DOCSLIB.ORG

Al-Sayyid Bedouin Shifra Kisch

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Al-Sayyid Bedouin Shifra Kisch Sign Languages in Village Communities Unauthenticated Download Date | 3/22/19 10:54 AM Sign Language Typology 4 Editors Marie Coppola Onno Crasborn Ulrike Zeshan Editorial board Sam Lutalo-Kiingi Irit Meir Ronice Müller de Quadros Roland Pfau Adam Schembri Gladys Tang Erin Wilkinson Jun Hui Yang De Gruyter Mouton · Ishara Press Unauthenticated Download Date | 3/22/19 10:54 AM Sign Languages in Village Communities Anthropological and Linguistic Insights Edited by Ulrike Zeshan Connie de Vos De Gruyter Mouton · Ishara Press Unauthenticated Download Date | 3/22/19 10:54 AM ISBN 978-1-61451-203-5 e-ISBN 978-1-61451-149-6 ISSN 2192-5186 e-ISSN 2192-5194 Library of Congress Cataloging-in-Publication Data A CIP catalog record for this book has been applied for at the Library of Congress. Bibliographic information published by the Deutsche Nationalbibliothek The Deutsche Nationalbibliothek lists this publication in the Deutsche Nationalbibliografie; detailed bibliographic data are available in the Internet at http://dnb.dnb.de. ” 2012 Walter de Gruyter, Inc., Boston/Berlin and Ishara Press, Nijmegen, The Netherlands Printing: Hubert & Co. GmbH & Co. KG, Göttingen Țȍ Printed on acid-free paper Printed in Germany www.degruyter.com Unauthenticated Download Date | 3/22/19 10:54 AM Contents Acknowledgements ....................................................................................... 1 Introduction: Demographic, sociocultural, and linguistic variation across rural signing communities Connie de Vos and Ulrike Zeshan ................................................................. 2 Part I. Rural signing varieties: Description, docu- PHQWDWLRQDQG¿HOGZRUNSUDFWLFH Being a deaf white anthropologist in Adamorobe: Some ethical and methodological issues Annelies Kusters .......................................................................................... 27 Colour signs in two indigenous sign languages Dany Adone, Anastasia Bauer, Keren Cumberbatch and Elaine L. Maypilama ................................................................................... 53 Demarcating generations of signers in the dynamic sociolinguistic landscape of a shared sign-language: The case of the Al-Sayyid Bedouin Shifra Kisch ................................................................................................. 87 The Kata Kolok perfective in child signing: Coordination of manual and non-manual components Connie de Vos ............................................................................................ 127 The survival of Algerian Jewish Sign Language alongside Israeli Sign Language in Israel Sara Lanesman and Irit Meir .................................................................... 153 6LJQLQJLQWKH$UFWLF([WHUQDOLQÀXHQFHVRQ,QXLW6LJQ/DQJXDJH Joke Schuit ................................................................................................ 181 Unauthenticated Download Date | 3/22/19 10:54 AM Contents An exploration in the domain of time: From Yucatec Maya time gestures to Yucatec Maya Sign Language time signs Olivier Le Guen ......................................................................................... 209 Deaf signers in Douentza, a rural area in Mali Victoria Nyst, Kara Sylla and Moustapha Magassouba ........................... 251 Language ecological change in Ban Khor, Thailand: An ethnographic case study of village sign language endangerment Angela M. Nonaka .................................................................................... 277 :RUNLQJZLWKYLOODJHVLJQODQJXDJHFRPPXQLWLHV'HDI¿HOGZRUN researchers in professional dialogue Hasan Dikyuva, Cesar Ernesto Escobedo Delgado, Sibaji Panda and Ulrike Zeshan ............................................................... 313 3DUW 3UR¿OHVRIVKDUHGVLJQLQJFRPPXQLWLHV $GDPRUREH$GHPRJUDSKLFVRFLROLQJXLVWLFDQGVRFLRFXOWXUDOSUR¿OH Annelies Kusters ........................................................................................ 347 $OLSXU6LJQ/DQJXDJH$VRFLROLQJXLVWLFDQGFXOWXUDOSUR¿OH Sibaji Panda .............................................................................................. 353 Algerian Jewish Sign Language: A sociolinguistic sketch Sara Lanesman and Irit Meir .................................................................... 361 Al-Sayyid: A sociolinguistic Sketch Shifra Kisch ............................................................................................... 365 Sociolinguistic sketch of Ban Khor and Ban Khor Sign Language Angela M. Nonaka .................................................................................... 373 Chican Sign Language: A sociolinguistic sketch Cesar Ernesto Escobedo Delgado ............................................................ 377 .DWD.RORN$QXSGDWHGVRFLROLQJXLVWLFSUR¿OH Connie de Vos ............................................................................................ 381 Unauthenticated Download Date | 3/22/19 10:54 AM Contents Sociolinguistic sketch of Konchri Sain Keren Cumberbatch .................................................................................. 387 6RFLROLQJXLVWLFSUR¿OHRI,QXLW6LJQ/DQJXDJH Joke Schuit ................................................................................................ 389 Mardin Sign Language: Signing in a “deaf family” Hasan Dikyuva .......................................................................................... 395 <ROQJX6LJQ/DQJXDJH$VRFLROLQJXLVWLFSUR¿OH Elaine L. Maypilama and Dany Adone ..................................................... 401 Language index .........................................................................................405 Subject index .............................................................................................408 Unauthenticated Download Date | 3/22/19 10:54 AM ȱ Unauthenticated Download Date | 3/22/19 10:54 AM Acknowledgements 7KLV YROXPH LV RQH RI WKH ¿UVW SXEOLVKHG RXWFRPHV RI WKH (XUR%$%(/ SURMHFWµ(QGDQJHUHG6LJQ/DQJXDJHVLQ9LOODJH&RPPXQLWLHV¶ KHQFHIRUWK 9LOODJH6LJQ (XUR%$%(/LVDQDFURQ\PZKLFKVWDQGVIRU%HWWHU$QDO\VHV %DVHG RQ (QGDQJHUHG /DQJXDJHV DQG WKLV VFKHPH ZDV GHYHORSHG XQGHU WKH (852&25(6 SURJUDPPH RI WKH (XURSHDQ 6FLHQFH )RXQGDWLRQ 7KH 9LOODJH6LJQSURMHFWLQFOXGHGSDUWQHUXQLYHUVLWLHVIURPWKH8.WKH86WKH 1HWKHUODQGV*HUPDQ\DQG,VUDHODQGPDQ\RIWKHDXWKRUVUHSUHVHQWHGLQ WKLVYROXPHKDYHEHHQFROODERUDWRUVLQWKH(XUR%$%(/LQLWLDWLYH:HJUDWH- IXOO\UHFRJQLVHWKH(XURSHDQ6FLHQFH)RXQGDWLRQ¶VFRQWULEXWLRQDVZHOODV WKHLQGLYLGXDOQDWLRQDOIXQGLQJDJHQFLHVZKRFRQWULEXWHGWRWKH(XUR%$%(/ VFKHPH WKH$UWV +XPDQWLHV 5HVHDUFK &RXQFLO $+5& WKH 'HXWVFKH )RUVFKXQJVJHPHLQVFKDIW ')* WKH 1DWLRQDO 6FLHQFH )RXQGDWLRQ 16) DQGWKH1HWKHUODQGV2UJDQLVDWLRQIRU6FLHQWL¿F5HVHDUFK 1:2 6RPHRI WKHUHVHDUFKSUHVHQWHGKHUHKDVEHHQDGGLWLRQDOO\IXQGHGE\WKH(QGDQJHUHG /DQJXDJHV 'RFXPHQWDWLRQ 3URJUDPPH RI WKH +DQV 5DXVLQJ (QGDQJHUHG /DQJXDJHV3URMHFW2WKHUFRQWULEXWLRQVDUHDFNQRZOHGJHGZLWKLQLQGLYLGXDO FKDSWHUV :HZRXOGOLNHWRWKDQNWKHDXWKRUVZKRKDYHFRQWULEXWHGWRWKLVYROXPH ZLWKLQDQGEH\RQGWKH(XUR%$%(/SURMHFW$QDVWDVLD%DXHU$QJHOD1RQDND $QQHOLHV .XVWHUV &HVDU (UQHVWR (VFREHGR 'HOJDGR 'DQ\$GRQH +DVDQ 'LN\XYD,ULW0HLU-RNH6FKXLW.DUD6\OOD.HUHQ&XPEHUEDWFK0RXVWDSKD 0DJDVVRXED2OLYHU/H*XHQ6DUD/DQHVPDQ6KLIUD.LVFK6LEDML3DQGD (ODLQH0D\SLODPDDQG9LFWRULD1\VW,WKDVEHHQDSULYLOHJHWRZRUNZLWK \RXDOO:HZRXOGDOVROLNHDQRSSRUWXQLW\WRH[SUHVVRXUJUDWLWXGHWRRXU SHHUVZKRUHYLHZHGWKHFKDSWHUVLQFOXGLQJWKHHGLWRULDOERDUGPHPEHUVRI WKH6LJQ/DQJXDJH7\SRORJ\6HULHVDQGWKHVHULHVHGLWRUV0DULH&RSSROD DQG2QQR&UDVERUQ :HDUHDOVRLQGHEWHGWRWKHGHGLFDWHGWHDPRISHRSOHZKRKDYHFRQWULE- XWHGWRWKHFRS\HGLWLQJW\SHVHWWLQJGHVLJQDQGSURGXFWLRQRIWKLVYROXPH WKURXJKDOOLWVVWDJHVLQSDUWLFXODU5RELQ$URUD7RQL&RPHUDQG-HQQLIHU :HEVWHUDW,VKDUD3UHVVDQG0DUFLD6FKZDUW]DQG$QJHOLND+HUPDQQIURP 'H*UX\WHU0RXWRQ Connie de Vos Ulrike Zeshan Unauthenticated Download Date | 3/22/19 10:55 AM Introduction: Demographic, sociocultural, and linguistic variation across rural signing communities Connie de Vos and Ulrike Zeshan 7KLVERRNXQLWHVWKHZRUNRIERWKDQWKURSRORJLVWVDQGOLQJXLVWVZKRKDYH FRQGXFWHG¿HOGZRUNLQUXUDOVLJQLQJFRPPXQLWLHVDURXQGWKHJOREH,QPRVW FDVHVWKHVHVLJQLQJFRPPXQLWLHVKDYHHPHUJHGLQUHVSRQVHWRDKLJKLQFL- GHQFHRI RIWHQKHUHGLWDU\ GHDIQHVV,QFRQWUDVWWRWKHQDWLRQDOVLJQODQJXDJHV XVHGLQXUEDQGHDIFRPPXQLWLHVWKHVHLQGLJHQRXVVLJQODQJXDJHVDUHW\SL- FDOO\VKDUHGEHWZHHQGHDIDQGKHDULQJFRPPXQLW\PHPEHUVWKXVIDFLOLWDWLQJ D KLJK GHJUHH RI LQWHJUDWLRQ EHWZHHQ GHDI DQG KHDULQJ LQGLYLGXDOV 7KLV YROXPHUHSUHVHQWVWKHODUJHVWFROOHFWLRQRIFRPSDUDWLYHZRUNDFURVVVXFK ³GHDIYLOODJHV´WRGDWH 7KHUHKDYHEHHQVSRUDGLFSXEOLFDWLRQVRQWKHVHFRPPXQLWLHVRYHUWKHSDVW IHZGHFDGHV VHHIRULQVWDQFH.DNXPDVX:DVKDEDXJK*URFH EXWWKHFKDSWHUVLQWKLVYROXPHFRQVWLWXWHWKH¿UVWH[WHQVLYHFRPSLOD- WLRQRIDFDGHPLFSDSHUVUHJDUGLQJWKHVHVLJQLQJYDULHWLHVDQGWKHFRPPXQL- WLHVLQZKLFKWKH\KDYHHPHUJHGIURPERWKDQWKURSRORJLFDODQGOLQJXLVWLF SHUVSHFWLYHV 0RUHRYHU IRU VRPH RI WKH VLJQLQJ YDULHWLHV GLVFXVVHG KHUH WKLVLVWKH¿UVWSULQWHGSXEOLFDWLRQWRDSSHDU VHHWKHFRPPXQLW\VNHWFKHVE\ 'LN\XYD/DQHVPDQ 0HLUDQG3DQGDLQ3DUW,,RIWKLVYROXPH $OO NQRZQ YLOODJH VLJQ ODQJXDJHV DUH HQGDQJHUHG XVXDOO\ EHFDXVH RI SUHVVXUHIURPODUJHUXUEDQVLJQODQJXDJHVDQGVRPHKDYHGLHGRXWDOUHDG\ ,URQLFDOO\LWLVRIWHQWKHVXFFHVVRIWKHODUJHUVLJQODQJXDJHFRPPXQLWLHVLQ XUEDQFHQWUHVWKHLUUHFRJQLWLRQDQGVXEVHTXHQWVSUHDGZKLFKOHDGVWRWKH HQGDQJHUPHQWRIWKHVHVPDOOPLQRULW\VLJQODQJXDJHV)RUWKLVUHDVRQWKH ERRNDOVRDGGUHVVHVWKLVVSHFL¿FW\SHRIODQJXDJHHQGDQJHUPHQWGRFXPHQ- WDWLRQVWUDWHJLHVDQGRWKHUHWKLFDOLVVXHV 7KHVHFWLRQVEHORZVHUYHDVDQLQWURGXFWLRQWRWKHGHPRJUDSKLFVRFLR- FXOWXUDODQGOLQJXLVWLFGLYHUVLW\WKDWLVUHSUHVHQWHGLQWKLVERRN5HVXOWVIURP WKHFKDSWHUVRIWKLVYROXPHDUHFRQWH[WXDOLVHGE\GHVFULELQJVRPHFRPPRQ- DOLWLHVDFURVVWKHYDULRXVVLWHVDQGODQJXDJHVDVZHOODVPRVWLPSRUWDQWO\
Load more

Recommended publications
  • Sign Language Typology Series
    SIGN LANGUAGE TYPOLOGY SERIES The Sign Language Typology Series is dedicated to the comparative study of sign languages around the world. Individual or collective works that systematically explore typological variation across sign languages are the focus of this series, with particular emphasis on undocumented, underdescribed and endangered sign languages. The scope of the series primarily includes cross-linguistic studies of grammatical domains across a larger or smaller sample of sign languages, but also encompasses the study of individual sign languages from a typological perspective and comparison between signed and spoken languages in terms of language modality, as well as theoretical and methodological contributions to sign language typology. Interrogative and Negative Constructions in Sign Languages Edited by Ulrike Zeshan Sign Language Typology Series No. 1 / Interrogative and negative constructions in sign languages / Ulrike Zeshan (ed.) / Nijmegen: Ishara Press 2006. ISBN-10: 90-8656-001-6 ISBN-13: 978-90-8656-001-1 © Ishara Press Stichting DEF Wundtlaan 1 6525XD Nijmegen The Netherlands Fax: +31-24-3521213 email: [email protected] http://ishara.def-intl.org Cover design: Sibaji Panda Printed in the Netherlands First published 2006 Catalogue copy of this book available at Depot van Nederlandse Publicaties, Koninklijke Bibliotheek, Den Haag (www.kb.nl/depot) To the deaf pioneers in developing countries who have inspired all my work Contents Preface........................................................................................................10
    [Show full text]
  • Florida Department of Education Home Language Codes
    Florida Department of Education Home Language Codes Code Home Language OM (Afan) Oromo AB Abkhazian AC Abnaki AD Achumawi AA Afar AK Afrikaans AE Ahtena EF Akan EK Akateko AF Alabama AL Albanian, Shqip AG Aleut AH Algonquian WJ American Sign Language AM Amharic AI Apache AR Arabic AJ Arapaho AO Araucanian AP Arikara AN Armenian, Hayeren AS Assamese AQ Athapascan AT Atsina AU Atsugewi AV Aucanian WK Awadhi AW Aymara AZ Azerbaijani AX Aztec BA Bantu BC Bashkir BQ Basque, Euskera BS Bassa BJ Belarusian Code Home Language BE Bengali, Bangla BR Berber BP Bhojpuri DZ Bhutani BH Bihari BI Bislama BG Blackfoot BF Breton BL Bulgarian BU Burmese, Myanmasa BD Byelorussian CB Caddo CC Cahuilla CD Cakchiquel CA Cambodian, Khmer CN Cantonese EC Carolinian CT Catalan CE Cayuga ZA Cebuano ED Chamorro CF Chasta Costa CG Chemeheuvi CI Cherokee CJ Chetemacha CK Cheyenne ZB Chhattisgarhi ZC Chinese, Hakka ZD Chinese, Min Nau (Fukienese or Fujianese) CH Chinese, Zhongwen CL Chinook Jargon CM Chiricahua ZE Chittagonian CP Chiwere CQ Choctaw CS Chumash EE Chuukese/Trukese Code Home Language CU Clallam CV Coast Miwok CW Cocomaricopa CX Coeur D’Alene CY Columbia DF Comanche CO Corsican DG Cowlitz DJ Cree ZF Creole HR Croatian, Hrvatski DK Crow DH Cuna DI Cupeno CZ Czech DB Dakota DA Danish DL Deccan DC Delaware DD Delta River Yuman DE Diegueno DU Dutch, Netherlands DO Dzongkha EN English EA Eskimo EO Esperanto ES Estonian EB Eyak FO Faroese FA Farsi, Persian FJ Fijian FL Filipino FI Finnish, Suomi FB Foothill North Yokuts FC Fox FR French FD French Cree Code Home
    [Show full text]
  • Deaf and in Need : Finding Culturally Sensitive Human Services
    California State University, Monterey Bay Digital Commons @ CSUMB Capstone Projects and Master's Theses 2007 Deaf and in need : finding culturally sensitive human services Colleen M. Moore California State University, Monterey Bay Follow this and additional works at: https://digitalcommons.csumb.edu/caps_thes Recommended Citation Moore, Colleen M., "Deaf and in need : finding culturally sensitive human services" (2007). Capstone Projects and Master's Theses. 350. https://digitalcommons.csumb.edu/caps_thes/350 This Capstone Project is brought to you for free and open access by Digital Commons @ CSUMB. It has been accepted for inclusion in Capstone Projects and Master's Theses by an authorized administrator of Digital Commons @ CSUMB. Unless otherwise indicated, this project was conducted as practicum not subject to IRB review but conducted in keeping with applicable regulatory guidance for training purposes. For more information, please contact [email protected]. Deaf and in Need: Finding Culturally Sensitive Human Services © 2007 Colleen M Moore. All Rights Reserved. 1 INTRODUCTION Imagine that you are unable to provide food for your family or must obtain housing, health care, psychiatric services, child care, family planning services or any other human service; you are unable to gain access to these things due to any number of difficult life circumstances. You must go to the local Department of Social and Employment Services (California), apply for aid, surrender private information and face the potential emotional backlash or shame that, for some, accompanies the decision to ask for help. Now imagine that you are a member of a cultural group that uses a language, customs and social mores unknown to most people.
    [Show full text]
  • Sign Language Endangerment and Linguistic Diversity Ben Braithwaite
    RESEARCH REPORT Sign language endangerment and linguistic diversity Ben Braithwaite University of the West Indies at St. Augustine It has become increasingly clear that current threats to global linguistic diversity are not re - stricted to the loss of spoken languages. Signed languages are vulnerable to familiar patterns of language shift and the global spread of a few influential languages. But the ecologies of signed languages are also affected by genetics, social attitudes toward deafness, educational and public health policies, and a widespread modality chauvinism that views spoken languages as inherently superior or more desirable. This research report reviews what is known about sign language vi - tality and endangerment globally, and considers the responses from communities, governments, and linguists. It is striking how little attention has been paid to sign language vitality, endangerment, and re - vitalization, even as research on signed languages has occupied an increasingly prominent posi - tion in linguistic theory. It is time for linguists from a broader range of backgrounds to consider the causes, consequences, and appropriate responses to current threats to sign language diversity. In doing so, we must articulate more clearly the value of this diversity to the field of linguistics and the responsibilities the field has toward preserving it.* Keywords : language endangerment, language vitality, language documentation, signed languages 1. Introduction. Concerns about sign language endangerment are not new. Almost immediately after the invention of film, the US National Association of the Deaf began producing films to capture American Sign Language (ASL), motivated by a fear within the deaf community that their language was endangered (Schuchman 2004).
    [Show full text]
  • University of California Santa Cruz Minimal Reduplication
    UNIVERSITY OF CALIFORNIA SANTA CRUZ MINIMAL REDUPLICATION A dissertation submitted in partial satisfaction of the requirements for the degree of DOCTOR OF PHILOSOPHY in LINGUISTICS by Jesse Saba Kirchner June 2010 The Dissertation of Jesse Saba Kirchner is approved: Professor Armin Mester, Chair Professor Jaye Padgett Professor Junko Ito Tyrus Miller Vice Provost and Dean of Graduate Studies Copyright © by Jesse Saba Kirchner 2010 Some rights reserved: see Appendix E. Contents Abstract vi Dedication viii Acknowledgments ix 1 Introduction 1 1.1 Structureofthethesis ...... ....... ....... ....... ........ 2 1.2 Overviewofthetheory...... ....... ....... ....... .. ....... 2 1.2.1 GoalsofMR ..................................... 3 1.2.2 Assumptionsandpredictions. ....... 7 1.3 MorphologicalReduplication . .......... 10 1.3.1 Fixedsize..................................... ... 11 1.3.2 Phonologicalopacity. ...... 17 1.3.3 Prominentmaterialpreferentiallycopied . ............ 22 1.3.4 Localityofreduplication. ........ 24 1.3.5 Iconicity ..................................... ... 24 1.4 Syntacticreduplication. .......... 26 2 Morphological reduplication 30 2.1 Casestudy:Kwak’wala ...... ....... ....... ....... .. ....... 31 2.2 Data............................................ ... 33 2.2.1 Phonology ..................................... .. 33 2.2.2 Morphophonology ............................... ... 40 2.2.3 -mut’ .......................................... 40 2.3 Analysis........................................ ..... 48 2.3.1 Lengtheningandreduplication.
    [Show full text]
  • FALAISES DE BANDIAGARA (Pays Dogon)»
    MINISTERE DE LA CULTURE REPUBLIQUE DU MALI *********** Un Peuple - Un But - Une Foi DIRECTION NATIONALE DU ********** PATRIMOINE CULTUREL ********** RAPPORT SUR L’ETAT DE CONSERVATION DU SITE «FALAISES DE BANDIAGARA (Pays Dogon)» Janvier 2020 RAPPORT SUR L’ETAT ACTUEL DE CONSERVATION FALAISES DE BANDIAGARA (PAYS DOGON) (MALI) (C/N 516) Introduction Le site « Falaises de Bandiagara » (Pays dogon) est inscrit sur la Liste du Patrimoine Mondial de l’UNESCO en 1989 pour ses paysages exceptionnels intégrant de belles architectures, et ses nombreuses pratiques et traditions culturelles encore vivaces. Ce Bien Mixte du Pays dogon a été inscrit au double titre des critères V et VII relatif à l’inscription des biens: V pour la valeur culturelle et VII pour la valeur naturelle. La gestion du site est assurée par une structure déconcentrée de proximité créée en 1993, relevant de la Direction Nationale du Patrimoine Culturel (DNPC) du Département de la Culture. 1. Résumé analytique du rapport Le site « Falaises de Bandiagara » (Pays dogon) est soumis à une rude épreuve occasionnée par la crise sociopolitique et sécuritaire du Mali enclenchée depuis 2012. Cette crise a pris une ampleur particulière dans la Région de Mopti et sur ledit site marqué par des tensions et des conflits armés intercommunautaires entre les Dogons et les Peuls. Un des faits marquants de la crise au Pays dogon est l’attaque du village d’Ogossagou le 23 mars 2019, un village situé à environ 15 km de Bankass, qui a causé la mort de plus de 150 personnes et endommagé, voire détruit des biens mobiliers et immobiliers.
    [Show full text]
  • Alignment Mouth Demonstrations in Sign Languages Donna Jo Napoli
    Mouth corners in sign languages Alignment mouth demonstrations in sign languages Donna Jo Napoli, Swarthmore College, [email protected] Corresponding Author Ronice Quadros, Universidade Federal de Santa Catarina, [email protected] Christian Rathmann, Humboldt-Universität zu Berlin, [email protected] 1 Mouth corners in sign languages Alignment mouth demonstrations in sign languages Abstract: Non-manual articulations in sign languages range from being semantically impoverished to semantically rich, and from being independent of manual articulations to coordinated with them. But, while this range has been well noted, certain non-manuals remain understudied. Of particular interest to us are non-manual articulations coordinated with manual articulations, which, when considered in conjunction with those manual articulations, are semantically rich. In which ways can such different articulators coordinate and what is the linguistic effect or purpose of such coordination? Of the non-manual articulators, the mouth is articulatorily the most versatile. We therefore examined mouth articulations in a single narrative told in the sign languages of America, Brazil, and Germany. We observed optional articulations of the corners of the lips that align with manual articulations spatially and temporally in classifier constructions. The lips, thus, enhance the message by giving redundant information, which should be particularly useful in narratives for children. Examination of a single children’s narrative told in these same three sign languages plus six other sign languages yielded examples of one type of these optional alignment articulations, confirming our expectations. Our findings are coherent with linguistic findings regarding phonological enhancement and overspecification. Keywords: sign languages, non-manual articulation, mouth articulation, hand-mouth coordination 2 Mouth corners in sign languages Alignment mouth demonstration articulations in sign languages 1.
    [Show full text]
  • Inventaire Des Aménagements Hydro-Agricoles Existants Et Du Potentiel Amenageable Au Pays Dogon
    INVENTAIRE DES AMÉNAGEMENTS HYDRO-AGRICOLES EXISTANTS ET DU POTENTIEL AMENAGEABLE AU PAYS DOGON Rapport de mission et capitalisation d’expérienCe Financement : Projet d’Appui de l’Irrigation de Proximité (PAIP) Réalisation : cellule SIG DNGR/PASSIP avec la DRGR et les SLGR de la région de Mopti Bamako, avril 2015 Table des matières I. Introduction .................................................................................................................................... 3 II. Méthodologie appliquée ................................................................................................................ 3 III. Inventaire des AHA existants et du potentiel aménageable dans le cercle de Bandiagara .......... 4 1. Déroulement des activités dans le cercle de Bandiagara ................................................................................... 7 2. Bilan de l’inventaire du cercle de Bandiagara .................................................................................................... 9 IV. Inventaire des AHA existants et du potentiel aménageable dans les cercles de Bankass et Koro 9 1. Déroulement des activités dans les deux cercles ............................................................................................... 9 2. Bilan de l’inventaire pour le cercle de Koro et Bankass ................................................................................... 11 Gelöscht: 10 V. Inventaire des AHA existants et du potentiel aménageable dans le cercle de Douentza ............. 12 VI. Récapitulatif de l’inventaire
    [Show full text]
  • CENDEP WP-01-2021 Deaf Refugees Critical Review-Kate Mcauliff
    CENDEP Working Paper Series No 01-2021 Deaf Refugees: A critical review of the current literature Kate McAuliff Centre for Development and Emergency Practice Oxford Brookes University The CENDEP working paper series intends to present work in progress, preliminary research findings of research, reviews of literature and theoretical and methodological reflections relevant to the fields of development and emergency practice. The views expressed in the paper are only those of the independent author who retains the copyright. Comments on the papers are welcome and should be directed to the author. Author: Kate McAuliff Institutional address (of the Author): CENDEP, Oxford Brookes University Author’s email address: [email protected] Doi: https://doi.org/10.24384/cendep.WP-01-2021 Date of publication: April 2021 Centre for Development and Emergency Practice (CENDEP) School of Architecture Oxford Brookes University Oxford [email protected] © 2021 The Author(s). This open access article is distributed under a Creative Commons Attribution- NonCommercial-No Derivative Works (CC BY-NC-ND) 4.0 License. Table of Contents Abstract ............................................................................................................................................................ 4 1. Introduction ........................................................................................................................................... 5 2. Deaf Refugee Agency & Double Displacement .............................................................................
    [Show full text]
  • A Nthropology N Ew Sletter
    Special theme: Languages and Linguistics at an Ethnological Museum National Museum of Language is a window into the human mind and reflects human activities, Ethnology while linguistics is an academic field where languages are analyzed from a scientific view-point. As an ethnological museum, Minpaku has a strong focus Osaka on fieldwork, which is necessary for linguists and ethnologists to study languages and learn about human beings and their diversity. Essays in this Number 39 issue present glimpses of the thoughts of linguists at Minpaku who combine linguistic fieldwork and later analysis at their desks. What is unique to December 2014 researchers at Minpaku, however, is that we are also involved with exhibitions for the public and have everyday communication with Anthropology Newsletter anthropologists in other fields. Languages do not exist without humans and humans do not exist without language. We believe that linguistic research is a good starting point on the path to a better understanding of who we are. MINPAKU Yak and Pig, Glacier and Sea Noboru Yoshioka National Museum of Ethnology Why do many Japanese-language dictionaries contain the word yaku [jakɯ] ‘yak’? When I was in the field, this question all of a sudden struck me. To make sure that my facts were correct, I checked the desktop dictionaries that I was carrying — a pocket-size dictionary published in 1979, a student dictionary published in 1996, and one Contents published in 2008 — and confirmed that all of these actually contained Languages and Linguistics the word as I had thought. Living in at an Ethnological Museum Japan, it is hard to see real yaks.
    [Show full text]
  • Passenger Information Using a Sign Language Avatar Individual Travel Assistance for Passengers with Special Needs in Public Transport
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by Institute of Transport Research:Publications STRATEGIES Travel Assistance Photo: Helmer Photo: Passenger information using a sign language avatar Individual travel assistance for passengers with special needs in public transport Public transport, passenger information, travel assistance, information and communication technology, reduced mobility, accessibility, inclusion Public transport operators are legally obliged to ensure equal access to transportation services. This includes equal access to information and communication related to those services. Deaf passengers mostly prefer to communicate in sign language. For this reason, the specific needs of deaf and hard-of- hearing passengers still are not adequately addressed – despite the tremendous efforts public transport operators have put in providing accessible communication services to their passengers. This article describes a novel approach to passenger information in sign language based on the automatic translation of natural (written) language text into sign language. This includes the use of a sign language avatar to display the information to deaf and hard-of-hearing passengers. Authors: Lars Schnieder, Georg Tschare ublic transport operators provide nature and causes of disruptions [2]. The tion on the Rights of Persons with Disabili- real-time passenger information passenger information system may be used ties oblige all ratifying countries to ensure via electronic information systems both physically within a transportation hub that persons with disabilities have the in order to keep passengers up to as well as remotely via mobile devices used opportunity to live independently and par- Pdate about the current status of the public by the passengers.
    [Show full text]
  • “Danish Sign Language [Dsl] (A Language of Denmark)
    “Danish Sign Language [dsl] (A language of Denmark) • Alternate Names: Dansk tegnsprog, DTS • Population: 5,000 in Denmark (2007). 24,500 (2014 IMB). • Location: Scattered. • Language Status: 5 (Developing). Recognized language (2015, Law 61, amendment to Danish Language Council). • Dialects: None known. Faroe Islands, Greenland (2014 J. Zachariassen; Aldersson and McEntee-Atalianis 2007). Some signs are related to French Sign Language [fsl]. Intelligible with Swedish [swl] and Norwegian [nsl] sign languages with only moderate difficulty. Not intelligible with Finnish Sign Language [fse]. Signed Danish is distinct, but used in communication with some hearing people. • Typology: One-handed fingerspelling. • Language Use: First deaf school began in 1807. Used in all 6 state primary schools for the deaf. Interpreters are required in court, and may be used at important public events, in job training, social services, and mental health programs. • Language Development: Films. TV. Videos. Dictionary. Grammar. Bible portions: 2013. • Other Comments: Fingerspelling system similar to French Sign Language [fsl]. Organization for sign language teachers. Instruction provided for parents of deaf children and other hearing people. Christian (Protestant).” Lewis, M. Paul, Gary F. Simons, and Charles D. Fennig (eds.) 2015. Ethnologue: Languages of the World, Eighteenth edition. Dallas, Texas: SIL International. Online version: http://www.ethnologue.com. Related Readings Aldersson, Russell, and Lisa McEntee-Atalianis 2008 A Lexical Comparison of Signs from Icelandic and Danish Sign Languages. Sign Language Studies 9(1): 45-87. Engberg-Pedersen, Elisabeth 2010 Expressions of Causation in Danish Sign Language. Sign Language & Linguistics 13(1): 40-67. Last Updated: April 13, 2015 .
    [Show full text]