DOCSLIB.ORG

C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 | Origene OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA333700 C1orf149 (MEAF6) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: WB, IHC Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-FLJ11730 Antibody: synthetic peptide directed towards the N terminal of human FLJ11730. Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 23 kDa Gene Name: MYST/Esa1 associated factor 6 Database Link: NP_073593 Entrez Gene 64769 Human Q9HAF1 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 Background: The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them. Synonyms: C1orf149; CENP-28; EAF6; NY-SAR-91 Note: Immunogen sequence homology: Bovine:100%; Western clawed frog:100%; Chicken:100%; African clawed frog:100%; Green puffer:100%; Zebra finch:100%; Mouse:100%; Human:100%; Rat:100%; Zebrafish:92%; Atlantic salmon:92%; Rainbow smelt:85%; Filarial nematode wor Product images: WB Suggested Anti-FLJ11730 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Jurkat cell lysateMEAF6 is supported by BioGPS gene expression data to be expressed in Jurkat This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 Human kidney This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Open Data for Differential Network Analysis in Glioma
    International Journal of Molecular Sciences Article Open Data for Differential Network Analysis in Glioma , Claire Jean-Quartier * y , Fleur Jeanquartier y and Andreas Holzinger Holzinger Group HCI-KDD, Institute for Medical Informatics, Statistics and Documentation, Medical University Graz, Auenbruggerplatz 2/V, 8036 Graz, Austria; [email protected] (F.J.); [email protected] (A.H.) * Correspondence: [email protected] These authors contributed equally to this work. y Received: 27 October 2019; Accepted: 3 January 2020; Published: 15 January 2020 Abstract: The complexity of cancer diseases demands bioinformatic techniques and translational research based on big data and personalized medicine. Open data enables researchers to accelerate cancer studies, save resources and foster collaboration. Several tools and programming approaches are available for analyzing data, including annotation, clustering, comparison and extrapolation, merging, enrichment, functional association and statistics. We exploit openly available data via cancer gene expression analysis, we apply refinement as well as enrichment analysis via gene ontology and conclude with graph-based visualization of involved protein interaction networks as a basis for signaling. The different databases allowed for the construction of huge networks or specified ones consisting of high-confidence interactions only. Several genes associated to glioma were isolated via a network analysis from top hub nodes as well as from an outlier analysis. The latter approach highlights a mitogen-activated protein kinase next to a member of histondeacetylases and a protein phosphatase as genes uncommonly associated with glioma. Cluster analysis from top hub nodes lists several identified glioma-associated gene products to function within protein complexes, including epidermal growth factors as well as cell cycle proteins or RAS proto-oncogenes.
    [Show full text]
  • WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
    [Show full text]
  • Pathway-Guided Analysis Identifies Myc-Dependent Alternative Pre-Mrna Splicing in Aggressive Prostate Cancers
    Pathway-guided analysis identifies Myc-dependent alternative pre-mRNA splicing in aggressive prostate cancers John W. Phillipsa,1, Yang Panb,1, Brandon L. Tsaia, Zhijie Xiea, Levon Demirdjianc, Wen Xiaoa, Harry T. Yangb, Yida Zhangb, Chia Ho Lina, Donghui Chenga, Qiang Hud, Song Liud, Douglas L. Blacka, Owen N. Wittea,e,f,g,h,2, and Yi Xinga,b,c,i,2 aDepartment of Microbiology, Immunology and Molecular Genetics, University of California, Los Angeles, CA 90095; bBioinformatics Interdepartmental Graduate Program, University of California, Los Angeles, CA 90095; cCenter for Computational and Genomic Medicine, The Children’s Hospital of Philadelphia, Philadelphia, PA 19104; dDepartment of Biostatistics and Bioinformatics, Roswell Park Comprehensive Cancer Center, Buffalo, NY 14263; eDepartment of Molecular and Medical Pharmacology, University of California, Los Angeles, CA 90095; fMolecular Biology Institute, University of California, Los Angeles, CA 90095; gJonsson Comprehensive Cancer Center, University of California, Los Angeles, CA 90095; hEli and Edythe Broad Center of Regenerative Medicine and Stem Cell Research, University of California, Los Angeles, CA 90095; and iDepartment of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, PA 19104 Contributed by Owen N. Witte, January 2, 2020 (sent for review September 16, 2019; reviewed by Colin C. Collins and Han Liang) We sought to define the landscape of alternative pre-mRNA splicing treatment-related neuroendocrine prostate cancer (NEPC) has in prostate cancers and the relationship of exon choice to known been aided by large-scale genomic and transcriptomic studies of cancer driver alterations. To do so, we compiled a metadataset patient samples representing each form of the disease (10–13).
    [Show full text]
  • Downloaded Per Proteome Cohort Via the Web- Site Links of Table 1, Also Providing Information on the Deposited Spectral Datasets
    www.nature.com/scientificreports OPEN Assessment of a complete and classifed platelet proteome from genome‑wide transcripts of human platelets and megakaryocytes covering platelet functions Jingnan Huang1,2*, Frauke Swieringa1,2,9, Fiorella A. Solari2,9, Isabella Provenzale1, Luigi Grassi3, Ilaria De Simone1, Constance C. F. M. J. Baaten1,4, Rachel Cavill5, Albert Sickmann2,6,7,9, Mattia Frontini3,8,9 & Johan W. M. Heemskerk1,9* Novel platelet and megakaryocyte transcriptome analysis allows prediction of the full or theoretical proteome of a representative human platelet. Here, we integrated the established platelet proteomes from six cohorts of healthy subjects, encompassing 5.2 k proteins, with two novel genome‑wide transcriptomes (57.8 k mRNAs). For 14.8 k protein‑coding transcripts, we assigned the proteins to 21 UniProt‑based classes, based on their preferential intracellular localization and presumed function. This classifed transcriptome‑proteome profle of platelets revealed: (i) Absence of 37.2 k genome‑ wide transcripts. (ii) High quantitative similarity of platelet and megakaryocyte transcriptomes (R = 0.75) for 14.8 k protein‑coding genes, but not for 3.8 k RNA genes or 1.9 k pseudogenes (R = 0.43–0.54), suggesting redistribution of mRNAs upon platelet shedding from megakaryocytes. (iii) Copy numbers of 3.5 k proteins that were restricted in size by the corresponding transcript levels (iv) Near complete coverage of identifed proteins in the relevant transcriptome (log2fpkm > 0.20) except for plasma‑derived secretory proteins, pointing to adhesion and uptake of such proteins. (v) Underrepresentation in the identifed proteome of nuclear‑related, membrane and signaling proteins, as well proteins with low‑level transcripts.
    [Show full text]
  • Variation in Protein Coding Genes Identifies Information Flow
    bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 1 1 2 3 4 5 Variation in protein coding genes identifies information flow as a contributor to 6 animal complexity 7 8 Jack Dean, Daniela Lopes Cardoso and Colin Sharpe* 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 Institute of Biological and Biomedical Sciences 25 School of Biological Science 26 University of Portsmouth, 27 Portsmouth, UK 28 PO16 7YH 29 30 * Author for correspondence 31 [email protected] 32 33 Orcid numbers: 34 DLC: 0000-0003-2683-1745 35 CS: 0000-0002-5022-0840 36 37 38 39 40 41 42 43 44 45 46 47 48 49 Abstract bioRxiv preprint doi: https://doi.org/10.1101/679456; this version posted June 21, 2019. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Animal complexity and information flow 2 1 Across the metazoans there is a trend towards greater organismal complexity. How 2 complexity is generated, however, is uncertain. Since C.elegans and humans have 3 approximately the same number of genes, the explanation will depend on how genes are 4 used, rather than their absolute number.
    [Show full text]
  • CCNB3 Fusions Are Frequent in Undifferentiated Sarcomas of Male
    Modern Pathology (2015) 28, 575–586 & 2015 USCAP, Inc. All rights reserved 0893-3952/15 $32.00 575 BCOR–CCNB3 fusions are frequent in undifferentiated sarcomas of male children Tricia L Peters1,2,9, Vijetha Kumar1,2,9, Sumanth Polikepahad1,2, Frank Y Lin3,4, Stephen F Sarabia1,2, Yu Liang5, Wei-Lien Wang5, Alexander J Lazar5,6, HarshaVardhan Doddapaneni7, Hsu Chao7, Donna M Muzny7, David A Wheeler4,7,8, M Fatih Okcu3, Sharon E Plon3,4,7,8, M John Hicks1,2,3,4, Dolores Lo´pez-Terrada1,2,3,4, D Williams Parsons3,4,7,8 and Angshumoy Roy1,2,3,4 1Department of Pathology, Texas Children’s Hospital, Houston, TX, USA; 2Department of Pathology & Immunology, Baylor College of Medicine, Houston, TX, USA; 3Department of Pediatrics, Baylor College of Medicine, Houston, TX, USA; 4Dan L. Duncan Cancer Center, Baylor College of Medicine, Houston, TX, USA; 5Department of Pathology, University of Texas MD Anderson Cancer Center, Houston, TX, USA; 6Sarcoma Research Center, University of Texas MD Anderson Cancer Center, Houston, TX, USA; 7Human Genome Sequencing Center, Baylor College of Medicine, Houston, TX, USA and 8Department of Molecular and Human Genetics, Baylor College of Medicine, Houston, TX, USA The BCOR–CCNB3 fusion gene, resulting from a chromosome X paracentric inversion, was recently described in translocation-negative ‘Ewing-like’ sarcomas arising in bone and soft tissue. Genetic subclassification of undifferentiated unclassified sarcomas may potentially offer markers for reproducible diagnosis and substrates for therapy. Using whole transcriptome paired-end RNA sequencing (RNA-seq) we unexpectedly identified BCOR–CCNB3 fusion transcripts in an undifferentiated spindle-cell sarcoma.
    [Show full text]
  • Identification of an EPC2-PHF1 Fusion Transcript in Low-Grade Endometrial Stromal Sarcoma
    www.oncotarget.com Oncotarget, 2018, Vol. 9, (No. 27), pp: 19203-19208 Research Paper Identification of an EPC2-PHF1 fusion transcript in low-grade endometrial stromal sarcoma Marta Brunetti1, Ludmila Gorunova1, Ben Davidson2,3, Sverre Heim1,3, Ioannis Panagopoulos1 and Francesca Micci1 1Section for Cancer Cytogenetics, Institute for Cancer Genetics and Informatics, The Norwegian Radium Hospital, Oslo University Hospital, Oslo, Norway 2Department of Pathology, The Norwegian Radium Hospital, Oslo University Hospital, Oslo, Norway 3Institute of Clinical Medicine, Faculty of Medicine, University of Oslo, Oslo, Norway Correspondence to: Francesca Micci, email: [email protected] Keywords: fusion gene; EPC2; PHF1; RNA sequencing; low-grade endometrial stromal sarcoma Received: February 13, 2018 Accepted: March 16, 2018 Published: April 10, 2018 Copyright: Brunetti et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License 3.0 (CC BY 3.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT Recurrent chromosomal translocations leading to gene fusion formation have been described in uterine sarcomas, including low-grade endometrial stromal sarcoma (LG-ESS). Involvement of the PHF1 gene in chromosomal rearrangements targeting band 6p21 has been found in LG-ESS with different partners from JAZF1 mapping in 7p15, to EPC1 from 10p11, MEAF6 from 1p34, and BRD8 from 5q31. In the present study, RNA sequencing of a LG-ESS showed a novel recombination of PHF1 with the Enhancer of Polycomb homolog 2 (EPC2). RT-PCR followed by Sanger sequencing and FISH analysis confirmed the EPC2-PHF1 fusion transcript.
    [Show full text]
  • Fusion Genes in Gynecologic Tumors: the Occurrence, Molecular Mechanism and Prospect for Therapy ✉ Bingfeng Lu1, Ruqi Jiang1, Bumin Xie1,Wuwu1 and Yang Zhao 1
    www.nature.com/cddis REVIEW ARTICLE OPEN Fusion genes in gynecologic tumors: the occurrence, molecular mechanism and prospect for therapy ✉ Bingfeng Lu1, Ruqi Jiang1, Bumin Xie1,WuWu1 and Yang Zhao 1 © The Author(s) 2021 Gene fusions are thought to be driver mutations in multiple cancers and are an important factor for poor patient prognosis. Most of them appear in specific cancers, thus satisfactory strategies can be developed for the precise treatment of these types of cancer. Currently, there are few targeted drugs to treat gynecologic tumors, and patients with gynecologic cancer often have a poor prognosis because of tumor progression or recurrence. With the application of massively parallel sequencing, a large number of fusion genes have been discovered in gynecologic tumors, and some fusions have been confirmed to be involved in the biological process of tumor progression. To this end, the present article reviews the current research status of all confirmed fusion genes in gynecologic tumors, including their rearrangement mechanism and frequency in ovarian cancer, endometrial cancer, endometrial stromal sarcoma, and other types of uterine tumors. We also describe the mechanisms by which fusion genes are generated and their oncogenic mechanism. Finally, we discuss the prospect of fusion genes as therapeutic targets in gynecologic tumors. Cell Death and Disease (2021) 12:783 ; https://doi.org/10.1038/s41419-021-04065-0 FACTS Generally, at the genome level, the fusion gene may be expressed; however, if the promoter region or other important elements are destroyed, it may not be expressed. In 1973, researchers first ● fi Fusion genes are cancer-speci c and considered to be the discovered the rearrangement of chromosomes 9 and 22 in driving events of cancer.
    [Show full text]
  • Detection of H3k4me3 Identifies Neurohiv Signatures, Genomic
    viruses Article Detection of H3K4me3 Identifies NeuroHIV Signatures, Genomic Effects of Methamphetamine and Addiction Pathways in Postmortem HIV+ Brain Specimens that Are Not Amenable to Transcriptome Analysis Liana Basova 1, Alexander Lindsey 1, Anne Marie McGovern 1, Ronald J. Ellis 2 and Maria Cecilia Garibaldi Marcondes 1,* 1 San Diego Biomedical Research Institute, San Diego, CA 92121, USA; [email protected] (L.B.); [email protected] (A.L.); [email protected] (A.M.M.) 2 Departments of Neurosciences and Psychiatry, University of California San Diego, San Diego, CA 92103, USA; [email protected] * Correspondence: [email protected] Abstract: Human postmortem specimens are extremely valuable resources for investigating trans- lational hypotheses. Tissue repositories collect clinically assessed specimens from people with and without HIV, including age, viral load, treatments, substance use patterns and cognitive functions. One challenge is the limited number of specimens suitable for transcriptional studies, mainly due to poor RNA quality resulting from long postmortem intervals. We hypothesized that epigenomic Citation: Basova, L.; Lindsey, A.; signatures would be more stable than RNA for assessing global changes associated with outcomes McGovern, A.M.; Ellis, R.J.; of interest. We found that H3K27Ac or RNA Polymerase (Pol) were not consistently detected by Marcondes, M.C.G. Detection of H3K4me3 Identifies NeuroHIV Chromatin Immunoprecipitation (ChIP), while the enhancer H3K4me3 histone modification was Signatures, Genomic Effects of abundant and stable up to the 72 h postmortem. We tested our ability to use H3K4me3 in human Methamphetamine and Addiction prefrontal cortex from HIV+ individuals meeting criteria for methamphetamine use disorder or not Pathways in Postmortem HIV+ Brain (Meth +/−) which exhibited poor RNA quality and were not suitable for transcriptional profiling.
    [Show full text]
  • WO 2016/141169 Al 9 September 2016 (09.09.2016) P O P C T
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2016/141169 Al 9 September 2016 (09.09.2016) P O P C T (51) International Patent Classification: (74) Agent: AKHAVAN, Ramin; Caris MPI, Inc., 6655 N. A61K 31/335 (2006.01) G01N 33/50 (2006.01) MacArthur Blvd., Irving, TX 75039 (US). A61K 39/395 (2006.01) G01N 33/53 (2006.01) (81) Designated States (unless otherwise indicated, for every C12Q 1/68 (2006.01) G01N 33/00 (2006.01) kind of national protection available): AE, AG, AL, AM, C40B 30/04 (2006.01) AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (21) International Application Number: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, PCT/US2016/020657 DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IR, IS, JP, KE, KG, KN, KP, KR, (22) International Filing Date: KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, MG, 3 March 2016 (03.03.2016) MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, OM, (25) Filing Language: English PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, (26) Publication Language: English TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (30) Priority Data: (84) Designated States (unless otherwise indicated, for every 62/127,769 3 March 2015 (03.03.2015) kind of regional protection available): ARIPO (BW, GH, 62/167,659 28 May 2015 (28.05.2015) GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, (71) Applicant: CARIS MPI, INC.
    [Show full text]
  • Pathway-Guided Analysis Identifies Myc-Dependent Alternative Pre-Mrna Splicing in Aggressive Prostate Cancers
    Pathway-guided analysis identifies Myc-dependent alternative pre-mRNA splicing in aggressive prostate cancers John W. Phillipsa,1, Yang Panb,1, Brandon L. Tsaia, Zhijie Xiea, Levon Demirdjianc, Wen Xiaoa, Harry T. Yangb, Yida Zhangb, Chia Ho Lina, Donghui Chenga, Qiang Hud, Song Liud, Douglas L. Blacka, Owen N. Wittea,e,f,g,h,2, and Yi Xinga,b,c,i,2 aDepartment of Microbiology, Immunology and Molecular Genetics, University of California, Los Angeles, CA 90095; bBioinformatics Interdepartmental Graduate Program, University of California, Los Angeles, CA 90095; cCenter for Computational and Genomic Medicine, The Children’s Hospital of Philadelphia, Philadelphia, PA 19104; dDepartment of Biostatistics and Bioinformatics, Roswell Park Comprehensive Cancer Center, Buffalo, NY 14263; eDepartment of Molecular and Medical Pharmacology, University of California, Los Angeles, CA 90095; fMolecular Biology Institute, University of California, Los Angeles, CA 90095; gJonsson Comprehensive Cancer Center, University of California, Los Angeles, CA 90095; hEli and Edythe Broad Center of Regenerative Medicine and Stem Cell Research, University of California, Los Angeles, CA 90095; and iDepartment of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, PA 19104 Contributed by Owen N. Witte, January 2, 2020 (sent for review September 16, 2019; reviewed by Colin C. Collins and Han Liang) We sought to define the landscape of alternative pre-mRNA splicing treatment-related neuroendocrine prostate cancer (NEPC) has in prostate cancers and the relationship of exon choice to known been aided by large-scale genomic and transcriptomic studies of cancer driver alterations. To do so, we compiled a metadataset patient samples representing each form of the disease (10–13).
    [Show full text]