNJURXQG´DSSOLFDEOHIRUPDLQO\DQWKURpogenic pollution with POPs? Does this term make sense in the context of health related issues? Can and should it be defined statistically or do we rather need toxicologically defined threshold or action levels? w Do we need to establish a "background variation" for POPs? Can deposition data be interpreted in terms of population density? w ,VWKHWHUP³DPELHQWEDFNJURXQG´MXVWDSUDJPDWLFDSSURDFKWRaccept pollution due to a long history of human occupation DQGVRLOXVHDV³QDWXUDO´",IVRZKLFKOHYHOVDUH³QDWXUDO´RULVWKHUHD³VRFLRHFRQRPLFWKUHVKROGRIDFFHSWDQFH´" w Can multivariate statistical approaches really explain which contaminant or group of contaminants originate from which source? w What are the border stones for a scientifically sRXQG(XURSHDQFRQFHSWRI³EDFNJURXQGOHYHOV´IRU323V" w What do regulators really need? Workshops
:25.6+23±,17(51$7,21$/<($52)3/$1(7($57+ ,<3( ± 81'(567$1',1*7+(/,1.6%(7:((162,/6&,(1&($1'27+(5*(26&,(1&(6 $1'7+(,552/(,16833257,1*$6867$,1$%/(62&,(7< :HGQHVGD\$XJXVW±KUV /RFDWLRQ+6 Convenor: Gabriele Broll, Univ. of Vechta, Germany Co-convenor: Stephen Nortcliff, Univ. of Reading, United Kingdom
DESCRIPTION The IYPE was initiated jointly by the International Geological Sciences and the UNESCO supported by twelve founding partners including IUSS and ISRIC. The United Nations General Assembly has proclaimed the year 2008 to be the United Nations International Year of Planet Earth (www.yearofplanetearth.org). The main aim of the IYPE is to demonstrate the great potential provided by the geosciences to lay the foundations of a safer, healthier and wealthier society. Within the activities of the IYPE ten broad science themes were selected: groundwater, hazards, earth & health, climate, resources, megacities, deep earth, ocean, life and soil. Within WKHVFLHQFHWKHPH³6RLO´IRXUkey questions were identified. The focus of this workshop is on two of these themes: 1. How can we link the soil science knowledge base with other disciplines within the earth sciences? 2. How can we communicate better with society about the role of soil in many aspects of our daily life and the need to raise awareness to protect and maintain the soil and its functions?
7LPH Speaker 7LWOHRI3UHVHQWDWLRQ ± Gabriele Broll Welcome and Introduction ± Stephen Nortcliff, Univ. of Reading Soil as science theme in the International Year of Planet Earth Marja-Liisa Räisänen, Univ. of The importance of geochemistry to understand sustainability and ± Kuopio/ Geological Survey vulnerability of soils Hanneke van den Ancker and Patrick McKeever, Earth Heritage and Geodiversity in the EU Soil Directive: soil European Federation of Geologist scientists, geomorphologists and geologists for conservation and & European Geoparks Network, sustainable spatial planning The Netherlands Discussion: How can we link the soil science knowledge base with Moderation: Gabriele Broll other disciplines within the earth sciences? ± Coffee Break Arwyn Jones, Vladimir Stolbovoy, Charles Tarnocai, Gabriele Broll, Otto Spaargaren and Luca Montanarella The Northern Circumpolar Soil Atlas as tool to raise awareness for 11.00 - 11.20 European Commission Joint soil protection Research Centre, Agriculture & Agri-Food, Canada, University of Vechta, Germany, ISRIC, The Netherlands How can we communicate better with society about the role of soil 11.20 - 12.00 Moderation: Stephen Nortcliff in many aspects of our daily life and the need to raise awareness to protect and maintain the soil and its functions? Business Meetings
WRB Business Meeting 0RQGD\$XJXVW±± 9HQXH+6 &RQWDFW(ULND0LFKHOL 0LFKHOL(ULND#PNNV]LHKX $OOZRUNLQJJURXSPHPEHUVDQGLQWHUHVWHGFROOHDJXHVDUHZHOFRPH
ECSSS Council Meeting 7XHVGD\$XJXVW±± 9HQXH%|FNOVDDO &RQWDFW:LQIULHG%OXP ZLQIULHGEOXP#ERNXDFDW $GPLVVLRQIRU(&666FRXQFLOPHPEHUVRQO\
&267±5HYLHZ0HHWLQJ 7XHVGD\$XJXVW±± 9HQXH%|FNOVDDO &RQWDFW3HWHU.XLNPDQ 3HWHU.XLNPDQ#ZXUQO $GPLVVLRQIRU&267PHPEHUVRQO\
ESSC Council Meeting :HGQHVGD\$XJXVW±± 9HQXH%|FNOVDDO &RQWDFW-RVH/XLV5XELR MRVHOUXELR#XYHV $GPLVVLRQIRU(66&FRXQFLOPHPEHUVRQO\
ESBN Meeting :HGQHVGD\$XJXVW±± 9HQXH+6 &RQWDFW$UZ\Q-RQHV DUZ\QMRQHV#MUFLW $GPLVVLRQIRUPHPEHUVRI(6%1RQO\
ESBN-SC Meeting :HGQHVGD\$XJXVW±± 9HQXH)HVWVDDO &RQWDFW$UZ\Q-RQHV DUZ\QMRQHV#MUFLW $GPLVVLRQIRUPHPEHUVRI(6%16&RQO\ Excursions
$SUH³)RUHVWVRLOVDWWKHHDVWHUQHGJHRIWKH$OSV $XVWULD ´ 'DWHSODFHDQGWLPHRIGHSDUWXUH Sunday, 24.08.2008; Departure: 8:00 h, bus parking lot, Schönbrunner Schloßstraße, 1130 Vienna Underground U4 - stop "Schönbrunn"; Return: 20:00 h, Vienna, Schönbrunner Schloßstraße; &RQWHQWV The excursion route covers a transect from the eastern foothills of the Central Alps towards the Pannonian basin. Substrates for soil development at the foothills are schists, gneisses, quartzite and basalt. The basin is filled with marine sediments (gravel, sand, claystone and limestone). As the area has not been glaciated during Pleistocene, substrates for recent soil development also comprise colluvia, debris flow and relictic soil material. The area is located at the intersection of the oceanic and the continental (Pannonian) climate province and covers an elevation gradient from 300 to 700 m a.s.l.. Natural vegetation types are oak hornbeam forests in lower elevations and beech forests in higher elevations. Due to land use history, secondary Scots pine or Norway spruce forests are dominating. The influence of OLWWHUUDNLQJXQWLOWKH¶VFDQVWLOOEHUHFRJQL]HGIURPJURXQG vegetation and humus properties in forest areas close to settlements. Soil physical, chemical and mineralogical properties (in particular clay mineralogy) and influence of land use on soil development will be discussed. Examples for regionalisation of soil properties based on forest inventory data and site maps will be presented. ,WLQHUDU\9LHQQD±.REHUVGRUI±/DFNHQEDFK±1HFNHQPDUNW±9LHQQD
$SUH³&URVVVHFWLRQRIQRUWKHUQODQGVFDSHVLQ/RZHU$XVWULDIURPORHVVWR3DODHR]RLF´ 'DWHSODFHDQGWLPHRIGHSDUWXUH Sunday, 24.08.2008; Departure: 8:00 h, bus parking lot, Schönbrunner Schloßstraße, 1130 Vienna Underground U4 - stop "Schönbrunn"; Return: 20:00 h Vienna, Schönbrunner Schloßstraße; &RQWHQWV This excursion exemplary shows the different soil formations in a very short distance influenced by changing of parent material, climate and vegetation. The altitude increase during the excursion from 150 m asl (Danube niveau) up to 590 m asl (Göpfritz). The climate changes from Pannonian in the Vienna Basin, over the hilly land climDWHRIWKH/RHVV:HLQYLHUWHOWRthe colder rough climate of the HURGHGODQGVFDSHVRIWKH3DOHR]RLF:DOGYLHUWHO ,WLQHUDU\/RZHU$XVWULD9LHQQD±=LHUVGRUI±%UXQQDG:LOG±*|SIULW]DG:LOG±6FKUHPV±9LHQQD
$SRVW³6RLOVXQGHUWKHVRFDOOHG$XVWULDQVHPLDULGFOLPDWHLQWKHUHJLRQ:HLQYLHUWHO´ 'DWHWLPHDQGSODFHRIGHSDUWXUH Saturday 30.08.2008; Departure: 8:00 h, APCOA bus parking lot, Schönbrunner Schloßstraße, 1130 Vienna Underground U4 - stop "Schönbrunn"; Return: 20:00 h, Vienna, Schönbrunner Schloßstraße; &RQWHQWV 6RLOH[FXUVLRQLQWKHILHOGVWRWKH.XELHQDPXVeum and the Soil Classification -Assessment-Museum (Bodenschätzungsmuseum). This excursion shows particular soils in the so called Austrian semiarid climate. Presentation of soil development from hydromorphic to terrestrial soils situated on alluvial sediments and loess and tertiary sediments; especially of soils, which are influenced by groundwater and soils which are not influenced by groundwater; there is an enormous difference in the crop yield. ,WLQHUDU\:/RZHU$XVWULD±:HLQYLHUWHO 9LHQQD±6SLOOHUQ±9LHQGRUIHU:HLQJHELUJH±6RQQEHUJ±+ROODEUXQQ±*URQRQGRUI±$VSHUVGRUI±.DOODGRUI±0DLVVDX± Vienna; Supporting Programme
SOIL SCIENCE - LAND USE - SOIL PROTECTION as expressed by philately by Hans-Peter Blume, Kiel, Germany
A collection of Stamps and other philatelic products with relation to Soil Science are presented in 10 frames with 120 sheets.
Soil is the transformation product of mineralDQGRUJDQLFVXEVWDQFHVDWWKHHDUWK¶Vsurface under the influence of environmental factors. It is the growth medium for plants and the general basis of live for animals and humankind. Soil Science is a discipline of natural sciences, studying conditions, development, ecology, geography, usability, as well as the degradation and conservation of soils. Since 2005 the German Society of Soil Science chooses and publishes a Soil of the Year. This soil appears annually on a stamp which is printed by the Austrian Post Printing Office in Vienna.
Under Soilscapes stamps or other records with soil profiles are combined with landscapes, in which they dominate. The soil profiles are also combined with stamps of wild plants, naturally growing on these soils.
Under Attributes of Soils, parent rocks, primary minerals and secondary minerals are arranged according to different attributes. Soil animals are arranged according to their importance for soil formation.
Under Research of Soils main field and laboratory methods and their use are presented.
Under Tillage of Soils different methods of physical soil treatment, including drainage and irrigation are shown.
Under Use of Soils the different forms of land use are demonstrated.
Soil Degradation and Conservation is a further topic of Philatelistic observation.
Under Personalities of Soil Science persons of historical importance related to soil and land use and development of soil science as a scientific discipline are shown.
The part Teaching - Research - Communications highlights universities with pedological teaching and research, congresses of soil science and neighboring disciplines and publishers of books and journals of soil sciences.
The collection will be displayed during the congress next to the Exhibition area. *XLGHOLQHVDQG,QIRUPDWLRQ IRU6SHDNHUV&KDLUSHUVRQVDQG3RVWHU3UHVHQWHUV
2SHQLQJ+RXUV3UHYLHZ5RRP
0RQGD\$XJXVW ±KUV 7XHVGD\$XJXVW ±KUV :HGQHVGD\$XJXVW ±KUV 7KXUVGD\$XJXVW ±KUV )ULGD\$XJXVW ±KUV
,I\RXDUHD&KDLUSHUVRQ
3OHDVHORFDWH \RXU6HVVLRQURRPLQGXHWLPH ,I\RXDUHD6SHDNHULQD6HVVLRQ 3OHDVHORFDWH \RXU6HVVLRQURRPLQGXHWLPH ,I\RXSUHVHQWDSRVWHU 3RVWHU6HVVLRQVWDNHSODFHGDLO\ H[FHSW:HGQHVGD\$XJXVW EHWZHHQDQGKUV3OHDVHFKHFNWKHGDWH RQZKLFK\RXU3RVWHUZLOOEHSUHVHQWHGDQGPRXQW\RXU3RVWHUEHWZHHQDQGKUV$WWDFKLWWRWKHERDUGZLWKWKH SRVWHU ERDUG QXPEHU \RX KDYH UHFHLYHG \RX ZLOO DOVR ILQG \RXU SRVWHU ERDUG QXPEHU LQ WKH DXWKRU LQGH[ DW WKH HQG RI WKH DEVWUDFWERRNDVZHOODVLQWKLVSURJUDPPH DQGUHPRYHLWE\WKDWVDPHGD\WRDYRLGWKDW\RXU3RVWHULVGLVSRVHGRIE\ WKHVWDII 3RVWHU6HVVLRQ 6HVVLRQ 6HVVLRQ 6HVVLRQ 6HVVLRQ 'LVSOD\'DWH 0RQGD\$XJXVW 7XHVGD\$XJXVW 7KXUVGD\$XJXVW )ULGD\$XJXVW 3RVWHU1XPEHU 3±3 3±3 3±3 3±3 3UHVHQFHDW3RVWHU 3RVWHU0RXQWLQJ7LPH 3RVWHU5HPRYDO7LPH 'RXEOHVLGHGWDSHIRUPRXQWLQJWKH3RVWHUVZLOOEHDYDLODEOHIURPWKH3RVWHUVHUYLFHGHVN3OHDVHQRWHWKDWQRRWKHUPDWHULDOV DUHDGPLWWHGIRUPRXQWLQJWKHSRVWHUVWRDYRLGGDPDJLQJWKHSDQHOVXUIDFHV$QDVVLVWDQWZLOOEHDYDLODEOHVKRXOG\RXQHHGDQ\ KHOS ,QRUGHUWRHQDEOHGLVFXVVLRQDQGLQWHUDFWLRQZLWKRWKHUSDUWLFLSDQWVZHUHTXHVWWKHPDLQDXWKRURUDQRWKHUPHPEHURIWKH JURXSWREHDWWKHSRVWHUERDUGDWWKHWLPHVQRWHGEHORZ,IWKLVLVQRWSRVVLEOHZHUHTXHVWWKHDXWKRUVWROHDYHDQRWHRQWKe SRVWHULQGLFDWLQJWKHWLPHVZKHQWKH\ZLOOEHSUHVHQWDWWKHERDUG 7KHFRQYHQRUVRIWKHUHVSHFWLYH6\PSRVLDZLOOQRPLQDWHRQHWRWZRSRVWHUVIRUHDFKWRSLFDVFDQGLGDWHVIRUWKH3RVWHU$ZDUGV 6HOHFWHG3RVWHUVZLOOEHPRXQWHGLQWKH3RVWHU$ZDUG)LQDOLVWVDUHDE\WKHFRQJUHVVVWDIIWREHYLHZHGIRUWKHUHVWRIWKH &RQJUHVV7KH3RVWHU$ZDUG:LQQHUVZLOOEHDQQRXQFHGGXULQJWKH&ORVLQJ&HUHPRQ\RQ)ULGD\$XJXVW± KUV 3OHDVHQRWHWKDWWKHRUJDQLVHUVFDQQRWDVVXPHDQ\OLDELOLW\IRUORVVRUGDPDJHRISRVWHUVGLVSOD\HGLQWKHSRVWHUDUHD3RVWHUV WKDWDUHQRWUHPRYHGE\KUVRQWKHGD\RIWKHUHVSHFWLYH3RVWHU6HVVLRQZLOOEHUHPRYHGE\VWDIIDQGZLOOQRWEHVWRUHGRU VHQWWRWKHDXWKRUDIWHUWKHPHHWLQJ Congress Information Abstract Books You will find a CD-ROM of all the abstracts in your congress bag. Hard copies of the abstract book may be purchased at the registration desk for EUR 15.00 (while stocks last). Badges Participants will receive their name badges from the conference registration desk. Since only registered participants will be permitted to attend scientific sessions, the exhibition and poster areas, you are kindly asked to wear your badge when entering the congress venue. Please note that admission to scientific sessions is strictly restricted to participants wearing their badges. Exhibitors and accompanying persons are not entitled to attend the scientific sessions. Lost badges can be replaced at the registration desk. However, a handling fee will be charged. The following badge-colours are used at the Congress: White ĺ Participants Blue ĺ Accompanying Persons Green ĺ Exhibitors Red ĺ Press Yellow ĺ Staff Cancellations and Refunds Notice of cancellation is to be made in writing by registered letter or fax to the Congress Office. The policy for refunding registration fees is as follows: Written cancellation received: - Before May 31, 2008: 75% refund - After May 31, 2008: no refund The date of the postmark or fax ID is the basis for considering refunds. Refunds will be made after the congress. Cash Bar Snacks and drinks may be purchased at the cash bar in the catering area during congress hours. Certificate of Attendance Confirmations of attendance will be issued at the registration desk. Citation of Authors In this programme only the presenting authors are listed. You will find the complete list of all authors in the author index of the Abstract Book. Coffee Breaks Refreshments will be served free of charge to participants wearing name badges in the catering area. Excursions on DVD A DVD with the guides to all initially planned excursions may be purchased at the registration desk for EUR 15.00 (while stocks last). Lunch You can have lunch in the on-campus restaurant (Nelsons) in the second courtyard. Alternatively there are plenty of restaurants in the vicinity of the conference centre which serve a broad variety of local and international dishes. The Naschmarkt houses several restaurants including seafood, Japanese and Chinese cuisine, a pancake house, and local food. Check for two or three FRXUVHPHQXVDWOXQFKWLPH µ0LWWDJVPHQ¶), which may offer a better value than individually ordered courses. Exhibition Opening Hours Monday, August 25 08.30-17.00 hrs Tuesday, August 26 10.00-17.00 hrs Wednesday, August 27 10.00-17.00 hrs Thursday, August 28 10.00-17.00 hrs Friday, August 29 10.00-18.00 hrs Hotel and Tours Desk There will be a hotel desk in the foyer between Böckl-Saal and Festsaal where optional social programmes such as city tours, etc. may be booked. Internet WLAN is available in the conference venue. Login details can be obtained from the registration desk. You many also find small Internet cafés throughout the city. Message Board A Message Board and notice of the daily programme are available in the catering tent. Poster Service Desk Poster presentations are indicated with the letter P and three digits, e.g. P001. Staff at the poster service desk will assist poster presenters to find their poster board and provide adhesive material. Congress Information Poster Mounting and Removal There are four poster sessions: Monday, Tuesday, Thursday, anG )ULGD\ IURP ± KUV 3RVWHU PRXQWLQJ ZLOO EH SRVVLEOHIURPKUVRQWKHGD\RIWKHUHVSHFWLYH3RVWHU6HVVLRQ3RVWHUVPXVWEHUHPRYHGE\KUVRQWKHGD\RI WKH UHVSHFWLYH 3RVWHU 6HVVLRQ 3OHDVH QRWH WKDW WKH RUJDQLVHUV FDQQRW DVVXPH DQ\ OLDELOLW\ IRU ORVV RU GDPDJH RI SRVWHUV GLVSOD\HG LQ WKH SRVWHU DUHD 3RVWHUV WKDW DUH QRW UHPRYHG E\ KUVRIWKHGD\ RIWKHUHVSHFWLYH3RVWHU6HVVLRQ ZLOOEH UHPRYHGE\VWDIIDQGZLOOQRWEHVWRUHGRUVHQWWRWKHDXWKRUDIWHUWKHPHHWLQJ Presentation numbers (DFKSUHVHQWDWLRQQXPEHUFRQVLVWVRIDVHTXHQFHRIOHWWHUVDQGGLJLWV)RUH[DPSOHSUHVHQWDWLRQQXPEHUS01.A.02 stands for 6\PSRVLXPWLPHVORW$VHFRQGSUHVHQWDWLRQZLWKLQWKLVWLPHVORW.H\QRWHOHFWXUHVFDUU\D³./´LQVWHDGRIWKHVHTXHQFH QXPEHU Preview Room (TXLSPHQWIRUDILQDOFKHFNRIWKHVHTXHQFHRI\RXUSUHVHQWDWLRQLVDYDLODEOHLQWKHSUHYLHZURRP$OOSUHVHQWHUVVKRXOGEULQJ WKHLU HOHFWURQLF SUHVHQWDWLRQ WR WKH SUHYLHZ URRP SUHIHUDEO\ LQ WKH PRUQLQJ RI WKH GD\ RI WKH WDON EXW QRW ODWHU WKDQ KRXUV EHIRUHWKHVWDUWRIWKHVHVVLRQ)RUVHVVLRQVVWDUWLQJDWWKH3RZHU3RLQWSUHVHQWDWLRQVVKRXOGEHGHOLYHUHGWKHSUHYLRXV GD\ Registration Desk opening hours 6XQGD\$XJXVW ±KUV 0RQGD\$XJXVW ±KUV 7XHVGD\$XJXVW ±KUV :HGQHVGD\$XJXVW ±KUV 7KXUVGD\$XJXVW ±KUV )ULGD\$XJXVW ±KUV Signage - Colour Guidance System 7KHFRORXUVLQZKLFKWKHURRPVDUHSULQWHGLQWKHSURJUDPPHE\GD\DVZHOODVWKHGHWDLOHGV\PSRVLDSURJUDPPHFRUUHVSRQG ZLWKWKHFRORXUVRIWKHVLJQSRVWVGLUHFWLQJ\RXWRWKHPHHWLQJURRPV Smoking Policy (85262,/ LV D ³1RVPRNLQJ&RQIHUHQFH´ 3OHDVH QRWH WKDW VPRNLQJ LV EDQQHG IURP DOO SXEOLF EXLOGLQJV LQFOXGLQJ WKH FDWHULQJWHQW5HVWDXUDQWVDQGEDUVPD\GHSHQGLQJRQVL]HEHGHFODUHGHLWKHUDV³VPRNLQJ´RU³QRVPRNLQJ´ORFDWLRQVRUKDYH VHSDUDWHDUHDVDQGYHQWLODWLRQV\VWHPV Staff 6KRXOG\RXKDYHDQ\TXHVWLRQVFRQJUHVVVWDIIUHFRJQL]DEOHE\DUHGWVKLUWDQG\HOORZEDGJHZLOOEHSOHDVHGWRKHOS\RX Registration Fees Onsite registration 6XQGD\$XJXVW ±KUV 0RQGD\$XJXVW ±KUV 7XHVGD\$XJXVW ±KUV :HGQHVGD\$XJXVW ±KUV 7KXUVGD\$XJXVW ±KUV )ULGD\$XJXVW ±KUV after 31st May Payment received before 31st January before 31st May and on site 5HJXODUSDUWLFLSDQWV EUR 250.-- EUR 300.-- EUR 350.-- Students** EUR 100.-- EUR 150.-- EUR 200.-- 'D\7LFNHW --EUR 100.-- $FFRPSDQ\LQJSHUVRQV EUR 55.-- EUR 55.-- EUR 40.--* SOHDVHSURYLGHDFRS\RIDQ,'WRJHWKHUZLWK\RXUUHJLVWUDWLRQ What is covered by the registration fee? Participants Accompanying persons w $GPLVVLRQWRDOOVFLHQWLILFVHVVLRQV w $GPLVVLRQWRWKHZHOFRPHUHFHSWLRQDWWKH&LW\+DOO w $FFHVVWRWKHH[KLELWLRQ 0RQGD\$XJXVWKUV w :HOFRPHUHFHSWLRQDWWKH&LW\+DOO w +LVWRULFDO&LW\7RXU 0RQGD\$XJXVWKUV :HGQHVGD\$XJXVWKUV w $EVWUDFWVRQ&'520 w $FFHVVWRWKHH[KLELWLRQ w &RIIHHEUHDNV QRDGPLVVLRQWROHFWXUHV 3OHDVHQRWHWKDWWKH+LVWRULFDOFLW\WRXULVQRWDYDLODEOHIRURQVLWH UHJLVWUDWLRQVRIDFFRPSDQ\LQJSHUVRQV,QGLYLGXDOWRXUVFDQ KRZHYHUEHERRNHGDWWKH+RWHODQG7RXUV'HVN 3D\PHQWRIUHJLVWUDWLRQIHHVPD\EHPDGHLQFDVK (XURVRQO\ E\PDHVWURGHELWFDUGRUE\WKHIROORZLQJFUHGLWFDUG'LQHUV &OXE0DVWHUFDUG9LVD Please noteWKDWWKHUHGXFHGUHJLVWUDWLRQIHHLVRQO\DSSOLFDEOHLILWKDVEHHQFUHGLWHGWRWKHFRQJUHVVDFFRXQWEHIRUHWKH GHDGOLQH5HJLVWHULQJZLWKRXWSHUIRUPLQJDQDFWXDOSD\PHQWLVQRWVXIILFLHQWWREHQHILWIURPWKHUHGXFWLRQ 3UHUHJLVWUDWLRQ ZLWKRXWSD\PHQWRIWKHUHJLVWUDWLRQIHHLVSRVVLEOH7KHIXOOIHHLVWREHSDLGDWWKHUHJLVWUDWLRQGHVN Cancellations and refunds: 1RWLFHRIFDQFHOODWLRQPXVWEHPDGHLQZULWLQJE\UHJLVWHUHGOHWWHURUID[WRWKH&RQJUHVV2IILFH 7KHSROLF\IRUUHIXQGLQJUHJLVWUDWLRQIHHVLVDVIROORZV :ULWWHQFDQFHOODWLRQUHFHLYHG %HIRUH0D\UHIXQG $IWHU0D\QRUHIXQG 7KHGDWHRIWKHSRVWPDUNRUID[,'LVWKHEDVLVIRUFRQVLGHULQJUHIXQGV3OHDVHLQGLFDWHWKHSUHIHUUHGPHWKRGRIUHLPEXUVHPHQW FKHTXHRUEDQNWUDQVIHULQFODFFRXQWQXPEHU RQ\RXUZULWWHQFDQFHOODWLRQ5HIXQGVZLOOEHPDGHDIWHUWKHFRQJUHVV General Information Bank services - Money matters %DQNV DUH RSHQ IURP ± DQG IURP ± 0RQGD\ WR )ULGD\ 6RPH EDQNV DUH DOVR RSHQ RQ 7KXUVGD\ DIWHUQRRQVXQWLOKUV&DVKPDFKLQHV $70V ZKLFKDFFHSWDOOPDMRULQWHUQDWLRQDOEDQNFDUGVDUHDYDLODEOHWKURXJKRXWWKH FLW\ &DVK PDFKLQHV LQ WKH YLFLQLW\ RI WKH FRQIHUHQFH YHQXH DUH VLWXDWHG RQ :LHGQHU +DXSWVWUDVVH DQG DV ZHOO DV 2SHUQJDVVH 7KH FXUUHQF\ RI $XVWULD LV WKH (XUR ¼ 0DMRU FUHGLW FDUGV DUH ZLGHO\ DFFHSWHG EXW SOHDVH DOZD\V FKHFN EHIRUHKDQG Car Parking 3DUWLFLSDQWVPD\SDUNWKHLUFDULQWKHµ*DUDJH7HFKQLVFKH8QLYHUVLWlW:LHQ¶2SHUQJDVVH&KDUJHVDUH(85IRUHYHU\ VWDUWHGKRXURU(85SHUGD\DQGDOOPDMRUFUHGLWFDUGVDUHDFFHSWHG Climate 7KHWHPSHUDWXUHLQ$XJXVWLVZDUPDQGDYHUDJHVDURXQGGHJUHHV&HOVLXV GHJUHHV)DKUHQKHLW (YHQLQJVDUHFRROHUDQG OLJKWMDFNHWVRUVZHDWHUVDUHUHFRPPHQGHG Currency 7KHRIILFLDOFXUUHQF\RI$XVWULDLVWKH(XUR ¼ (85 86' *%3 -3< &+)DVSHUGDWHRISULQWLQJ Drinking water 7DSZDWHULQ$XVWULDLVRIKLJKTXDOLW\DQGVXLWDEOHIRUGULQNLQJ Eating Out in Vienna 9LHQQDKDVDEURDGYDULHW\RIORFDODQGLQWHUQDWLRQDOUHVWDXUDQWVPDQ\RIWKHPORFDWHGLQWKHROGFLW\DQGLQWKHYLFLQLW\RIWKH FRQIHUHQFHYHQXH Electricity Supply 9+]$&$GDSWRUVFDQEHREWDLQHGIURP\RXUKRWHOUHFHSWLRQRUHOHFWURQLFVVWRUHV Emergency Phone Number 7KHSKRQHQXPEHUWRGLDOIRUHPHUJHQFLHVLV GSM cell phone roaming *60FHOOPRELOHSKRQHURDPLQJLVDYDLODEOHIRUDOOPDMRULQWHUQDWLRQDOSURYLGHUV,WLVDGYLVDEOHWRDVN\RXUSURYLGHUEHIRUHKDQG ZKLFKURDPLQJFRPSDQ\LQ$XVWULDRIIHUVWKHFKHDSHVWWDULIIV Insurance ,QUHJLVWHULQJIRUWKH(85262,/SDUWLFLSDQWVDJUHHWKDWQHLWKHUWKHRUJDQLVLQJFRPPLWWHHQRUWKHFRQJUHVVRIILFHDVVXPH DQ\OLDELOLW\ZKDWVRHYHU3DUWLFLSDQWVDUHUHTXHVWHGWRPDNHWKHLURZQDUUDQJHPHQWVIRUKHDOWKDQGWUDYHOLQVXUDQFH Internet :/$1LVDYDLODEOHLQWKHFRQIHUHQFHYHQXH/RJLQGHWDLOVFDQEHREWDLQHGIURPWKHUHJLVWUDWLRQGHVN Language 7KHRIILFLDOODQJXDJHRIWKHFRQJUHVVZLOOEH(QJOLVK QRVLPXOWDQHRXVWUDQVODWLRQ *HUPDQLVWKHRIILFLDOODQJXDJHLQ$XVWULD. Medical care 7KH$XVWULDQ1DWLRQDO+HDOWK6HUYLFHPD\EHXVHGE\DOOSHUVRQVIURP(XURSHDQ8QLRQFRXQWULHV ZKRKDYHWKH()RUP (+,&DUG 7KLVIRUPFDUGVKRXOGEHREWDLQHGDWWKHKHDOWKVHUYLFHRUSRVWRIILFHRIWKHYLVLWRU VKRPHFRXQWU\EHIRUHWUDYHOOLQJWR $XVWULD,WLVDGYLVDEOHIRUSDUWLFLSDQWVIURPFRXQWULHVRXWVLGHWKH(XURSHDQ8QLRQWRWDNHRXWPHGLFDOLQVXUDQFHEHIRUHUHDFKLQJ $XVWULDVLQFHWKH\ZLOOEHFKDUJHGIRUDFFHVVWRWKHQDWLRQDOKHDOWKV\VWHP Pharmacies 0HGLFLQHVWKDWGRQRWUHTXLUHDPHGLFDOSUHVFULSWLRQPD\EHSXUFKDVHGRYHUWKHFRXQWHU,I\RXQHHGDGYLFHGRQRWKHVLWDWHWR DVNWKHSKDUPDFLVW,I\RXXVXDOO\WDNHPHGLFDWLRQLWLVDGYLVDEOHWREULQJDVXIILFLHQWDPRXQWZLWK\RXIRU\RXUWULS3KDUPDFLHV LQWKHYLFLQLW\RIWKHFRQIHUHQFHYHQXHDUHRQ2SHUQJDVVH RSHQ0RQ)ULDQGKUVDQGVDW DQG:LHGQHU +DXSWVWUDVVH RSHQ0RQ)ULDQG6DW 7KHUHDUHGXW\SKDUPDFLHVRSHQKRXUVDGD\2XWVLGHHDFKSKDUPDF\ WKHUHLVDOLVWRIWKHQHDUHVWGXW\SKDUPDFLHVRU\RXPD\DVNDW\RXUKRWHOUHFHSWLRQIRUPRUHLQIRUPDWLRQ Safety - Crime 9LVLWRUVDIHW\LVJHQHUDOO\DGHTXDWH/LNHLQDQ\RWKHUPDMRU(XURSHDQFLW\\RXFDQZDONHYHU\ZKHUHXVLQJFRPPRQVHQVH3LFN SRFNHWLQJLQKHDYLO\YLVLWHGWRXULVW]RQHVRULQSXEOLFWUDQVSRUWOLQHVPLJKWEHDFRQFHUQ 8QIRUWXQDWHO\H[SHULHQFHKDVVKRZQWKDWVRPHEDVLFSUHFDXWLRQDU\PHDVXUHVVKRXOGDOZD\VEHNHSWLQPLQGLQDQ\FLW\ 'RQRWFDUU\LPSRUWDQWLWHPVOLNHIOLJKWWLFNHWVSDVVSRUWVHWFZLWK\RXZKHQYLVLWLQJWKHFRQIHUHQFHRUVWUROOLQJWKURXJKWKHFLW\ OHDYHWKHPLQWKHKRWHOVDIHGXULQJ\RXUVWD\5DWKHUFDUU\DSKRWRFRS\RI\RXUSDVVSRUWRUDQLGHQWLW\FDUGZLWK\RX 7U\QRWWRFDUU\DOOGRFXPHQWVPRQH\FUHGLWFDUGVDQGRWKHUHVVHQWLDOLWHPVDQGYDOXDEOHVLQRQHEDJ,ILWJHWVORVWRUVWROHQ HYHU\WKLQJZLOOEHJRQHDQGPLJKWEHGLIILFXOWWRUHSODFHRQVKRUWQRWLFHHVSHFLDOO\SDVVSRUWVDQGYLVDWRUHWXUQWR\RXUFRXQWU\ RIUHVLGHQFH 7DNHRII\RXUQDPHEDGJHZKHQOHDYLQJWKHFRQIHUHQFHFHQWUH General Information Shops Shops in Vienna are generally open between 09.00 and 18.00 hrs Mon-Fri, and between 09.00 and 12.00 on Saturdays. Some shops are open until 19.00 Mon-Fri and until 17.00 on Saturdays. Shops are usually closed on Sundays, except for a few establishments with special permits. Taxis There are Taxi ranks throughout the city, but calling is often your best option. Please address your hotel reception or the registration desk of the conference venue. Tipping Tips are not obligatory in Austria, although people usually tip approximately 10% at restaurants, cafés and bars. Hotel and airport porters will accept tips, depending on the luggage. Travelling within Vienna Vienna has an excellent public transport system which is very effective and inexpensive. Tickets are available from machines at underground stations (maestro debit cards accepted), at news ageQW¶VRUDW9LHQQD7UDQVSRUW$XWKRULW\¶VWLFNHWRIILFHV7LFNHWs bought in advance are cheaper and must be punched in a blue ticket cancelling machine on the tram or bus, or at the barrier before boarding the underground train. Single trip tickets can be used for any single trip within Vienna. You may change lines (and switch between bus, tram, underground, or urban train), but you may not interrupt your journey. Ticket price: EUR 1.70 when bought in advance; EUR 2.20 when bought in the means of transport. The 24-hour pass is valid throughout Vienna for exactly 24 hours from the time it is punched. Price: EUR 5.70 The 72-hour pass is valid throughout Vienna for exactly 72 hours from the time it is punched. Price: EUR 13.60 The 8-day ticket is valid for any eight days, not necessarily eight consecutive days. It is a rover ticket, which means you can travel all around Vienna. You can also use the ticket for several people travelling together. Simply punch one strip for each person in the group. Price: EUR 27.20 Week-pass valid from Monday to Monday, 09.00 hrs. Price: EUR 14.00 A taxi is the most comfortable way of getting around the city but also the most expensive. They are identifiable by their roof-sign which is lit when available. Prices must be displayed inside the cab and meters (which are compulsory in all cabs) will indicate the fare. Travelling from and to the Airport Vienna International Airport is located 13 kilometres south east of Vienna. City Airport Train (CAT) 7KHWUDLQVHUYLFHEHWZHHQWKHDLUSRUWDQGWKHFLW\FHQWUH &LW\$LU7HUPLQDO±6WDWLRQµ:LHQ0LWWH¶) is every 30 minutes and takes 16 minutes. It is covered from 6:05 hrs to 00:05 hrs (Airport to City) and from 5:38 hrs to 23:38 hrs (City to Airport). Tickets may be purchased online (EUR 8.00 single or EUR 15.00 return), from ticket machines at the airport/station (EUR 9.00 single or EUR UHWXUQ RURQERDUG (85VLQJOH )URPµ:LHQ0LWWH¶\RXFDQWDNHWKHJUHHQOLQH 8 GLUHFWLRQHütteldorf and get off DWµ.DUOVSODW]¶ (two stops). Alternatively, there is a bus service to Südbahnhof which takes around 35 minutes and costs EUR 6.00 (single) and EUR 11.00 (return). From there you can take WKHWUDPOLQHµ'¶WRµ2SHUQULQJ¶ Taxi fares to the conference venue are about EUR 35.00 and take around 25 minutes. There is a taxi rank outside the airport terminal. Night-time fees are slightly higher. Vienna Vienna, the capital of Austria, 2 million inhabitants, is situated on the EDQNVRIWKH'DQXEH9LHQQDLVDGUHDPFLW\IRUDQ\RQe with an interest in history. Narrow, medieval alleyways and grand boulevards lead to historic sights such as the Imperial Palace (Hofburg), Belvedere Palace, Burgtheater, the Spanish Riding ScKRRO6W6WHSKHQ¶V&DWKHGUDOWKH2SHUD+RXVH.DUOVNLUFKH or Schönbrunn Palace. Vienna has been synonymous with music for centuries, and was home to Mozart, Beethoven, Schubert DQG -RKDQQ 6WUDXVV 7KH 9LHQQD 3KLOKDUPRQLF 2UFKHVWUD LV RQH of the world's top orchestras; the Vienna Boys' Choir is triumphantly successful wherever it tours. Vienna possesses a lively and vast array of cultural attractions, from classical or experimental theatre, film or dance festivals, opera or operetta, to exhibitions and concerts. The Museum of Fine Arts is one of the world's largest and most distinguished museums, housing priceless works of art. Art accompanies you wherever you go in Vienna - even some of its underground stations are listed properties on account of their elegant, ornamental Jugendstil (Art 1RXYHDX VW\OHGHVLJQHGE\2WWR:DJQHU)RUPRUHLQIRUPDWLRQDERXW9LHQQDSOHDVHVHHZZZDERXWYLHQQDRUJ Social Events Monday, August 25, 2008, 20.00hrs Welcome Reception by the Mayor of Vienna at the Vienna City Hall The mayor of the city of Vienna is pleased to invite you to a Welcome Reception. Meet your colleagues at this event. Enjoy the evening with a Buffet and live music. Dress code: business attire Attendance free for registered participants and accompanying persons. Those who have registered prior to the congress should have received their ticket with the congress material. Please remember to bring your ticket. Please note that attendance is limited and advance registration is mandatory in order to receive a ticket! A limited number of tickets will still be available for onsite bookings. Venue: Vienna City Hall, Lichtenfelsgasse 2, 1010 Vienna Directions )URP WKH FRQIHUHQFH YHQXH WDNH WKH SXUSOH XQGHUJURXQG OLQH 8 GLUHFWLRQ µ6WDGLRQ¶ three stops and get off at µ5DWKDXV¶. Take the exit towards the back of the train and turn left. This is /LFKWHQIHOVJDVVH. The entrance to the Reception is on the left hand side. Alternatively, it could be a rather scenic walk which takes around 20 to 30 minutes. From the main entrance of the conference centre go straight ahead and cross the park. Cross the main road and keep going straight ahead down µ$NDGHPLHVWUDVVH¶ or µ.lUQWQHU6WUDVVH¶ until you get to the µ5LQJURDG¶. Turn left and follow the µ5LQJURDG¶. You will pass the two museums and the parliament building on your left. The next building on your left is the town hall. Cross the park and take the side entrance on the left side of the building. Wednesday, August 17, 2008, 09.00 hrs. Signs of the time - Historical Vienna (only for pre-registered participants) This is the perfect tour to get an overall impression of beautiful Vienna. Get to know the many magnificent buildings along Ringstrasse, such as the State Opera, Museums of Fine Arts and Natural History, the Hofburg (Imperial Palace), Parliament, City Hall, the Burgtheater and Votivkirche. Another highlight is a guided tour through the wonderful stately rooms of Schönbrunn Palace, the former summer residence of the Habsburg family. We return via Belvedere Palace. Buses depart from the Technical University, Vienna, Wednesday, August 17, 2008, 09.00 hrs. Duration: 3.5 hours Advance registration necessary. No onsite booking possible. Thursday, August 28, 2008, 19.30hrs 'LQQHUDWD9LHQQHVH³+HXULJHU´ An evening spent in typical Austrian wine taverns in Vienna. You will be served a delicious Austrian buffet and excellent local wines while enjoying the atmosphere of a WUDGLWLRQDOO\GHFRUDWHGUHVWDXUDQW³+HXULJHU´FRXOGEHWUDQVODWHGZLWK³RIWKLV\HDU´ and means a young crisp wine produced during the current wine season. Only wine producers serving their own product, grown LQWKHYLQH\DUGVRI9LHQQDPD\FDOOWKHLUWDYHUQ³+HXULJHU´ Dress code: casual Venue: Weingut Fuhrgassl Huber Neustift/Walde 68 1190 Wien Buses depart from the Technical University, Vienna, Thursday, August 28, 2008, 19.00hrs. 3ULFHSHUWLFNHWLQFOXGLQJPXVLFIRRGDQGEHYHUDJHV(85± Please note that advance registration is mandatory in order to receive a ticket! A limited number of tickets will still be available for onsite bookings. City & Subway Map Exhibition / Exhibitors Exhibitors: (as per date of printing) ADC BioScientific Decagon Devices Delta-T Devices ecoTech Umwelt-Meßsysteme Eijkelkamp Agrisearch Equipment IMKO E. Schweizerbart`sche Verlagsbuchhandlung UMS Umweltanalytische Mess-Systeme Umwelt-Geräte-Technik Wiley-Blackwell Austrian Soil Science Society Slovak Soil Science Society Exhibition Dates & Opening hours: Monday, August 25 08.30-17.00 hrs Tuesday, August 26 10.00-17.00 hrs Wednesday, August 27 10.00-17.00 hrs Thursday, August 28 10.00-17.00 hrs Friday, August 29 10.00-18.00 hrs Since the daily conference hours are 8.30 to 18.00 hrs, conference participants may remain in the exhibition hall beyond exhibition hours. Author Index (only presenting authours) Please note that in this programme only the presenting authors are listed. You will find the complete list of all authors in the author index of the Abstract Book. Presentation numbers: S = Symposia P = Poster Abd El-Rahim, W.: P385 Bardy, M.: S01.D.06, P112 Calvelo Pereira, R.: P290 Abdallah, E.: P467 Barin, M.: P084 Caner, L.: S30.A.01, S30.C.03 Abedini, M.: S03.D.02, P330, P544 Baritz, R.: S15.M.KL Cantero-Martinez, C.: S28.B.04 Abiven, S.: S14.N.05, P238 Barna, G.: P581 Cappuyns, V.: S13.F.06 Achat, D.: P744 Barnier, C.: S23.B.04 Capra, G.: P030 Ackermann, J.: P285 Barouchas, P.: P277 Carbonell, R.: P245 Acosta-Martinez, V.: S08.G.03 Barré, P.: S14.N.04 Cardei, P.: S04.J.06, P471 Adamczyk, B.: P746 Bastounopoulou, M.: S28.G.03 Carlesso, R.: P639, P641 Ageeb, G.: P001 Baumann, F.: S02.H.04 Carmen-Alina, G.: P046 Ahrends, B.: S09.K.01 Bayer, J.: S01.F.01 Carnicelli, S.: P526 Aizadeh Okuei, P.: P383 Bech, J.: P692 Caspari, T.: S19.F.03 Ajmone-Marsan, F.: P210 Behrens, T.: S26.E.03 Catari, G.: S03.D.03 Albanito, F.: P575 Bek, S.: P309 Cécillon, L.: S16.F.04 Albrecht, C.: S26.F.02 Benkova, M.: P154 ýengiü, I.: P007 Alcántara, C.: P443 Berger, W.: P158 Cerli, C.: P257 Alfaro, M.: S28.B.03 Berggren Kleja, D.: S01.A.01 ýermák, J.: S09.L.KL AlJaloud, A.: P673 Bernard, C.: S03.G.01 Chalhoub, M.: P640 Al-Kaisi, M.: S02.J.01 Bernoux, M.: S02.H.03, P230 Chang, S.: S28.C.03 Alloway, B.: S27.B.KL Berns, A.: S01.E.03 Chanzy, A.: S07.H.04 Álvarez-Rogel, J.: S05.L.KL Bertermann, D.: S07.K.04 Chauvat, M.: S08.F.05 Álvaro-Fuentes, J.: P191 Berthelin, J.: S14.N.03 Chemidlin Prevost-Boure, N.: S08.B.03 Alves, S.: P294 Bertrand, I.: P220 Chen, Z.: S19.G.02 Amaxidis, Y.: P521 Besalatpour, A.: S11.E.02 Cheng, S.: S01.E.04 Amougou, N.: P208 Besson, A.: S07.K.03, P616 Chernysh, A.: P333 An, S.: P568 Bhattacharyya, R.: P337 Chodak, M.: P500 Anagu, I.: S13.D.03 Biasioli, M.: S11.A.01 Chojnicki, J.: P047 Anaya, M.: P369 Bieganowski, A.: P515 Chotte, J.: S08.E.03 Andreetta, A.: P739 Bienes, R.: P340, P341 Ciampalini, R.: S26.G.04 Andrianaki, M.: P648 Bilal, M.: S28.I.01 ýidiü, A.: S10.I.01 Andrianarisoa, K.: S08.D.03, P134 Billen, N.: P348 Ciglasch, H.: P683 Andrist-Rangel, Y.: S28.H.02 Bini, C.: P540 Ciobanu, G.: P435 Angelone, M.: P490 Bireescu, G.: P087 Cloy, J.: P265, P604 Antille, D.: S28.E.02 Bireescu, L.: P358 Cobo Borrero, J.: P450 Antoni, V.: S12.L.04, S15.N.01 Birkás, M.: S04.K.01 Colinet, G.: S11.E.01 Antoniadis, V.: P219 Biró, B.: S24.I.03, P071 Collin Bellier, C.: P033 Appel, K.: P025 Bisharat, R.: S28.C.02 Colombo, C.: S14.L.04, S19.D.02 Aquino, A.: S13.D.04 Biswas, S.: P531 Concheri, G.: P233 Arao, T.: P449 Black, H.: S10.I.02, S16.E.04 Conrad, Y.: S07.N.06 Aref, F.: P399, P411 BáoĔska, E.: P357 Contin, M.: S11.F.04 Arenz, M.: P248 Blume, H.: S22.N.01 Coquet, Y.: S06.C.03 Arizaleta, M.: P252 Bock, M.: S26.E.04 Cordova, C.: S26.G.02 Arnold, R.: S29.J.KL Bodner, G.: P021 Cornélis, J.: S09.N.03 Arrouays, D.: S10.H.KL Bogatu, C.: S11.E.04 Cornu, J.: P176 Atanassova, I.: P188 Boivin, P.: S08.F.04 Coucheney, E.: S08.C.01 Auffray, V.: S06.B.01 Bolysheva, T.: P175 Couder, E.: P287 Aust, M.: S13.G.04 Bongoua Devisme, A.: S08.E.02 Coulouma, G.: S26.F.05 Azizi, P.: P396 Borggaard, O.: S11.F.02 Coutinho, J.: P464 Borowska, K.: P404 Cox, L.: P390 Baatar, U.: P585 Boruvka, L.: P315 Craciun, C.: P010 Babayev, M.: P324 Bosold, M.: S20.C.02 Creamer, R.: S16.E.03 Babenko, A.: S22.L.01 Bosshard, C.: S28.A.01 Cser, V.: P156 Bachmann, J.: S06.B.02 Böttcher, J.: P588 Csiba, M.: S04.J.05 Bachmann, G.: P114 Bottinelli, N.: P229, P477 Cummins, T.: S19.G.01 Badalíková, B.: P279 Bou Kheir, R.: S03.D.01 ýurlík, J.: S19.E.03 Badin, A.: S18.J.05 Bouajila, A.: P239 Curmi, P.: S25.B.05 Baghban Sirus, S.: P384 Boulonne, L.: P520 Cyrus, E.: P275 Bahmanzadeh, H.: P374 Boye, K.: S28.F.05 Czyz, E.: S17.J.04, P537 Bahrami, A.: P725, P726 Brak, M.: P618 Bahrani, A.: P061, P678 Bravin, M.: S23.B.03, P066 Dąbkowska-Naskret, H.: P535 Baize, D.: S15.M.01 Brtnický, M.: P441 Dadenko, E.: P100 Bajica, M.: S15.L.02 Bucsi, T.: P476 Dahlke, C.: S21B.F.03 Bakhlaeva-Egorova, O.: P608 Buenemann, E.: S08.D.02 Dameni, H.: P184 Bakic, H.: P155 Bulgariu, D.: P506 Danilova, A.: P009, P150 Baksic, D.: S17.J.03 Bullinger-Weber, G.: P687 Dao, T.: P422 Balkoviþ, J.: P606 Burghardt, W.: S18.H.KL1 Darwish, K.: P302 Ballabio, C.: P314 Buscot, F.: S08.A.01 Davari, M.: P700 Balog, K.: P621 Butorac, L.: P331 De Troyer, I.: S01.C.01 Barancikova, G.: P577 De Witt, N.: S16.D.KL Barczi, A.: S25.C.02 Calciu, I.: P567 Deckers, J.: S21A.E.01 Bardulis, A.: P747 Calil, F.: P024 Défossez, P.: S04.H.04 Degorski, M.: P501 Franko, U.: S01.K.01 Haas, U.: P286 Delstanche, S.: P461 Frielinghaus, M.: S22.N.05, P345 Hackl, E.: S08.B.06 Delvaux, B.: P444 Friesl, W.: S27.B.03 Haei, M.: P593 Denisova, T.: P086 Frison, A.: S06.B.04 Hagemann, N.: S21A.E.04 Desaules, A.: S10.I.03 Fritz, H.: P710 Hahn, C.: P430 Deumlich, D.: S15.L.04 Fröhlich, D.: S09.L.03 Haimi, J.: S09.K.04 Deurer, M.: S13.F.01, P035 Frossard, E.: S28.J.06, P387 Hajabbasi, M.: P028, P199, P376 Dexter, A.: S02.H.KL Fuchs, M.: P008 Hallett, P.: S18.K.04, P310 Díaz-Pinés, E.: P734 Fuentes, M.: P195 Hamer, U.: S08.D.04 Diehl, D.: S01.F.04 Fuhrmann, A.: P099 Hamidpour, M.: S11.B.05 Dilkova, R.: P468, P532 Fulajtar, E.: S03.G.03, P039 Han, K.: S28.D.05 Djordjevic, A.: P042 Fursova, A.: P101 Hanegraaf, M.: S10.K.04 Djukic, I.: P595 Furtado, M.: P263 Hartikainen, S.: S11.C.02 Djurisic-Mladenovic, N.: P423 Fuß, R.: P096 Hartmann, P.: P708 Dlugosz, J.: P394 Hasan, O.: S29.J.01 Doaei, N.: S17.H.01, P246 Gaballah, M.: S05.N.04 Hashemi, S.: P323 Dobos, E.: S20.B.02 Gaertig, T.: P733 Hashemimajd, K.: P185 Domsch, H.: P313 Gafurova, L.: S28.K.01, P137 Hasinger, M.: S11.G.03 Domuta, C.: P629 Gaivoronskiy, V.: P147 Haslinger, E.: P077 Don, A.: S01.J.04 Gál, A.: S10.K.03 Hathaway-Jenkins, L.: S07.N.04 Dondini, M.: P202 Galic, Z.: P705 Hedde, M.: P242 Dorodnikov, M.: S01.I.04 Galoviü, L.: P414 Heim, A.: S01.G.03 Dos Santos, T.: P135 Gandois, L.: S13.E.03 Heinze, S.: S08.G.02 Douaoui, A.: S05.M.03 Garnier, P.: S08.C.04, P274 Heitkamp, F.: P218 Doublet, J.: S28.E.01 Garre, S.: P055 Helassa, N.: S24.I.02 Dreibrodt, S.: S21B.G.01 Gartner, K.: S09.L.02 Henríquez-Rodríguez, M.: P647 Dryslova, T.: P264 Gartzia Bengoetxea, N.: P180 Herbst, M.: P317 Duijnisveld, W.: P516 Gascó, G.: P271 Hernández Hierro, J.: P398 Dümig, A.: S25.B.03 Gauthier, A.: P172 Herold, M.: P068 Dumitru, M.: P617 Gavrichkova, O.: S23.C.04, P126 Herouet, J.: P742 Gebhardt, S.: P043 Herrmann, A.: P136 Eberhardt, E.: S15.N.02 Gehring, A.: P372 Herzberger, E.: S22.L.02 Ebrahimi, S.: S12.M.02, P139, P221, Geissen, V.: S11.B.04, S11.C.01, P094 Heumann, S.: P244 P472, P677 Geitner, C.: P074 Heyn, N.: P555 Eckelmann, W.: P695 Gelsomino, A.: P296 Hien, E.: S29.K.03 Eckmeier, E.: P299 Gentile, A.: S16.D.01 Hilber, I.: S11.D.01 Eftene, M.: S30.B.04 Gerayzade, A.: P609 Hildebrand, E.: S09.M.04 Egli, M.: S19.F.01 Geremia, R.: S08.D.06 Hildermann, I.: S23.B.06 Eickhorst, T.: P115 Gerke, H.: P023 Hinck, S.: P305 El Nahry, A.: S07.L.04 Gessesse, G.: P336 Hinsinger, P.: S23.A.KL Elarabi, H.: P027 Geyer, K.: S22.M.02 Hirai, K.: S28.E.03 El-Dewiny, C.: P377 Ghaffari, G.: P642 Hissler, C.: P226 Ellerbrock, R.: S01.B.05 Ghani, A.: S01.C.02 Hoballah, E.: P676 Emadi, M.: P004, P186, P303, P304 Gheres, M.: P487, P566 Hofmann, A.: S01.D.03 Emadodin, I.: P297, P661 Ghorbani Nasrabadi, R.: P053 Hofmann, T.: S18.J.03, P505 Emami, H.: P013, P014, P360 Ghorbani Vaghei, H.: P015 Höke, S.: S18.K.03 Emerstorfer, N.: P620 Ghrair, A.: P157 Holland, J.: S06.C.04, S07.N.05 Engelhardt, S.: S06.A.01 Giandon, P.: S15.N.04 Holthusen, D.: P473 Ernst, G.: P090 Giani, L.: S19.G.04 Hong, I.: P121, P123 Ertlen, D.: S25.B.02 Gil, G.: P420 Hong, S.: P386 Esmaili, A.: P418 Gildemeister, D.: S01.D.02 Hopkins, D.: S01.H.06, S02.I.01, Esmali Ouri, A.: P325, P338 Gillabel, J.: S01.I.02 S08.D.01 Espana, M.: P217 Girardin, C.: S01.D.01 Horia, V.: P436 Espejo, R.: P591 Glante, F.: S16.D.03 Horn, R.: S04.J.01, S07.H.KL Espejo-Perez, A.: P637 Glenk, K.: S21A.D.02 Hosseini, V.: P704 Esperschuetz, J.: P051 Gocke, M.: S19.G.03 Hosseinifard, S.: P655 Eusterhues, K.: S30.B.01 Golia, E.: P410, P493, P494, P691 Hosseinpur, A.: P437 Golubovic, S.: P045 Hough, R.: S02.H.01 Fantappiè, M.: S03.F.02 Gömöryová, E.: P607 Houot, S.: S28.J.02 Farhangi, M.: P133 Gönster, S.: P557 Hrubý, J.: P110 Farooq, S.: P656 González Alcaraz, M.: P280 Hseu, Z.: P272 Farrokhian Firouzi, A.: P633, P634 González Sánc, E.: S28.D.04 Huber, S.: -null- Fässler, E.: S11.E.03 González-Fernández, P.: S28.H.06 Huber, S.: S16.D.04 Feder, F.: S28.B.05 González-Martín, I.: P196 Huber, C.: P723, P724 Feiza, V.: P359 Gonzalez-Sanchez, E.: P550 Hubert, F.: S30.B.03 Feiziene, D.: S28.C.04 Gorbov, S.: P495 Hudson, T.: P603 Fenton, O.: P149 Graefe, U.: S08.F.06 Huerta, E.: P453 Fiala, K.: P234 Grantina, L.: P116 Hugenschmidt, C.: S07.J.01 Filipov, F.: P041, P255 Grebenc, T.: S23.A.01, P251 Huguenot, D.: S11.D.06 Finke, P.: S25.C.04 Gregory, A.: S01.J.02 Hurst, S.: P584, P685 Fishkis, O.: S30.C.01 Griffiths, B.: S08.C.02, S17.K.01 Hybler, V.: P638 Fless, N.: P454 Grigore, E.: S07.H.02 Flessa, H.: P743 Grossman, L.: S21B.F.02 Ibañez-Huerta, A.: P334 Foereid, B.: S01.K.04, P194 Grundmann, G.: S08.C.03 Ibargoitia, M.: P181, P182 Follain, S.: S03.E.04 Grüneberg, E.: S09.I.02 Ilieva, V.: P391, P401 Fonseca, B.: S11.B.03 Grybos, M.: S14.M.03 Illés, G.: P311 Fonseca Salcedo, F.: P630 Guenet, B.: S01.D.04 Ilvesniemi, H.: P227 Fonteneau, H.: P228 Guney, M.: S18.J.02 Ingwersen, J.: S01.K.02 Forghani, A.: P200, P402 Guntzer, F.: S28.I.02 Inselsbacher, E.: S28.C.01 Fox, C.: P005 Gus, P.: P266 Iordache, M.: P105 Francaviglia, R.: P224 Gvili, O.: P560 Isermann, K.: S27.B.04 Franke, M.: P646 Ispas, S.: P445 Ivankovic, N.: P504 Köster, T.: S03.D.04 Maejima, Y.: P426 Koumanov, K.: S07.M.04 Mahjoory, R.: S21B.F.01 Jacobs, A.: S01.J.05 Kovalev, I.: P612 Mahmoud, S.: P378 Jaeger, F.: P236 Kovaleva, N.: S25.C.03 Mahmoud, M.: P409 Jafarov, A.: P002 Kovda, I.: P073 Makarov, M.: P365 Jafarzadeh, A.: S20.C.04 Kozak, J.: S15.L.KL Makowsky, L.: S18.I.01 Jahn, R.: S19.D.KL Kralj, T.: S20.B.05 Mali, B.: P483 Jalali Moakhar, V.: P658, P659 Kramers, G.: P288 Maly, S.: P104 James, B.: S21B.G.02 Kratz, S.: S28.J.05, P106, P392 Mamedov, N.: P610 Janowiak, J.: P214 Kravchenko, A.: S02.J.06, S30.B.06, Mandzhieva, S.: S10.J.05 Janßen, I.: S04.I.01 P511 Manna, P.: S07.H.03 Javaux, M.: S06.B.06 Kreschnak, C.: S07.L.06 Maquere, V.: P459 Jerabkova, L.: S09.J.01 Kroulik, M.: S04.I.04 Marchetti, M.: P070 Jeschke, F.: S14.M.01 Krümmelbein, J.: S04.H.03, P478 Marchetti, R.: P597 Joergensen, R.: S08.G.01 Krzic, M.: S22.L.03, P712, P715 Marfenina, O.: S25.B.01 Jolivet, C.: P517 Kuderna, M.: S16.E.02 Mariscal-Sancho, I.: S28.F.01 Jomura, M.: P259 Kudryashov, S.: P563 Markgraf, W.: S04.H.01 Jones, R.: S16.D.02 Kulhavy, J.: S09.N.06 Maron, P.: S08.E.01 Jones, A.: S20.A.01 Kulli Honauer, B.: S22.L.04 Marschner, B.: S01.A.KL, S13.G.03 Joos, O.: S01.I.03 Kurakov, A.: S08.E.04 Martin, M.: S26.D.02 Jung, W.: P570 Kurganova, I.: S01.H.02, S28.D.02 Martin, D.: P364 Junge, B.: P328 Kutrovski, M.: P213 Martínez-Casasnovas, J.: S17.H.03 Jungerius, P.: S20.B.04 Kuznetsova, Y.: P102 Matejek, B.: P458 Justus, A.: S25.C.01 Kvarda, W.: P689 Matev, A.: S07.N.01, P587 Matty, F.: P666 Kabala, C.: S19.F.04, P170 Lacarce, E.: S15.L.03, S19.D.03 Matula, S.: S06.A.KL, P026 Kadziene, G.: S07.L.02 Lacatusu, A.: P178 Mazhitova, G.: S02.I.03 Kaiser, M.: S01.E.02 Lacatusu, R.: P509 Mazzocca, A.: P291 Kaiser, C.: S08.B.04 Lafuente, F.: P258 McCabe, D.: P253 Kaiser, K.: S14.L.KL Lahdenperä, A.: P717 McKenzie, B.: S16.F.03 Kalbe, U.: P141 Lai, H.: P556 Meesenburg, H.: S09.M.02 Kalbitz, K.: S14.L.01 Lair, G.: S13.F.03 Meier, C.: P539 Kalinina, O.: P031 Laloy, E.: S03.E.02 Meißner, S.: S13.G.02 Kammer, A.: S01.B.01 Lamandé, M.: S04.I.02 Meiwes, K.: S09.K.02 Kandeler, E.: P125 Lamers, M.: P574 Meleshyn, A.: S14.M.02 Kandil, H.: P672 Lamparter, A.: S06.C.02 Mellendorf, M.: P093 Karami, A.: P339, P554 Lang, F.: S03.F.01 Mergelov, N.: P268 Karczewska, A.: S18.J.04, P148 Lange, B.: S07.J.03 Mesic, M.: S28.F.02 Karklins, A.: S20.B.03 Langella, G.: P322 Meuli, R.: S16.G.01 Karyotis, T.: P088, P614 Langer, I.: P065 Meuser, H.: S18.I.02 Kasparinskis, R.: S19.E.02 Langley, S.: P489 Meyer, B.: S05.L.03 Kátai, J.: P654 Langohr, R.: S25.A.KL Meyer, F.: P529 Kataja-aho, S.: P713 Lapa, V.: P412 Miano, T.: P205, P206 Keller, A.: S28.E.04 Larikov, A.: P132, P711 Michalzik, B.: S09.N.05 Khalili Rad, R.: P679 Lark, M.: S26.D.KL Michel, J.: S13.F.02 Khalilmoghadam, B.: S03.G.02, Lashermes, G.: P446 Michot, D.: S07.I.03, S26.F.04 S06.B.03 Laszlo, P.: P470 Miehlich, G.: S22.L.KL Khan, K.: S05.N.03 Laverdière, M.: P623 Milanovskiy, E.: P198 Khormali, F.: S30.C.02 Laveuf, C.: S25.B.04 Milleret, R.: S08.F.03, P129 Khresat, S.: S17.H.02 Lazarov, A.: P355 Miltner, A.: P247 Kim, P.: S02.J.05 Lebedeva-Verba, M.: P038 Mirjana, S.: P138 Kim, S.: S24.I.01 Lee, K.: P421 Mirzazade, R.: P680 Kim, P.: S28.F.04 Lee, Y.: P428 Mitova- Trifonova, T.: P438 Kim, P.: P463 Lefebvre, M.: S04.J.04 Mitovska, R.: P225 Kim, P.: P670 Legout, A.: P644, P745 Mitusov, A.: P076, P171 Kimetu, J.: P189 Lehmann, A.: S18.H.KL2 Mitusova, O.: P169 Kirchmann, H.: S27.A.01 Leifeld, J.: S01.J.03 Mocanu, V.: P011 Kisic, I.: S03.F.04, S11.D.02 Leitner, D.: P072 Moeyersons, J.: P300 Kissou, R.: P605 Lemercier, B.: P316 Möller, M.: S26.D.01 Kitzler, B.: P600 Lenhart, K.: S02.J.02 Montanarella, L.: S17.H.KL Klepsch, S.: P057 Lenhart, T.: S07.L.01 Montoroi, J.: S05.L.04 Klevzov, A.: P375 Lerch, T.: S01.G.04 Morachevskaya, E.: P457 Klingelmann, E.: S13.F.04 Leue, M.: P653 Moradi, A.: P069 Klotzbücher, T.: S01.B.02 Levei, E.: P491 Moraetis, D.: S28.H.05 Klumpp, E.: S24.H.04 Lilly, A.: S10.J.02 Morell-Soler, F.: P190 Klymenko, O.: P400 Lipiec, J.: S04.J.03 Morgenstern, Y.: S07.I.01 Knecht, K.: P056 Lisec, A.: S17.K.03 Morishita, T.: S09.I.03 Knicker, H.: S01.D.05 Loell, M.: P080 Morrison, C.: P269 Kobal, M.: S01.H.04, P596 Londero, E.: P261 Mosaddeghi, M.: S07.I.04, S07.J.02, Kobza, J.: S10.H.01 Lopez, D.: S27.C.03 P019 Kodesova, R.: P018, P276 López Olvera, J.: P151 Mostephaoui, T.: P663 Koele, N.: S09.N.04 Lorencová, H.: P731 Mourier, B.: S19.F.02, S29.J.04 Kohlpaintner, M.: P735 Loseva, E.: P130 Mousavi, S.: P671 Kölbl, A.: P241 Lukas, V.: P321 Moussadek, R.: S07.N.03 Kolesnikov, S.: P140 Lukowski, M.: P306 Mrazikova, M.: P475 Kolev, N.: S07.L.05 Lüscher, P.: P686 Mueller, C.: S01.C.03, S02.K.04 Kõlli, R.: S16.E.01 Luster, J.: S23.B.02 Mueller, K.: S13.G.01 Kolupaeva, V.: P626 Mueller, L.: S16.F.05 Koper, J.: P204 Mabit, L.: P327 Mueller, K.: P032, P681, P682 Koptsik, G.: S11.G.04 Macaigne, P.: S07.J.05 Müller, D.: S12.M.01 Koptsik, S.: S12.M.03 Machinet, G.: S01.B.04 Müller, C.: P694 Kosse, A.: S18.H.01 Madadi, A.: S03.E.03 Muñiz Ugarte, O.: P413 Munkholm, L.: S02.J.04, P366 Piccolo, A.: S01.H.01 Rodríguez-Liza, A.: P353 Munteanu, I.: S21B.G.03 Pieper, S.: S18.J.06 Rodríguez-Rodríguez, O.: P434, P440, Murawska, B.: P416 Piirainen, S.: S09.I.04 P455, P462, P651 Muriel, J.: P636 Pintar, M.: S17.H.04, P552 Rokhzadi, A.: P085 Murtagh, L.: P250 Piotrowska, A.: P393 Romanenkov, V.: S02.K.01 Muter, O.: P067, P167 Piron, D.: S08.F.02, P044, P488 Rosenbaum, U.: S06.C.01 Pivovarova, E.: P362 Rotina, E.: P146 Najafi, N.: P049 Pizzigallo, M.: P142 Rottmann, N.: S01.B.03 Nannipieri, P.: P124 Plante, A.: S14.N.02 Roulier, S.: S18.I.04 Nanzer, S.: P406 Pla-Sentis, I.: S07.H.01 Rubio, C.: P519 Naumann, P.: S01.C.04 Poggio, L.: S15.N.03, S26.E.01, Rueck, F.: P301 Navroski, M.: P293 S27.C.04 Ruess, L.: S08.A.KL Nedyalkova, K.: P419 Poll, C.: S08.B.01, P586 Rusu, C.: P040 Neerinckx, S.: S21A.E.02 Polous, A.: P662 Rusu, T.: P530 Neidhardt, H.: P548 Polyakov, A.: P370 Rütting, T.: S02.K.03 Nekova, D.: P344 Ponican, O.: P485 RyĪak, M.: P514 Németh, T.: S28.A.KL Popescu, L.: P161 Nerger, R.: P518 Popova, Z.: S07.L.03, S28.D.01 Sa, T.: P120, P122 Nesic, L.: P433 Poputnikov, V.: S18.H.02 Sabahi, H.: P395 Nestroy, O.: S22.M.01 Pospisilova, L.: P209, P363 Sabau, C.: P553 Neyshabouri, M.: S07.K.02 Poss, R.: P442 Saby, N.: S10.J.01 Niacsu, L.: P561 Pot, V.: S13.D.01, P281 Sadeghi, H.: P675 Nieminen, T.: S09.H.03 Potthast, K.: P203 Safari Sinegani, A.: P063, P064 NikliĔska, M.: P111 Potthoff, M.: S08.F.01 Sager, M.: S11.B.01, S17.J.01 Nikolskii-Gavrilov, I.: P569 Prahastuti, S.: S11.D.04 Sah, S.: S09.J.02 Nikpour, M.: P256, P652 Prasuhn, V.: P326 Sajedi, T.: S09.N.01 Nocentini, C.: P254, P729 Premrov, A.: P627 Sakai, M.: P736 Norra, S.: P507 Prietzel, J.: S09.K.03 Sakrabani, R.: S02.K.02 Nourbakhsh, F.: S28.K.04, P089 Prikhodko, V.: P572 Salem, M.: S07.M.03 Nowak, J.: P492 Priputina, I.: P168 Sanchez, J.: P667, P668 Nunan, N.: S02.I.02 Pritsch, K.: S23.B.01 Sánchez-Alcalá, I.: P407 Proust, D.: S11.C.03 SáĖka, M.: P549 Oberholzer, H.: S08.D.05, P481 Prus, T.: P551, P562 Sansoulet, J.: S13.F.05 Oberson, A.: P405 Puhlmann, H.: S07.I.02 Sarapatka, B.: P095 Öborn, I.: S28.H.01 Pumpanen, J.: P727 Sauer, D.: S19.E.01 Oburger, E.: P058 Puschenreiter, M.: S12.L.03 Sauer, A.: S27.C.01 Oktaba, L.: P034 Puskás, I.: P499 Sauheitl, L.: S23.B.05 Onal, M.: P083 Savin, A.: S20.C.03 Opfergelt, S.: S19.D.04 Quoc Dung, D.: P702, P738 Schack-Kirchner, H.: P571 Ordóñez, R.: P343 Schad, P.: S20.B.01 Orsillo, N.: P298 Rad, C.: P113 Schäffer, J.: S10.K.01 Oswald, S.: S23.C.03 Raducu, D.: P012 Schaumann, G.: S13.E.01 Ottesen, R.: S11.B.02 Rafaela, O.: P632 Scheel, T.: S14.L.02 Ottofuelling, S.: P503 Ragazzi, F.: S05.L.01 Scherr, K.: S11.F.06 Oustan, S.: P144 Rahimi, G.: S03.F.05 Schick, J.: S28.G.01 Ownegh, M.: S05.L.02, P664 Rahimi, M.: P382, P388, P674 Schillinger, W.: S17.J.06 Özkaraova Güngör, B.: S12.L.01 Rak, M.: P451 Schindewolf, M.: S03.E.01, P349 Özkaraova Güngör, B.: P650 Rakonczai, J.: P582 Schindler, U.: S07.J.06 ÖzpÕnar, S.: P541, P542 Ramazanova, F.: S17.J.02 Schirrmann, M.: S26.D.04 Ramirez, A.: P583 Schlichting, A.: S24.H.03 3DãDOLü, H.: P283 Ramos, M.: S03.F.06, P594 Schloter, M.: S24.H.KL Padidar, M.: P425, P429 Rampazzo, N.: P480 Schmidt, K.: S26.F.01 Pagel, H.: P103 Rampazzo Todorovic, G.: P081, P237 Schmitter, P.: S28.I.04 Paltineanu, C.: P635 Ranjard, L.: S08.G.04 Schneckenburger, T.: S13.E.02 Panin, P.: S25.B.06 Raous, S.: P173 Schneider, M.: S01.G.01 Pansak, W.: P558 Rasa, K.: S07.K.01 Schneider, J.: P498 Pappa, V.: P427, P546 Rasnoveanu, I.: P564 Schneider Teixeira, A.: P153 Papritz, A.: S10.H.04, S11.B.06, P684 Rasouli, S.: S28.I.03 Schnepf, A.: S23.C.01 Pascault, N.: S08.B.02 Rasouli Sadaghiani, M.: P050 Schoebinger, U.: P510 Pasricha, N.: S28.H.03, P179 Ratinger, T.: S21A.D.KL Scholten, T.: S03.G.04 Pastukhov, A.: S19.F.05 Räty, M.: P335, P484 Schöning, I.: S26.G.01 Pásztor, L.: P698, P699 Raynaud, X.: S23.C.02 Schrader, S.: P576 Patzel, N.: S21B.G.04 Recatala, L.: P346, P690, P371 Schröder, T.: P017 Pavelescu, G.: P496, P497 Reckling, T.: P320 Schrodt, F.: S28.F.03 Paz-Ferreiro, J.: S28.J.01, P318 Regan, J.: S03.F.03 Schroll, R.: P273 Pehamberger, A.: S20.C.01 Rehbein, K.: P307 Schuler, J.: S21A.E.03 Peltre, C.: S01.F.05 Reichenauer, T.: S12.L.02, S27.B.02 Schulp, N.: S21B.F.04 Penizek, V.: P319 Reimann, C.: S10.H.03, S18.J.01 Schumacher, M.: P602 Penne, C.: P212 Reintam, E.: P469 Schwab, P.: P513 Perelomov, L.: P645 Remes, M.: P728 Schwärzel, K.: S09.M.01, P706 Pérès, G.: S10.K.02, P373, P524, P525, Renella, G.: P062 Sciacca, S.: P720 P565 Repe, B.: P536 Seceleanu, I.: P628 Pérez-de-Mora, A.: P091 Reshadi-nezhad, N.: P197 Seger, M.: P486 Perez-Sirvent, C.: S05.N.02, P177, Reszkowska, A.: S05.N.01 Seletkoviü, I.: P460 P669 Reyhanitabar, A.: P379 Selim, A.: S28.D.06 Perovic, N.: P447 Richer de Forges, A.: P696 Sellitto, M.: S01.G.02 Peth, S.: S04.H.02 Rimmer, D.: S01.E.01 Semenov, M.: P029 PetĘ, Á.: P075 Ripka, K.: P127 Seo, Y.: P079 Petzold, R.: S09.L.01 Rochdi, A.: P347 Sepehr, E.: P052 Peyrical, J.: P523 Rodriguez, N.: P163 Serramiá, N.: P601 Pfeffer, M.: P599 Rodríguez Rodríguez, A.: P222 Sessitsch, A.: S08.B.05, S24.H.02 Piccini, C.: P389 Rodríguez-Campos, A.: P465, P466 Shakeri, S.: P003 Shary, P.: P174 Terán-Mita, T.: P166 Verdoodt, A.: S26.D.03 Shchegolikhina, A.: P240 Theocharopoulos, S.: P332 Vesterdal, L.: S09.I.01 Shein, E.: S04.K.02 Theodorika, C.: P538 Vidal Vázquez, E.: P456 Sherif, L.: P354 Thiel, E.: S28.B.06 Viera, M.: P741 Shields, A.: P693 Thiele-Bruhn, S.: P092 Vingiani, S.: P657 Shishkov, T.: S10.I.04, S20.B.06 Thorsen, M.: P559 Virto, I.: S17.I.01 Siam, H.: P380 Tiktak, A.: S21A.D.01 Vlček, V.: P235 Siasou, E.: P059 Titeux, H.: S09.N.02, P528 Voigt, B.: S22.N.02 Siljeström, P.: P036 Tobias, S.: S04.K.03, S16.F.02 von Bennewitz, E.: P649 Simojoki, A.: P474 Todorova, M.: P201 von Wilpert, K.: S09.J.KL, P479 Simončič, P.: S09.M.03 Todorovic, D.: S11.G.02 Voronina, L.: P408 Simota, C.: S05.M.02 Tonkova, Z.: P292 Vortelová, L.: P719 Simunic, I.: P403 Topcuoglu, B.: P082 Vrščaj, B.: S10.J.03, S18.K.01 Singh, A.: S09.H.04 Torres, D.: P162 Vrînceanu, A.: P643 Sklodowski, P.: P006 Tóth, T.: S05.M.01 Vukašinović, I.: P527 Skowronek, J.: S11.A.KL Totsche, K.: S13.D.KL Skrbic, B.: S28.J.04 Towers, W.: S17.K.02, S22.N.04 Wacker, B.: P613 Smalla, K.: S24.H.01 Toyota, K.: P131 Wada, S.: P117 Smirnova, I.: S11.G.01 Traoré, M.: P270 Wagner, S.: S29.K.01 Smith, K.: S01.F.02 Trap, J.: S09.H.02 Wahba, M.: P183 Smittenberg, R.: S01.H.05 Trifonova, T.: P397 Walch, S.: P243 Smyth, N.: P211 Trubetskaya, O.: P193 Walna, B.: P431 Sobocka, J.: S18.K.02 Trubetskoj, O.: P192 Walsch, J.: P284 Soinne, H.: S28.G.02 Trueby, P.: P160 Walter, I.: P329 Soja, G.: S11.F.01 Trükmann, K.: P482 Waltner, I.: P352 Soleimani, M.: S12.M.04 Trum, F.: S09.H.01, P709 Wanat, N.: P502 Sonneveld, M.: S28.B.02 Trümper, G.: P580 Wang, X.: P615 Soubrand, M.: P249 Truparová, S.: P732 Warnecke, S.: S17.J.05 Spaargaren, O.: S20.A.KL Tsai, H.: S29.K.02 Wauters, E.: S21A.D.03 Spiegel, H.: S09.J.04, S27.B.01 Tsai, C.: P707 Wegehenkel, M.: P589 Spielvogel, S.: P187 Tsatiris, V.: P289 Weihermüller, L.: P512 Spivakova, N.: P098 Tsenova, V.: P624 Weinfurtner, K.: S17.K.04 Spulber, L.: P573 Tsenova, V.: P625 Weis, W.: S09.J.03 Spychaj-Fabisiak, E.: P417 Tulina, A.: P215 Weisskopf, P.: S04.J.02 Srámek, V.: P718 Tunega, D.: S13.D.02, P152, P278 Wessolek, G.: S22.N.03 Stahr, K.: S30.A.KL Tunney, H.: S28.H.04 Weynants, M.: S06.B.05 Stamati, F.: S16.F.06, P282 Tusch, M.: S26.F.06 White, N.: S18.I.03 Stanga, I.: P350 Tzoraki, O.: S11.F.05 Whitmore, A.: S01.K.03 Statescu, F.: S07.M.01 Wiesenberg, G.: S01.B.06 Staunton, S.: S14.N.01, P232 Udovic, M.: S11.F.03 Wiesmeier, M.: S01.J.01 Stefan, M.: P054 Uhlířová, J.: S17.I.02 Wilczek, A.: P522 Steffens, M.: S01.H.03 Ukonmaanaho, L.: P730 Wilke, B.: S04.H.KL, P145 Stein, C.: S30.B.05 Ulmanu, M.: P119 Willer, J.: S26.E.02 Steiner, C.: S01.J.06 Umarova, A.: S07.N.02 Wilson, C.: S01.F.03, P688 Steinnes, E.: S27.A.KL Unterfrauner, H.: P721 Winiwarter, V.: S21B.F.KL, P547 Stepanov, A.: P231 Unterseher, E.: P592 Wirth, S.: S05.M.04 Sticht, C.: S02.J.03 Urbančič, M.: P367, P722 Wittstock, F.: S11.D.03 Stoicheva, D.: P439, P448 Urushadze, T.: S28.K.03 Woche, S.: S04.K.04 Stoimenov, G.: P578, P579, P619 Usowicz, B.: P020, P308 Woignier, T.: S19.D.01 Stone, D.: P295 Utermann, J.: P207 Wolff, M.: P701 Strauss, P.: S03.D.KL Uusitalo, M.: P740 Wolinska, A.: P016 Strzyszcz, Z.: P143 Uzarowicz, L.: S30.B.02 Stumpe, B.: S28.J.03 Yadegari, M.: P048, P078 Suhadolc, M.: S17.I.04 Valente, M.: P262 Yamelynets, T.: P342 Sutinen, R.: S07.J.04, P022, P737 van Beek, C.: S10.H.02 Yang, J.: P164, P631 Swiercz, A.: P533 Van de Wauw, J.: S26.G.03 Yatsukhno, V.: P534 Syafruddin, S.: P159 Van den Akker, J.: S16.F.01 Ye, L.: S27.C.02 Sycheva, S.: P590 van den Ancker, H.: P545 Yim, W.: P060, P118 Szabó, J.: S10.J.04 Van den Bossche, A.: S28.B.01 Youssef, R.: S11.C.04, S28.K.02 Szafranek, A.: S17.I.03 van Egmond, F.: S26.F.03 Yurkov, A.: P109 Szafranek-Nakonieczna, A.: P223 Van Liedekerke, M.: S15.L.01 Szava-Kovats, R.: P703 Van Miegroet, H.: S09.H.KL Zaer Nomali, S.: P432 Szili-Kovács, T.: P107, P108 van Riemsdijk, W.: S14.L.03 Zaghloul, A.: S11.D.05 Szopka, K.: P716 Vancampenhout, K.: S01.F.06, Zamora, F.: P665 Szymczak, D.: P508 S21A.D.04, S25.A.01 Zarad, S.: S07.M.02 Vanhala, P.: P598 Zechmeister-Boltenstern, S.: S02.H.02 Taalab, A.: P381 Varlev, I.: S28.D.03 Zehetner, F.: S29.J.03 Talkner, U.: S28.G.04 Vasat, R.: P312 Zgorelec, Z.: P361 Tarau, D.: P415 Vasenev, I.: S29.J.02 Zharkova, M.: P097 Targulian, V.: S29.K.KL Vashev, B.: P697 Zigova, A.: P037 Tarnocai, C.: S02.I.04 Vasiliniuc, I.: P368, P622 Zimmermann, M.: S01.I.01 Tawfik, M.: P424 Vassilieva, N.: P260 Zink, A.: S04.I.03 Tcvetkova, E.: P356 Vegter, J.: S12.L.KL Zoerner, D.: P543 Tedla, H.: P267 Velardo, M.: P351 Zovko, M.: S15.M.02 Teh, C.: P611 Velasco-Molina, M.: P216 Zsupos Oláh, Á.: P128 Teixeira, T.: P452 Velea, T.: P165 Teodorescu-Soare, E.: P660 Velizarova, E.: P714 1RWHV 1RWHV