DOCSLIB.ORG

(12) Patent Application Publication (10) Pub. No.: US 2010/0292090 A1 Nakamura Et Al

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Patent Application Publication (10) Pub. No.: US 2010/0292090 A1 Nakamura Et Al US 2010O292090A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2010/0292090 A1 Nakamura et al. (43) Pub. Date: Nov. 18, 2010 (54) PROGNOSTIC MARKERS AND Related U.S. Application Data THERAPEUTIC TARGETS FOR LUNG (60) Provisional application No. 60/840,376, filed on Aug. CANCER 25, 2006, provisional application No. 60/894,801, filed on Mar. 14, 2007. (75) Inventors: Yusuke Nakamura, Tokyo (JP); Publication Classification Yataro Daigo, Tokyo (JP); Shuichi Nakatsuru, Kanagawa (JP) (51) Int. Cl. C40B 30/04 (2006.01) CI2O I/68 (2006.01) Correspondence Address: GOIN 33/53 (2006.01) TOWNSEND AND TOWNSEND AND CREW, CI2O 1/02 (2006.01) LLP GOIN 33/00 (2006.01) TWO EMBARCADERO CENTER, EIGHTH (52) U.S. Cl. ............... 506/9: 435/6: 435/7.92; 435/7.94: FLOOR 435/29: 436/86 SAN FRANCISCO, CA 94111-3834 (US) (57) ABSTRACT The present invention provides a diagnostic marker to detect (73) Assignee: ONCOTHERAPY SCIENCE, ing lung cancer. In particular, the present invention provides INC., Kawasaki-shi (JP) lung cancer marker genes i.e. KIF4A, MAPJD, NPTX, or FGFR1OP. The present invention further provides methods (21) Appl. No.: 12/438,579 and kit for identifying compounds for treating lung cancer as well as methods for predicting a prognosis or diagnosis of lung cancer. In particular, the present invention provides (22) PCT Filed: Aug. 23, 2007 methods and kits for identifying inhibitors of the interaction between KIF4A/ZNF549, KIF4A/ZNF553, MAPJD/MYC, (86). PCT No.: PCT/UP2007/066825 or FGFR1OP/WRNIP1 which find utility in the treatment and prevention of lung. Alternatively, the present invention pro S371 (c)(1), vides MAPJD associated with HAT complex as therapeutic (2), (4) Date: Aug. 4, 2010 target. Patent Application Publication Nov. 18, 2010 Sheet 1 of 23 US 2010/0292090 A1 Fig. 1 Clinical SCLC K6 K24 K45 K46 K64 K76 K81 K95 onal sists ADC SCC ii is MAPUD NSCLC Normal lung NSCLC OEWS! saw how ww &lar a v. NPTX1 ADC SCC SCLC | | | | (/)|Q O |81||H-ION 01LZH-ION 6-Od 999?H-IONI ACTB Airway SC epithelia ADC |(_)02GH-ION ASCLCC SCLC 90/LH-ION 01LZH-ION |179H-ION Patent Application Publication Nov. 18, 2010 Sheet 2 of 23 US 2010/0292090 A1 Fig. Airway B NSCLC Cell line SCLC Cell line epithelia 3 KF4A & C st $2 cy C w SS. g. S SN SS isN N25 & 22 &a 3?m 3?m 3 (kDa) C - T of Y a ?h (/) (/) () B: anti-KIF4A IB: anti-ACTB NPTX1 N am --m- - - - - m a v - - - - - W - W -- FGFR1OP Clinical lung cancers - - - 15 16 17 (kDa) N T N T N T 250 1OO 50 FGFR1OP 37 inmammam ACTB Airway ... ...u. ... -- - - - - - --- epithelia Lung cancer cell lines cN Y S. S. g . S. S. N. S. LL SE cyp O O O- V - kDa is : C 9 ; ; 9 9 O 3 75 us sk a s xx 50 m m a name inter quipment oup m | FGFR1OP 37- - 37 Patent Application Publication Nov. 18, 2010 Sheet 3 of 23 US 2010/0292090 A1 Fig. 1 | |W NPTX1 Molleueuog| 1.35 |- Patent Application Publication Nov. 18, 2010 Sheet 4 of 23 US 2010/0292090 A1 Fig. 1 KIF4A Air DAPI KIF4A-Alexa488 MAPUD NPTX1 COS-7 NPTX1 A549 LC31 9 NCI-H520 SBC-5 SBC-5 hours after aphidicolin release 15 4 DAP Patent Application Publication Nov. 18, 2010 Sheet 5 of 23 US 2010/0292090 A1 Fig. 1 E KF4A MAPUD NPTX1 Lung SCLC FGFR1OP Patent Application Publication Nov. 18, 2010 Sheet 6 of 23 US 2010/0292090 A1 Fig. 2 A scLc ADC sco B KF4A 1 s 9.8 KLF4A negative 8-6 9 st d .4 .2 Normal Lung 5.2 - - - - - - - --- - -rrorror- O KIF4A positive (t O N - 127 P =0.0005 O 500 1 OOO1500 200025OO300035OO Postoperative days C E NPTX Normal FGFR1OP Strong Normal i. Lung Strong Weak * Y-8 NPTX1 Weak or absent .8 6. Weak,absent FGFR1OP Cas expression expression (N=208) .4 26 Strong expression FGFR1OP expression O N=139 (N=211) PC O.OOO1 0 500 100015002000250030003500 0 1000 20003000 40005000 6000 7000 Postoperative days Postoperative days Patent Application Publication Nov. 18, 2010 Sheet 7 of 23 US 2010/0292090 A1 Fig. 3 NPTX1 (U/ml) 7OO 600 300 200 1400 100 Patent Application Publication Nov. 18, 2010 Sheet 8 of 23 US 2010/0292090 A1 Fig. 4 A Control si-KIF4A C KFAA LUC SCR #1 #2 0.25 POOOO4 g 0.2 B S i 0.15 LUC .2 0.1 Y SCR O.05 D LUC SCR #1 #2 E COS-7 NH3T3 1 & S. 5 292 0.8 (kDa) l,a O2 a 8O O.6 250 sing Sadha- " : 8 150 e g 0.4 100 . COS-7 Y 0.2 O KIF4A(+) MOCK -- . KIF4A(+) MOCK KIF4A(+ MOCK PEO.OOO8 P=OOO37 G 80 140 r 70 - 120 3 60 100 S 50 - O 80 40 - g 30 - 60 w : 2O - 40 20 O O KIF4A(+) MOCK KIF4A(+) MOCK Patent Application Publication Nov. 18, 2010 Sheet 9 of 23 US 2010/0292090 A1 Fig. 5 A 9 5 S. MAPUD (O 5 MAPJD AcTB LUC si-1 SCR si-2 B LUC Si-MAPJD-2 3. 3 C LUC Si-MAPJD-2 ej8.7% 3.34.6% O y 2O FL, FL2, D mock MAPJD if A i B if A if B MAPJD ACTB xirs. MAPJD-A - X - MAPJD-B Patent Application Publication Nov. 18, 2010 Sheet 10 of 23 US 2010/0292090 A1 Fig. 6 NPTX1 A549 SBC5 Control anti-NPTX1 Control anti-NPTX1 SiRNA SiRNA SiRNA SiRNA LUC SCR- - - -si-2 - LUC SCR si-2 NPTX1ACTB RR NPTX1ACTB 0.500 2,000 CD g 2 0.400 1500 m marrimum c d 9 as O.300 3 g 1,000 --- m 0.200m CD > 2 t 0.500 '''''". "''''''''''''''''''" is 0.100 c Y Y O.000 0.000 SN p v i X i H I l 2 Patent Application Publication Nov. 18, 2010 Sheet 11 of 23 US 2010/0292090 A1 Fig. 7 A anti-FGFR1OP Control anti-FGFR1OP Control SiRNA SiRNA SiRNA SiRNA si-1 EGFPLUC SCR si-1 EGFPLUC SCR 3.0 32.5 2. O 2. O 5 1 O si-1 EGFP LUC SCR ? C 9 E (kDa) 1 5 250 1 O 100 75 50 mock 1 FGFR1OP 1 COS-7 COS-7 25 FGFR1OP/COS-7 WB: anti-c-Myc mock/COS-7 WB: anti-ACTB Patent Application Publication Nov. 18, 2010 Sheet 12 of 23 US 2010/0292090 A1 Fig. 7 p 0.0056 mock mock FGFR1OP P < 0.0001 ÇO o LO G mock CD © mock FGFR1OP Patent Application Publication Nov. 18, 2010 Sheet 13 of 23 US 2010/0292090 A1 Fig. 8 KFAA A P Normal anti-KIF4A (kDa) goat (gG pAb - - - - - - - - - - - 100 1 75 50 1. ZNF549 Zinc finger protein 549 2. ZNF553 Zinc finger protein 553 B DAP ZNF549-Alexa488 KIF4A-Alexa594 DAP - - ZNF553-Alexa488 KF4A-Alexa594 Merge Patent Application Publication Nov. 18, 2010 Sheet 14 of 23 US 2010/0292090 A1 Fig. 9 A WAPO mock SBNO TGFBRAP1 ROK1 RASGEF1A 1OOO 500 600 500 4OO 5 400 s 3OO & 3OO O s 200- 2OO 100. 1OO O 0 - O mock MAPJD mock MAPJD mock MAPJD mock MAPJD modk MAPJD 2, B C is a P: anti-MAPD Ab IP es 9e S. B anti-MYC. AO -- m -- -an P ... anti-MYC Ab SBNO1 E B: anti-MAPJD Abi TGFBRAP1 - IP: (-) : 3 RIOK1 - - B: anti-MYC Ab RASGEF1A - IBIP : anti-MAPJD( ) Abt. is " B23. D- - - - - - - - - - - - - - - - - - - - - - - - - - a r D x108 mock x104 SBNO1 x104 TGFBRAP1 x 106 ROK1 xg RASGEFA 5 III | - ON RSS "O : SS O>- 9 >-O 3 s : E a i i 2 a > n cl ?h-G -2 s CC C < f s S s s s Patent Application Publication Nov. 18, 2010 Sheet 15 of 23 US 2010/0292090 A1 Fig. 10 WAPO B protein MAPD MYC a swas sat w w a Y by (g) 0.51 2 0.51 2 Competitor (-) o c (coid probe) (-) g (-) g - O) --lsa s s : Patent Application Publication Nov. 18, 2010 Sheet 16 of 23 US 2010/0292090 A1 Fig. 11 A B MAPUD (D s 5 input ACH4 TRRAP MYC 2is sin sš So & So & So & So IP: () SBNo1 - - Acetylation Activation Repression Patent Application Publication Nov. 18, 2010 Sheet 17 of 23 US 2010/0292090 A1 Fig. 12 A P FGFR1OP P input O 2, () L : as M - 1 5O IgG heavy chain IB: anti-WRNIP WNRIP1 UV irradiation (10 J/m2) FGFR1 OP WRNIP1 IABL1 ACTB Patent Application Publication Nov. 18, 2010 Sheet 18 of 23 US 2010/0292090 A1 Fig. 12 FGFR1OP DAP merge with DAP UV (100 J/m2) (-) 60 min. E UV (100 J/m2) W (-) 5 min. 60 min. Patent Application Publication Nov. 18, 2010 Sheet 19 of 23 US 2010/0292090 A1 Fig. 12 F FGFR1OP DAP merge with DAP UV (100 J/m2) (-) 5 min. 60 min. Patent Application Publication Nov. 18, 2010 Sheet 20 of 23 US 2010/0292090 A1 Fig. 13 A FGFR1OP FGFR1OP (myc-IP) + + - WRNIP1 (myc-IP) + + recombinant ABL 1 - - recombinant ABL1 - -- -- (kDa) O O 9. (kDa) O O O 250 250 150 m # # 150 - iii. 100- 100 75 75 50 m 50 WB: phospho-Tyr (kDa) (kDa) O O. O. 250 150 m 100 m 75 50 m WB: c-myc(FGFR1OP) WB: C-myc(WRNIP1) c IP: myc Ab. B myc-tagged WRNIP1. * * Flag-tagged ABL1 - recombinant ABL1 * (kDa) WRNIP1 (myc-IP) + .
Load more

Recommended publications
  • Regulation of DNA Cross-Link Repair by the Fanconi Anemia/BRCA Pathway
    Downloaded from genesdev.cshlp.org on September 29, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW Regulation of DNA cross-link repair by the Fanconi anemia/BRCA pathway Hyungjin Kim and Alan D. D’Andrea1 Department of Radiation Oncology, Dana-Farber Cancer Institute, Harvard Medical School, Boston, Massachusetts 02215, USA The maintenance of genome stability is critical for sur- and quadradials, a phenotype widely used as a diagnostic vival, and its failure is often associated with tumorigen- test for FA. esis. The Fanconi anemia (FA) pathway is essential for At least 15 FA gene products constitute a common the repair of DNA interstrand cross-links (ICLs), and a DNA repair pathway, the FA pathway, which resolves germline defect in the pathway results in FA, a cancer ICLs encountered during replication (Fig. 1A). Specifi- predisposition syndrome driven by genome instability. cally, eight FA proteins (FANCA/B/C/E/F/G/L/M) form Central to this pathway is the monoubiquitination of a multisubunit ubiquitin E3 ligase complex, the FA core FANCD2, which coordinates multiple DNA repair activ- complex, which activates the monoubiquitination of ities required for the resolution of ICLs. Recent studies FANCD2 and FANCI after genotoxic stress or in S phase have demonstrated how the FA pathway coordinates three (Wang 2007). The FANCM subunit initiates the pathway critical DNA repair processes, including nucleolytic in- (Fig. 1B). It forms a heterodimeric complex with FAAP24 cision, translesion DNA synthesis (TLS), and homologous (FA-associated protein 24 kDa), and the complex resem- recombination (HR). Here, we review recent advances in bles an XPF–ERCC1 structure-specific endonuclease pair our understanding of the downstream ICL repair steps (Ciccia et al.
    [Show full text]
  • Checkpoint Defects Require WRNIP1 to Counteract R-Loop-Associated
    bioRxiv preprint doi: https://doi.org/10.1101/858761; this version posted November 29, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. CHECKPOINT DEFECTS REQUIRE WRNIP1 TO COUNTERACT R-LOOP- ASSOCIATED GENOMIC INSTABILITY Veronica Marabitti1, Giorgia Lillo1, Eva Malacaria1, Valentina Palermo1, Pietro Pichierri1 and Annapaola Franchitto1, * 1Department of Environment and Health, Section of Mechanisms Biomarkers and Models, Istituto Superiore di Sanita’, Viale Regina Elena 299, Rome, 00161, Italy * To whom correspondence should be addressed. Tel: +39 0649903042; Fax: +39 0649903650; Email: [email protected] Keywords: Werner syndrome, RECQ helicases, DNA repair, Replication stress 1 bioRxiv preprint doi: https://doi.org/10.1101/858761; this version posted November 29, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-ND 4.0 International license. ABSTRACT Conflicts between replication and transcription are common source of genome instability and many factors participate in prevention or removal of harmful R-loops. Here, we demonstrate that a WRNIP1-mediated response plays an important role in counteracting accumulation of aberrant R- loops. Using human cellular models with compromised ATR-dependent checkpoint activation, we show that WRNIP1 is stabilised in chromatin and is needed for maintaining genome integrity by mediating the ATM-dependent phosphorylation of CHK1.
    [Show full text]
  • Transcriptional Profiling of Breast Cancer Cells in Response to Mevinolin: Evidence of Cell Cycle Arrest, DNA Degradation and Apoptosis
    1886 INTERNATIONAL JOURNAL OF ONCOLOGY 48: 1886-1894, 2016 Transcriptional profiling of breast cancer cells in response to mevinolin: Evidence of cell cycle arrest, DNA degradation and apoptosis ALI M. MAHMOUD1,2, MOURAD A.M. ABOUL-SOUD1,3, JUNKYU HAN4,5, YAZEED A. AL-SHEIKH3, AHMED M. AL-ABD6 and HANY A. EL-SHEMY1 1Department of Biochemistry, Faculty of Agriculture, Cairo University, Giza 12613; 2Centre for Aging and Associated Diseases, Helmy Institute for Medical Sciences, Zewail City of Science and Technology, Giza 12588, Egypt; 3Chair of Medical and Molecular Genetics Research, Department of Clinical Laboratory Sciences, College of Applied Medical Sciences, King Saud University, Riyadh 11433, Kingdom of Saudi Arabia; 4Graduate School of Life and Environmental Sciences; 5Alliance for Research on North Africa (ARENA), University of Tsukuba, Tsukuba, Ibaraki 305-8572, Japan; 6Department of Pharmacology, Medical Division, National Research Centre, Cairo 21622, Egypt Received January 29, 2015; Accepted March 3, 2016 DOI: 10.3892/ijo.2016.3418 Abstract. The merging of high-throughput gene expression lines. In addition, MVN‑induced transcript abundance profiles techniques, such as microarray, in the screening of natural inferred from microarrays showed significant changes in some products as anticancer agents, is considered the optimal solu- key cell processes. The changes were predicted to induce cell tion for gaining a better understanding of the intervention cycle arrest and reactive oxygen species generation but inhibit mechanism. Red yeast rice (RYR), a Chinese dietary product, DNA repair and cell proliferation. This MVN-mediated contains a mixture of hypocholesterolemia agents such as multi‑factorial stress triggered specific programmed cell death statins.
    [Show full text]
  • Myopia in African Americans Is Significantly Linked to Chromosome 7P15.2-14.2
    Genetics Myopia in African Americans Is Significantly Linked to Chromosome 7p15.2-14.2 Claire L. Simpson,1,2,* Anthony M. Musolf,2,* Roberto Y. Cordero,1 Jennifer B. Cordero,1 Laura Portas,2 Federico Murgia,2 Deyana D. Lewis,2 Candace D. Middlebrooks,2 Elise B. Ciner,3 Joan E. Bailey-Wilson,1,† and Dwight Stambolian4,† 1Department of Genetics, Genomics and Informatics and Department of Ophthalmology, University of Tennessee Health Science Center, Memphis, Tennessee, United States 2Computational and Statistical Genomics Branch, National Human Genome Research Institute, National Institutes of Health, Baltimore, Maryland, United States 3The Pennsylvania College of Optometry at Salus University, Elkins Park, Pennsylvania, United States 4Department of Ophthalmology, University of Pennsylvania, Philadelphia, Pennsylvania, United States Correspondence: Joan E. PURPOSE. The purpose of this study was to perform genetic linkage analysis and associ- Bailey-Wilson, NIH/NHGRI, 333 ation analysis on exome genotyping from highly aggregated African American families Cassell Drive, Suite 1200, Baltimore, with nonpathogenic myopia. African Americans are a particularly understudied popula- MD 21131, USA; tion with respect to myopia. [email protected]. METHODS. One hundred six African American families from the Philadelphia area with a CLS and AMM contributed equally to family history of myopia were genotyped using an Illumina ExomePlus array and merged this work and should be considered co-first authors. with previous microsatellite data. Myopia was initially measured in mean spherical equiv- JEB-W and DS contributed equally alent (MSE) and converted to a binary phenotype where individuals were identified as to this work and should be affected, unaffected, or unknown.
    [Show full text]
  • Mir-17-92 Fine-Tunes MYC Expression and Function to Ensure
    ARTICLE Received 31 Mar 2015 | Accepted 22 Sep 2015 | Published 10 Nov 2015 DOI: 10.1038/ncomms9725 OPEN miR-17-92 fine-tunes MYC expression and function to ensure optimal B cell lymphoma growth Marija Mihailovich1, Michael Bremang1, Valeria Spadotto1, Daniele Musiani1, Elena Vitale1, Gabriele Varano2,w, Federico Zambelli3, Francesco M. Mancuso1,w, David A. Cairns1,w, Giulio Pavesi3, Stefano Casola2 & Tiziana Bonaldi1 The synergism between c-MYC and miR-17-19b, a truncated version of the miR-17-92 cluster, is well-documented during tumor initiation. However, little is known about miR-17-19b function in established cancers. Here we investigate the role of miR-17-19b in c-MYC-driven lymphomas by integrating SILAC-based quantitative proteomics, transcriptomics and 30 untranslated region (UTR) analysis upon miR-17-19b overexpression. We identify over one hundred miR-17-19b targets, of which 40% are co-regulated by c-MYC. Downregulation of a new miR-17/20 target, checkpoint kinase 2 (Chek2), increases the recruitment of HuR to c- MYC transcripts, resulting in the inhibition of c-MYC translation and thus interfering with in vivo tumor growth. Hence, in established lymphomas, miR-17-19b fine-tunes c-MYC activity through a tight control of its function and expression, ultimately ensuring cancer cell homeostasis. Our data highlight the plasticity of miRNA function, reflecting changes in the mRNA landscape and 30 UTR shortening at different stages of tumorigenesis. 1 Department of Experimental Oncology, European Institute of Oncology, Via Adamello 16, Milan 20139, Italy. 2 Units of Genetics of B cells and lymphomas, IFOM, FIRC Institute of Molecular Oncology Foundation, Milan 20139, Italy.
    [Show full text]
  • Vertebrate WRNIP1 and BLM Are Required for Efficient Maintenance of Genome Stability
    Genes Genet. Syst. (2008) 83, p. 95–100 Vertebrate WRNIP1 and BLM are required for efficient maintenance of genome stability Tomoko Hayashi1, Masayuki Seki1*, Eri Inoue1, Akari Yoshimura1, Yumiko Kusa1, Shusuke Tada1 and Takemi Enomoto1,2 1Molecular Cell Biology Laboratory, Graduate School of Pharmaceutical Sciences, Tohoku University, Sendai, Miyagi 980-8578, Japan 2Tohoku University 21st Century COE Program, “Comprehensive Research and Education Center for Planning of Drug Development and Clinical Evaluation,” Sendai, Miyagi 980-8578, Japan (Received 25 September 2007, accepted 15 November 2007) Bloom syndrome (BS) is rare autosomal recessive disorder associated with chro- mosomal instability. The gene responsible for BS, BLM, encodes a protein belonging to the RecQ helicase family. Disruptions of the SGS1 gene of Saccha- romyces cerevisiae, which encodes the RecQ helicase homologue in the budding yeast, causes accelerated aging, and this phenotype is enhanced by the disruption of MGS1, the budding yeast homologue for WRNIP1. To examine the functional relationship between RecQ and WRNIP1 in vertebrate cells, we generated and characterized wrnip1/blm cells derived from the chicken B-lymphocyte line DT40. wrnip1/blm cells showed an additive elevation of sister chromatid exchange (SCE), suggesting that both genes independently contribute to the suppression of excess SCE formation. The double mutants were more sensitive to DNA damage from camptothecin (CPT), but not to damage from methyl methanesulfonate, than either single mutant. This result suggests that WRNIP1 and BLM function inde- pendently to repair DNA or induce tolerance to the lesions induced by CPT. Key words: BLM, DT40, Mgs1, RecQ, WRN, WRNIP1 Five genes encoding RecQ helicase homologues have RecQL4 mutations result in RAPADILINO syndrome and been identified in human cells, three of which are the Baller-Gerold syndrome, suggesting that RecQL4 has mul- causative genes for Bloom syndrome (BS), Werner syn- tiple functions (Dietschy et al., 2007).
    [Show full text]
  • Molecular Genetics in Neuroblastoma Prognosis
    children Review Molecular Genetics in Neuroblastoma Prognosis Margherita Lerone 1, Marzia Ognibene 1 , Annalisa Pezzolo 2 , Giuseppe Martucciello 3,4 , Federico Zara 1,4, Martina Morini 5,*,† and Katia Mazzocco 6,† 1 Unit of Medical Genetics, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] (M.L.); [email protected] (M.O.); [email protected] (F.Z.) 2 IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 3 Department of Pediatric Surgery, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] 4 Dipartimento di Neuroscienze, Riabilitazione, Oftalmologia, Genetica e Scienze Materno-Infantili, University of Genova, 16132 Genova, Italy 5 Laboratory of Molecular Biology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy 6 Department of Pathology, IRCCS Istituto Giannina Gaslini, 16147 Genova, Italy; [email protected] * Correspondence: [email protected]; Tel.: +39-010-5636-2633 † Authors share senior authorship. Abstract: In recent years, much research has been carried out to identify the biological and genetic characteristics of the neuroblastoma (NB) tumor in order to precisely define the prognostic subgroups for improving treatment stratification. This review will describe the major genetic features and the recent scientific advances, focusing on their impact on diagnosis, prognosis, and therapeutic solutions in NB clinical management. Keywords: neuroblastoma; genetics; TRK; liquid biopsy; exosomes; telomere maintenance; hypoxia Citation: Lerone, M.; Ognibene, M.; Pezzolo, A.; Martucciello, G.; Zara, F.; 1. Introduction Morini, M.; Mazzocco, K. Molecular Genetics in Neuroblastoma Prognosis. Neuroblastoma (NB) is a pediatric heterogeneous disease with a median age of Children 2021, 8, 456. https:// 17 months at diagnosis, which can evolve with a benign course or fatal illness, with a doi.org/10.3390/children8060456 natural history ranging from a benign course to a terminal illness [1–3].
    [Show full text]
  • Elucidating the Role of WRNIP1 in the Protection of Stalled Replication Forks
    Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2018 Elucidating the role of WRNIP1 in the protection of stalled replication forks Porebski, Bartlomiej Abstract: DNA is the blueprint of life. It contains all the information necessary for the synthesis of proteins – the building blocks and workhorses of the cell. Maintenance of DNA in an unchanged state is therefore of utmost importance, since any mutations or loss of the information it holds may lead to catastrophic events, such as cell death or tumorigenesis. DNA needs to be faithfully copied with every cell division, which is an enormous task, given its size and importance. DNA replication is constantly challenged by endogenous and exogenous factors, which have the potential to stall or stop replication – such a circumstance is called replication stress. While cells have evolved a number of mechanisms to deal with replication stress, e.g. checkpoint signaling that halts the cell cycle, DNA repair pathways that remove obstacles or factors that stabilise stalled replication forks, persisting replication stress inevitably leads to genomic instability and tumorigenesis. Interestingly, cancer cells, due to their unrestricted proliferation, have elevated level of replication stress, which makes them more susceptible to anti-cancer therapies that exacerbate genomic instability. It is thus obvious that dissecting the events and mechanisms leading to and following replication stress is important from a basic science and clinical research point of view. Among the many aspects of replication stress, one that is gaining an increasing amount of attention is replication fork stability.
    [Show full text]
  • FGFR1OP (Human) Recombinant Protein (P01)
    FGFR1OP (Human) Recombinant Protein (P01) Catalog # : H00011116-P01 規格 : [ 10 ug ] [ 25 ug ] List All Specification Application Image Product Human FGFR1OP full-length ORF ( AAH11902, 1 a.a. - 379 a.a.) Enzyme-linked Immunoabsorbent Assay Description: recombinant protein with GST-tag at N-terminal. Western Blot (Recombinant Sequence: MAATAAAVVAEEDTELRDLLVQTLENSGVLNRIKAELRAAVFLALEEQEK protein) VENKTPLVNESLRKFLNTKDGRLVASLVAEFLQFFNLDFTLAVFQPETST LQGLEGRENLARDLGIIEAEGTVGGPLLLEVIRRCQQKEKGPTTGEGAL Antibody Production DLSDVHSPPKSPEGKTSAQTTPSKKANDEANQSDTSVSLSEPKSKSSLH LLSHETKIGSFLSNRTLDGKDKAGLCPDEDDMEGDSFFDDPIPKPEKTY Protein Array GLRNEPRKQAGSLASLSDAPPLKSGLSSLAGAPSLKDSESKRGNTVLKD LKLISDKIGSLGLGTGEDDDYVDDFNSTSHRSEKSEISIGEEIEEDLSVEID DINTSDKLDDLTQDLTVSQLSDVADYLEDVA Host: Wheat Germ (in vitro) Theoretical MW 67.43 (kDa): Preparation in vitro wheat germ expression system Method: Purification: Glutathione Sepharose 4 Fast Flow Quality Control 12.5% SDS-PAGE Stained with Coomassie Blue. Testing: Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Store at -80°C. Aliquot to avoid repeated freezing and thawing. Instruction: Note: Best use within three months from the date of receipt of this protein. MSDS: Download Datasheet: Download Publication Reference 1. Fibroblast growth factor receptor 1 oncogene partner as a novel prognostic biomarker and therapeutic target for lung cancer. Page 1 of 2 2016/5/23 Mano Y, Takahashi K, Ishikawa N, Takano A, Yasui W, Inai K, Nishimura H, Tsuchiya E, Nakamura Y, Daigo Y.Cancer Sci. 2007 Dec;98(12):1902-13. Epub 2007 Sep 18. Applications Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array Gene Information Entrez GeneID: 11116 GeneBank BC011902 Accession#: Protein AAH11902 Accession#: Gene Name: FGFR1OP Gene Alias: FOP Gene FGFR1 oncogene partner Description: Omim ID: 605392 Gene Ontology: Hyperlink Gene Summary: This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member.
    [Show full text]
  • Roles of the Werner Syndrome Recq Helicase in DNA Replication
    dna repair 7 (2008) 1776–1786 available at www.sciencedirect.com journal homepage: www.elsevier.com/locate/dnarepair Mini-review Roles of the Werner syndrome RecQ helicase in DNA replication Julia M. Sidorova ∗ Department of Pathology, University of Washington, Seattle, WA 98195-7705, USA article info abstract Article history: Congenital deficiency in the WRN protein, a member of the human RecQ helicase family, Received 22 July 2008 gives rise to Werner syndrome, a genetic instability and cancer predisposition disorder with Accepted 23 July 2008 features of premature aging. Cellular roles of WRN are not fully elucidated. WRN has been Published on line 6 September 2008 implicated in telomere maintenance, homologous recombination, DNA repair, and other processes. Here I review the available data that directly address the role of WRN in preserv- Keywords: ing DNA integrity during replication and propose that WRN can function in coordinating Werner syndrome replication fork progression with replication stress-induced fork remodeling. I further dis- RecQ helicase cuss this role of WRN within the contexts of damage tolerance group of regulatory pathways, Human cell culture and redundancy and cooperation with other RecQ helicases. Replication stress Published by Elsevier B.V. Damage tolerance Contents 1. Introduction ................................................................................................................. 1777 1.1. Is S phase prolonged in WRN-deficient cells? ...................................................................... 1777 1.2. What is the mechanism of the S phase extension in the absence of WRN? ...................................... 1778 1.3. Are all forks equal when it comes to WRN? ........................................................................ 1779 1.4. A mechanistic model for WRN role in replication elongation ..................................................... 1779 1.5. WRN and damage tolerance pathways ............................................................................. 1781 1.6.
    [Show full text]
  • Congenital Diseases of DNA Replication: Clinical Phenotypes and Molecular Mechanisms
    International Journal of Molecular Sciences Review Congenital Diseases of DNA Replication: Clinical Phenotypes and Molecular Mechanisms Megan Schmit and Anja-Katrin Bielinsky * Department of Biochemistry, Molecular Biology, and Biophysics, University of Minnesota, Minneapolis, MN 55455, USA; [email protected] * Correspondence: [email protected] Abstract: Deoxyribonucleic acid (DNA) replication can be divided into three major steps: initiation, elongation and termination. Each time a human cell divides, these steps must be reiteratively carried out. Disruption of DNA replication can lead to genomic instability, with the accumulation of point mutations or larger chromosomal anomalies such as rearrangements. While cancer is the most common class of disease associated with genomic instability, several congenital diseases with dysfunctional DNA replication give rise to similar DNA alterations. In this review, we discuss all congenital diseases that arise from pathogenic variants in essential replication genes across the spectrum of aberrant replisome assembly, origin activation and DNA synthesis. For each of these conditions, we describe their clinical phenotypes as well as molecular studies aimed at determining the functional mechanisms of disease, including the assessment of genomic stability. By comparing and contrasting these diseases, we hope to illuminate how the disruption of DNA replication at distinct steps affects human health in a surprisingly cell-type-specific manner. Keywords: Meier-Gorlin syndrome; natural killer cell deficiency; X-linked pigmentary reticulate disorder; Van Esch-O’Driscoll disease; IMAGe syndrome; FILS syndrome; Rothmund-Thomson syndrome; Baller-Gerold syndrome; RAPADILINO Citation: Schmit, M.; Bielinsky, A.-K. Congenital Diseases of DNA Replication: Clinical Phenotypes and 1. Introduction Molecular Mechanisms. Int. J. Mol. 1.1. Replication Initiation Sci.
    [Show full text]
  • Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors
    University of Cincinnati Date: 12/20/2010 I, Arturo R Maldonado , hereby submit this original work as part of the requirements for the degree of Doctor of Philosophy in Developmental Biology. It is entitled: Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors Student's name: Arturo R Maldonado This work and its defense approved by: Committee chair: Jeffrey Whitsett Committee member: Timothy Crombleholme, MD Committee member: Dan Wiginton, PhD Committee member: Rhonda Cardin, PhD Committee member: Tim Cripe 1297 Last Printed:1/11/2011 Document Of Defense Form Molecular Targeting and Enhancing Anticancer Efficacy of Oncolytic HSV-1 to Midkine Expressing Tumors A dissertation submitted to the Graduate School of the University of Cincinnati College of Medicine in partial fulfillment of the requirements for the degree of DOCTORATE OF PHILOSOPHY (PH.D.) in the Division of Molecular & Developmental Biology 2010 By Arturo Rafael Maldonado B.A., University of Miami, Coral Gables, Florida June 1993 M.D., New Jersey Medical School, Newark, New Jersey June 1999 Committee Chair: Jeffrey A. Whitsett, M.D. Advisor: Timothy M. Crombleholme, M.D. Timothy P. Cripe, M.D. Ph.D. Dan Wiginton, Ph.D. Rhonda D. Cardin, Ph.D. ABSTRACT Since 1999, cancer has surpassed heart disease as the number one cause of death in the US for people under the age of 85. Malignant Peripheral Nerve Sheath Tumor (MPNST), a common malignancy in patients with Neurofibromatosis, and colorectal cancer are midkine- producing tumors with high mortality rates. In vitro and preclinical xenograft models of MPNST were utilized in this dissertation to study the role of midkine (MDK), a tumor-specific gene over- expressed in these tumors and to test the efficacy of a MDK-transcriptionally targeted oncolytic HSV-1 (oHSV).
    [Show full text]