FHL1 antibody - N-terminal region (ARP31902_P050) Data Sheet

Product Number ARP31902_P050 Product Name FHL1 antibody - N-terminal region (ARP31902_P050) Size 50ug Symbol FHL1 Alias Symbols FHL1B; KYO-T; MGC111107; SLIM1; bA535K18.1; KYOT; SLIM; FHL-1; FHL1A; FLH1A; XMPMA; SLIM-1; SLIMMER Nucleotide Accession# NM_001449 Size (# AA) 280 amino acids Molecular Weight 32kDa Product Format Lyophilized powder NCBI Gene Id 2273 Host Rabbit Clonality Polyclonal Official Gene Full Name Four and a half LIM domains 1 This is a rabbit polyclonal antibody against FHL1. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: SKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPK Target Reference Rice,K.L., (2008) Biochem. Biophys. Res. Commun. 367 (3), 707-713 LIM , named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double motif called the LIM domain.FHL1 contains 3 LIM zinc-binding domains. It may have an involvement in Description of Target muscle development or hypertrophy.LIM proteins, named for 'LIN11, ISL1, and MEC3,' are defined by the possession of a highly conserved double zinc finger motif called the LIM domain.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. Partner Proteins CBX4, RBPJ, RING1, SRF, CBX4, FHL2, HIVEP3, MYBPC1, RBPJ, RING1, SRF, FHL2 Reconstitution and Add 50 ul of distilled water. Final anti-FHL1 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. Storage For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles. Lead Time Domestic: within 24 hours delivery International: 3-5 business days Blocking Peptide For anti-FHL1 antibody is Catalog # AAP31902 (Previous Catalog # AAPP02702) Immunogen The immunogen for anti-FHL1 antibody: synthetic peptide corresponding to a region of Human Swissprot Id Q6IB30 Protein Name Four and a half LIM domains protein 1 Protein Accession # NP_001440 Purification Affinity Purified Species Reactivity Mouse, Sheep, Dog, Bovine, Rabbit, Rat, Guinea pig, Human, Horse Application WB Predicted Homology Based on Immunogen Dog: 100%; Pig: 100%; Rat: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 92%; Human: 92% Sequence

Human Brain WB Suggested Anti-FHL1 Antibody Titration: 0.2-1 ug/ml Positive Control: Human brain

Image 1

Hum. Fetal Brain

Host: Rabbit Target Name: FHL1 Image 2 Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0ug/ml

Hum. Fetal Brain

Host: Rabbit Target Name: FHL1 Image 3 Sample Tissue: Human Fetal Brain Antibody Dilution: 1.0ug/ml

______

This product is for Research Use Only. Not for diagnostic, human, or veterinary use. Optimal conditions of its use should be determined by end users.