Number 11 November 2014

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Volume 18 - Number 11 November 2014 The PDF version of the Atlas of Genetics and Cytogenetics in Oncology and Haematology is a reissue of the original articles published in collaboration with the Institute for Scientific and Technical Information (INstitut de l’Information Scientifique et Technique - INIST) of the French National Center for Scientific Research (CNRS) on its electronic publishing platform I-Revues. Online and PDF versions of the Atlas of Genetics and Cytogenetics in Oncology and Haematology are hosted by INIST-CNRS. Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Scope The Atlas of Genetics and Cytogenetics in Oncology and Haematology is a peer reviewed on-line journal in open access, devoted to genes, cytogenetics, and clinical entities in cancer, and cancer-prone diseases. It presents structured review articles (“cards”) on genes, leukaemias, solid tumours, cancer-prone diseases, and also more traditional review articles (“deep insights”) on the above subjects and on surrounding topics. It also present case reports in hematology and educational items in the various related topics for students in Medicine and in Sciences. Editorial correspondance Jean-Loup Huret Genetics, Department of Medical Information, University Hospital F-86021 Poitiers, France tel +33 5 49 44 45 46 or +33 5 49 45 47 67 [email protected] or [email protected] Staff Mohammad Ahmad, Mélanie Arsaban, Marie-Christine Jacquemot-Perbal, Vanessa Le Berre, Anne Malo, Carol Moreau, Catherine Morel-Pair, Laurent Rassinoux, Alain Zasadzinski. Philippe Dessen is the Database Director (Gustave Roussy Institute – Villejuif – France). The Atlas of Genetics and Cytogenetics in Oncology and Haematology (ISSN 1768-3262) is published 12 times a year by ARMGHM, a non profit organisation, and by the INstitute for Scientific and Technical Information of the French National Center for Scientific Research (INIST-CNRS) since 2008. The Atlas is hosted by INIST-CNRS (http://www.inist.fr) http://AtlasGeneticsOncology.org © ATLAS - ISSN 1768-3262 The PDF version of the Atlas of Genetics and Cytogenetics in Oncology and Haematology is a reissue of the original articles published in collaboration with the Institute for Scientific and Technical Information (INstitut de l’Information Scientifique et Technique - INIST) of the French National Center for Scientific Research (CNRS) on its electronic publishing platform I-Revues. Online and PDF versions of the Atlas of Genetics and Cytogenetics in Oncology and Haematology are hosted by INIST-CNRS. Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Editor Jean-Loup Huret (Poitiers, France) Editorial Board Sreeparna Banerjee (Ankara, Turkey) Solid Tumours Section Alessandro Beghini (Milan, Italy) Genes Section Anne von Bergh (Rotterdam, The Netherlands) Genes / Leukaemia Sections Judith Bovée (Leiden, The Netherlands) Solid Tumours Section Vasantha Brito-Babapulle (London, UK) Leukaemia Section Charles Buys (Groningen, The Netherlands) Deep Insights Section Anne Marie Capodano (Marseille, France) Solid Tumours Section Fei Chen (Morgantown, West Virginia) Genes / Deep Insights Sections Antonio Cuneo (Ferrara, Italy) Leukaemia Section Paola Dal Cin (Boston, Massachussetts) Genes / Solid Tumours Section Brigitte Debuire (Villejuif, France) Deep Insights Section François Desangles (Paris, France) Leukaemia / Solid Tumours Sections Enric Domingo-Villanueva (London, UK) Solid Tumours Section Ayse Erson (Ankara, Turkey) Solid Tumours Section Richard Gatti (Los Angeles, California) Cancer-Prone Diseases / Deep Insights Sections Ad Geurts van Kessel (Nijmegen, The Netherlands) Cancer-Prone Diseases Section Oskar Haas (Vienna, Austria) Genes / Leukaemia Sections Anne Hagemeijer (Leuven, Belgium) Deep Insights Section Nyla Heerema (Colombus, Ohio) Leukaemia Section Jim Heighway (Liverpool, UK) Genes / Deep Insights Sections Sakari Knuutila (Helsinki, Finland) Deep Insights Section Lidia Larizza (Milano, Italy) Solid Tumours Section Lisa Lee-Jones (Newcastle, UK) Solid Tumours Section Edmond Ma (Hong Kong, China) Leukaemia Section Roderick McLeod (Braunschweig, Germany) Deep Insights / Education Sections Cristina Mecucci (Perugia, Italy) Genes / Leukaemia Sections Fredrik Mertens (Lund, Sweden) Solid Tumours Section Konstantin Miller (Hannover, Germany) Education Section Felix Mitelman (Lund, Sweden) Deep Insights Section Hossain Mossafa (Cergy Pontoise, France) Leukaemia Section Stefan Nagel (Braunschweig, Germany) Deep Insights / Education Sections Florence Pedeutour (Nice, France) Genes / Solid Tumours Sections Elizabeth Petty (Ann Harbor, Michigan) Deep Insights Section Susana Raimondi (Memphis, Tennesse) Genes / Leukaemia Section Mariano Rocchi (Bari, Italy) Genes Section Alain Sarasin (Villejuif, France) Cancer-Prone Diseases Section Albert Schinzel (Schwerzenbach, Switzerland) Education Section Clelia Storlazzi (Bari, Italy) Genes Section Sabine Strehl (Vienna, Austria) Genes / Leukaemia Sections Nancy Uhrhammer (Clermont Ferrand, France) Genes / Cancer-Prone Diseases Sections Dan Van Dyke (Rochester, Minnesota) Education Section Roberta Vanni (Montserrato, Italy) Solid Tumours Section Franck Viguié (Paris, France) Leukaemia Section José Luis Vizmanos (Pamplona, Spain) Leukaemia Section Thomas Wan (Hong Kong, China) Genes / Leukaemia Sections Adriana Zamecnikova (Kuwait) Leukaemia Section Atlas Genet Cytogenet Oncol Haematol. 2014; 18(11) Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Volume 18, Number 11, November 2014 Table of contents Gene Section ACVRL1 (activin A receptor type II-like 1) 789 Federica Ornati, Luca Vecchia, Claudia Scotti, Sara Plumitallo, Carla Olivieri CTDSPL (CTD (Carboxy-Terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase- Like) 797 Shreya Sarkar, Guru Prasad Maiti, Chinmay Kumar Panda DLX2 (distal-less homeobox 2) 805 Yorick Gitton, Giovanni Levi DLX5 (distal-less homeobox 5) 810 Yorick Gitton, Giovanni Levi DLX6 (distal-less homeobox 6) 817 Yorick Gitton, Giovanni Levi EDIL3 (EGF-Like Repeats And Discoidin I-Like Domains 3) 824 Hisataka Kitano, Chiaki Hidai HELLS (Helicase, Lymphoid-Specific) 829 Kathrin Muegge, Theresa Geiman NUAK1 (NUAK family, SNF1-like kinase, 1) 834 Fumika Inazuka, Hiroyasu Esumi PFKFB2 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2) 838 Ana Rodríguez-García, Pere Fontova, Helga Simon, Anna Manzano, Ramon Bartrons, Àurea Navarro-Sabaté WWTR1 (WW domain containing transcription regulator 1) 849 Yulei Zhao, Xiaolong Yang Leukaemia Section t(5;11)(q35;q12) NSD1/FEN1 853 Nathalie Douet-Guilbert, Etienne De Braekeleer, Corinne Tous, Nadia Guéganic, Audrey Basinko, Marie-Josée Le Bris, Frédéric Morel, Marc De Braekeleer t(7;9)(q11;p12) PAX5/POM121 856 Jean-Loup Huret t(9;12)(q34;p13) ETV6/ABL1 859 Etienne De Braekeleer, Nathalie Douet-Guilbert, Marc De Braekeleer t(9;22)(p13;q13) PAX5/BRD1 862 Jean-Loup Huret Atlas Genet Cytogenet Oncol Haematol. 2014; 18(11) Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Deep Insight Section Class III beta-tubulin, drug resistance and therapeutic approaches in cancers 865 Roshan Karki, Cristiano Ferlini Atlas Genet Cytogenet Oncol Haematol. 2014; 18(11) Atlas of Genetics and Cytogenetics in Oncology and Haematology OPEN ACCESS JOURNAL INIST -CNRS Atlas Genet Cytogenet Oncol Haematol. 2014; 18(11) Atlas of Genetics and Cytogenetics in Oncology and Haematology INIST -CNRS OPEN ACCESS JOURNAL Gene Section Review ACVRL1 (activin A receptor type II-like 1) Federica Ornati, Luca Vecchia, Claudia Scotti, Sara Plumitallo, Carla Olivieri Dept of Molecular Medicine, Unit of General Biology and Medical Genetics, University of Pavia, Italy (FO, SP, CO), Dept of Molecular Medicine, Unit of Immunology and General Pathology, University of Pavia, Italy (LV, CS) Published in Atlas Database: March 2014 Online updated version : http://AtlasGeneticsOncology.org/Genes/ACVRL1ID569ch12q13.html DOI: 10.4267/2042/54160 This work is licensed under a Creative Commons Attribution-Noncommercial-No Derivative Works 2.0 France Licence. © 2014 Atlas of Genetics and Cytogenetics in Oncology and Haematology Abstract Transcription Gene database underlines the presence of two Activin A receptor, type II-like kinase 1 (ALK1 is a different ACVRL1 transcripts, which both translate serine-threonine kinase) predominantly expressed into the same protein isoform. The second transcript on endothelial cells surface. Mutations in its variant is the shortest one and differs from the first ACVRL1 encoding gene (12q11-14) cause type 2 one in the 5'UTR region, due to the presence of an Hereditary Haemorrhagic Telangiectasia (HHT2), upstream in-frame start codon, poorly conserved in an autosomal dominant multisystem vascular the population. Nevertheless, in 2010 two new dysplasia. Its involvement in cancer transcripts were discovered in HUVEC cells. These neoangiogenesis has lead to the recent development new variants, called mRNA3 and mRNA4, begin of novel anti-cancer drugs, which are now in the transcription +1 nucleotide upstream , clinical trials. respectively at -510 and -470 positions, adding a cryptic non translated exon, that doesn't affect the Identity protein ORF (Garrido-Martin et al., 2010). Other names: ACVRLK1, ALK-1, ALK1, HHT, The promoter region
Recommended publications
  • Bioinformatic Analysis of Structure and Function of LIM Domains of Human Zyxin Family Proteins

    Bioinformatic Analysis of Structure and Function of LIM Domains of Human Zyxin Family Proteins

    International Journal of Molecular Sciences Article Bioinformatic Analysis of Structure and Function of LIM Domains of Human Zyxin Family Proteins M. Quadir Siddiqui 1,† , Maulik D. Badmalia 1,† and Trushar R. Patel 1,2,3,* 1 Alberta RNA Research and Training Institute, Department of Chemistry and Biochemistry, University of Lethbridge, 4401 University Drive, Lethbridge, AB T1K 3M4, Canada; [email protected] (M.Q.S.); [email protected] (M.D.B.) 2 Department of Microbiology, Immunology and Infectious Disease, Cumming School of Medicine, University of Calgary, 3330 Hospital Drive, Calgary, AB T2N 4N1, Canada 3 Li Ka Shing Institute of Virology, University of Alberta, Edmonton, AB T6G 2E1, Canada * Correspondence: [email protected] † These authors contributed equally to the work. Abstract: Members of the human Zyxin family are LIM domain-containing proteins that perform critical cellular functions and are indispensable for cellular integrity. Despite their importance, not much is known about their structure, functions, interactions and dynamics. To provide insights into these, we used a set of in-silico tools and databases and analyzed their amino acid sequence, phylogeny, post-translational modifications, structure-dynamics, molecular interactions, and func- tions. Our analysis revealed that zyxin members are ohnologs. Presence of a conserved nuclear export signal composed of LxxLxL/LxxxLxL consensus sequence, as well as a possible nuclear localization signal, suggesting that Zyxin family members may have nuclear and cytoplasmic roles. The molecular modeling and structural analysis indicated that Zyxin family LIM domains share Citation: Siddiqui, M.Q.; Badmalia, similarities with transcriptional regulators and have positively charged electrostatic patches, which M.D.; Patel, T.R.
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Molecular Signature Induced by RNASET2, a Tumor Antagonizing Gene, in Ovarian Cancer Cells

    Molecular Signature Induced by RNASET2, a Tumor Antagonizing Gene, in Ovarian Cancer Cells

    www.impactjournals.com/oncotarget/ Oncotarget, June, Vol.2, No 6 Molecular signature induced by RNASET2, a tumor antagonizing gene, in ovarian cancer cells Francesco Acquati1, Laura Monti1, Marta Lualdi1, Marco Fabbri2, Maria Grazia Sacco2, Laura Gribaldo2, and Roberto Taramelli1 1 Dipartimento di Biotecnologie e Scienze Molecolari, Università degli Studi dell’Insubria, via JH Dunant 3, 21100 Varese, Italy 2 European Commission - Joint Research Centre Institute for Health and Consumer Protection Molecular Biology and Genomics unit TP 464, Via E. Fermi, 2749 21027 Ispra (VA) - Italy Correspondence to: Roberto Taramelli, email: [email protected] Correspondence to: Francesco Acquati, email: [email protected] Keywords: RNases, cancer microenvironment, transcriptional profile Received: May 10, 2011, Accepted: June 2, 2011, Published: June 4, 2011 Copyright: © Acquati et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited. ABSTRACT: Using the Hey3Met2 human ovarian cancer cell line, we previously found the RNASET2 gene to possess a remarkable in vivo tumor suppressor activity, although no in vitro features such as inhibition of cell proliferation, clonogenic potential, impaired growth in soft agar and increase in apoptotic rate could be detected. This is reminiscent of the behavior of genes belonging to the class of tumor antagonizing genes (TAG) which act mainly within the context of the microenvironment. Here we present transcriptional profiles analysis which indicates that investigations of the mechanisms of TAG biological functions require a comparison between the in vitro and in vivo expression patterns.
  • C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 | Origene

    C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 | Origene

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA333700 C1orf149 (MEAF6) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: IHC, WB Recommended Dilution: WB, IHC Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for Anti-FLJ11730 Antibody: synthetic peptide directed towards the N terminal of human FLJ11730. Synthetic peptide located within the following region: HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Affinity Purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 23 kDa Gene Name: MYST/Esa1 associated factor 6 Database Link: NP_073593 Entrez Gene 64769 Human Q9HAF1 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 C1orf149 (MEAF6) Rabbit Polyclonal Antibody – TA333700 Background: The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognized by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients.
  • Open Data for Differential Network Analysis in Glioma

    Open Data for Differential Network Analysis in Glioma

    International Journal of Molecular Sciences Article Open Data for Differential Network Analysis in Glioma , Claire Jean-Quartier * y , Fleur Jeanquartier y and Andreas Holzinger Holzinger Group HCI-KDD, Institute for Medical Informatics, Statistics and Documentation, Medical University Graz, Auenbruggerplatz 2/V, 8036 Graz, Austria; [email protected] (F.J.); [email protected] (A.H.) * Correspondence: [email protected] These authors contributed equally to this work. y Received: 27 October 2019; Accepted: 3 January 2020; Published: 15 January 2020 Abstract: The complexity of cancer diseases demands bioinformatic techniques and translational research based on big data and personalized medicine. Open data enables researchers to accelerate cancer studies, save resources and foster collaboration. Several tools and programming approaches are available for analyzing data, including annotation, clustering, comparison and extrapolation, merging, enrichment, functional association and statistics. We exploit openly available data via cancer gene expression analysis, we apply refinement as well as enrichment analysis via gene ontology and conclude with graph-based visualization of involved protein interaction networks as a basis for signaling. The different databases allowed for the construction of huge networks or specified ones consisting of high-confidence interactions only. Several genes associated to glioma were isolated via a network analysis from top hub nodes as well as from an outlier analysis. The latter approach highlights a mitogen-activated protein kinase next to a member of histondeacetylases and a protein phosphatase as genes uncommonly associated with glioma. Cluster analysis from top hub nodes lists several identified glioma-associated gene products to function within protein complexes, including epidermal growth factors as well as cell cycle proteins or RAS proto-oncogenes.
  • WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T

    WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T

    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2012/174282 A2 20 December 2012 (20.12.2012) P O P C T (51) International Patent Classification: David [US/US]; 13539 N . 95th Way, Scottsdale, AZ C12Q 1/68 (2006.01) 85260 (US). (21) International Application Number: (74) Agent: AKHAVAN, Ramin; Caris Science, Inc., 6655 N . PCT/US20 12/0425 19 Macarthur Blvd., Irving, TX 75039 (US). (22) International Filing Date: (81) Designated States (unless otherwise indicated, for every 14 June 2012 (14.06.2012) kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BR, BW, BY, BZ, English (25) Filing Language: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, DO, Publication Language: English DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, KR, (30) Priority Data: KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, 61/497,895 16 June 201 1 (16.06.201 1) US MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, 61/499,138 20 June 201 1 (20.06.201 1) US OM, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SC, SD, 61/501,680 27 June 201 1 (27.06.201 1) u s SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, TR, 61/506,019 8 July 201 1(08.07.201 1) u s TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW.
  • The Chromosome 3P21.3-Encoded Gene, LIMD1, Is a Critical Tumor Suppressor Involved in Human Lung Cancer Development

    The Chromosome 3P21.3-Encoded Gene, LIMD1, Is a Critical Tumor Suppressor Involved in Human Lung Cancer Development

    The chromosome 3p21.3-encoded gene, LIMD1, is a critical tumor suppressor involved in human lung cancer development Tyson V. Sharpa, Ahmad Al-Attarb,1, Daniel E. Foxlera,1, Li Dingc, Thomas Q. de A. Vallima, Yining Zhanga, Hala S. Nijmeha, Thomas M. Webba, Andrew G. Nicholsond, Qunyuan Zhange, Aldi Krajae, Ian Spendloveb, John Osbornec, Elaine Mardisc,e, and Gregory D. Longmoref,2 aSchool of Biomedical Sciences, Queen’s Medical Centre, University of Nottingham Medical School, Nottingham NG7 2UH, United Kingdom; bAcademic and Clinical Departments of Oncology, University of Nottingham, Nottingham NG5 1PB, United Kingdom; dDepartment of Histopathology, Royal Brompton Hospital, London SW3 6NP, United Kingdom; cDepartment of Genetics, Genome Sequencing Center, and eDivision of Statistical Genomics, Washington University School of Medicine, St. Louis, MO 63108; and fDepartments of Medicine and Cell Biology, Washington University, St Louis, MO 63110 Edited by George Klein, Karolinska Institutet, Stockholm, Sweden, and approved October 7, 2008 (received for review May 23, 2008) Loss of heterozygosity (LOH) and homozygous deletions at chro- toma protein (pRB), inhibits E2F-mediated transcription, and mosome 3p21.3 are common in both small and nonsmall cell lung suppresses expression of the majority of genes with E2F1- cancers, indicating the likely presence of tumor suppressor genes responsive elements (9). Moreover, forced expression of LIMD1 (TSGs). Although genetic and epigenetic changes within this region in A549 lung tumor cell line blocks tumor growth in vitro and in have been identified, the functional significance of these changes vivo (9). Here, we show that expression of the 3p21.3 gene, has not been explored.
  • The Role of Zyxin and LIMD1 in Mitosis and Cancer

    The Role of Zyxin and LIMD1 in Mitosis and Cancer

    University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Spring 5-4-2019 The Role of Zyxin and LIMD1 in Mitosis and Cancer Jiuli Zhou University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Part of the Cancer Biology Commons, and the Cell Biology Commons Recommended Citation Zhou, Jiuli, "The Role of Zyxin and LIMD1 in Mitosis and Cancer" (2019). Theses & Dissertations. 353. https://digitalcommons.unmc.edu/etd/353 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. THE ROLE OF ZYXIN AND LIMD1 IN MITOSIS AND CANCER by Jiuli Zhou A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Pathology & Microbiology Graduate Program Under the Supervision of Professor Jixin Dong University of Nebraska Medical Center Omaha, Nebraska May, 2019 Supervisory Committee: Jennifer D. Black, Ph.D. Robert E. Lewis, Ph.D. Kaihong Su, Ph.D. i ACKNOWLEDGEMENTS Funding support: The China Scholarship Council; University of Nebraska Medical Center (UNMC) Graduate Studies Office Fellowship; National Cancer Institute/National Institutes of Health (NCI/NIH); Department of Defense; the COBRE Grant from the Nebraska Center for Cell Signaling/National Institute of General Medical Sciences (NIGMS/NIH). More important than the funding support, I would like to acknowledge the support and encouragement I received during my doctoral research.
  • Pathway-Guided Analysis Identifies Myc-Dependent Alternative Pre-Mrna Splicing in Aggressive Prostate Cancers

    Pathway-Guided Analysis Identifies Myc-Dependent Alternative Pre-Mrna Splicing in Aggressive Prostate Cancers

    Pathway-guided analysis identifies Myc-dependent alternative pre-mRNA splicing in aggressive prostate cancers John W. Phillipsa,1, Yang Panb,1, Brandon L. Tsaia, Zhijie Xiea, Levon Demirdjianc, Wen Xiaoa, Harry T. Yangb, Yida Zhangb, Chia Ho Lina, Donghui Chenga, Qiang Hud, Song Liud, Douglas L. Blacka, Owen N. Wittea,e,f,g,h,2, and Yi Xinga,b,c,i,2 aDepartment of Microbiology, Immunology and Molecular Genetics, University of California, Los Angeles, CA 90095; bBioinformatics Interdepartmental Graduate Program, University of California, Los Angeles, CA 90095; cCenter for Computational and Genomic Medicine, The Children’s Hospital of Philadelphia, Philadelphia, PA 19104; dDepartment of Biostatistics and Bioinformatics, Roswell Park Comprehensive Cancer Center, Buffalo, NY 14263; eDepartment of Molecular and Medical Pharmacology, University of California, Los Angeles, CA 90095; fMolecular Biology Institute, University of California, Los Angeles, CA 90095; gJonsson Comprehensive Cancer Center, University of California, Los Angeles, CA 90095; hEli and Edythe Broad Center of Regenerative Medicine and Stem Cell Research, University of California, Los Angeles, CA 90095; and iDepartment of Pathology and Laboratory Medicine, University of Pennsylvania, Philadelphia, PA 19104 Contributed by Owen N. Witte, January 2, 2020 (sent for review September 16, 2019; reviewed by Colin C. Collins and Han Liang) We sought to define the landscape of alternative pre-mRNA splicing treatment-related neuroendocrine prostate cancer (NEPC) has in prostate cancers and the relationship of exon choice to known been aided by large-scale genomic and transcriptomic studies of cancer driver alterations. To do so, we compiled a metadataset patient samples representing each form of the disease (10–13).
  • The Transcription Factor PU. 1 Is Enriched at Inflammatory Bowel Disease Risk Loci in CD56+ Cells

    The Transcription Factor PU. 1 Is Enriched at Inflammatory Bowel Disease Risk Loci in CD56+ Cells

    The Transcription Factor PU.1 Is Enriched At Inflammatory Bowel Disease Risk Loci in CD56+ Cells A thesis submitted to the Graduate School of the University of Cincinnati In partial fulfillment of the requirements for the degree of Master of Science In the division of Immunology of the College of Medicine By: Fazeela Yaqoob M.Phil. Government College University Lahore, Pakistan, 2011 August 2017 Committee Chair: Stephen Waggoner, Ph.D. Jonathan Katz, Ph.D. Leah Kottyan, Ph.D. Abstract Inflammatory bowel disease (IBD) affects the well-being of 1.6 million people in the United States. The etiology of IBD is strongly linked to genetic risk loci and to a dysregulated immune response against the intestinal microbiome. Genome-wide association studies identified more than 200 discrete genetic loci associated with risk for IBD, but mechanistic understanding of how these sites collectively promote disease is lacking. We hypothesize that altered binding of transcription factors (TFs) at IBD risk loci is a mechanism to globally promote gene expression changes associated with IBD. We used an innovative algorithm to assess intersection between known IBD genetic risk loci and transcription factor binding (ChIP-Seq) in a variety of cell types to reveal that PU.1 binding in human CD56+ cells (highest scoring dataset) overlaps variants at more than half of the IBD risk loci assessed (62 of 112, 3.7-fold enrichment, p<10-30). The majority (but not all) of human CD56+ cells are natural killer (NK) cells, which are implicated in mouse models of IBD pathogenesis and observed to accumulate in the inflamed intestines of IBD patients.
  • Hypomethylation of LIMD1 and P16 by Downregulation of DNMT1 Results in Restriction of Liver Carcinogenesis by Amarogentin Treatment

    Hypomethylation of LIMD1 and P16 by Downregulation of DNMT1 Results in Restriction of Liver Carcinogenesis by Amarogentin Treatment

    J Biosci (2021)46:53 Ó Indian Academy of Sciences DOI: 10.1007/s12038-021-00176-0 (0123456789().,-volV)(0123456789().,-volV) Hypomethylation of LIMD1 and P16 by downregulation of DNMT1 results in restriction of liver carcinogenesis by amarogentin treatment 1 2 1 3 DEBOLINA PAL ,SUBHAYAN SUR ,RITUPARNA ROY ,SUVRA MANDAL and 1 CHINMAY KUMAR PANDA * 1Department Oncogene Regulation, Chittaranjan National Cancer Institute, Kolkata 700 026, India 2Department of Pathology, Saint Louis University, Saint Louis, USA 3Department of Chemistry, National Research Institute for Ayurvedic Drug Development, Kolkata, India *Corresponding author (Email, [email protected]) MS received 28 December 2020; accepted 17 May 2021 Amarogentin (active component of Chirata) was found to prevent CCl4/NDEA-induced liver carcinogenesis at mild dysplastic stage through modulation of cell cycle, apoptosis, self-renewal pathways. The cell cycle regulatory genes LIMD1, P16 and RBSP3 were found to be upregulated in restricted liver lesions. To understand the mechanism of upregulation during restriction of cacinogenesis, the effect of amarogentin on epigenetic modification was evaluated in this study. It was also validated in vitro. Hypermethylation of LIMD1 and P16 was seen in mouse hepatocellular carcinoma (30th week carcinogen control mice); however, hypomethylation of these genes was seen in amarogentin-treated liver. In the case of RBSP3, no such change was seen. DNMT1 expression (mRNA/protein) was significantly increased in later stages of carcinogenesis, whereas its expression was comparable to normal liver in the case of amarogentin treatment. No significant change in expression (mRNA/protein) of HDAC1/2 was observed irrespective of treatment. Amarogentin treatment upregulated the expression (mRNA/protein) of LIMD1, P16 and RBSP3 in the HepG2 cell line.
  • The Potential Genetic Network of Human Brain SARS-Cov-2 Infection

    The Potential Genetic Network of Human Brain SARS-Cov-2 Infection

    bioRxiv preprint doi: https://doi.org/10.1101/2020.04.06.027318; this version posted April 6, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. The potential genetic network of human brain SARS-CoV-2 infection. Colline Lapina 1,2,3, Mathieu Rodic 1, Denis Peschanski 4,5, and Salma Mesmoudi 1, 3, 4, 5 1 Prematuration Program: linkAllBrains. CNRS. Paris. France 2 Graduate School in Cognitive Engineering (ENSC). Talence. France 3 Complex Systems Institute Paris île-de-France. Paris. France 4 CNRS, Paris-1-Panthéon-Sorbonne University. CESSP-UMR8209. Paris. France 5 MATRICE Equipex. Paris. France Abstract The literature reports several symptoms of SARS-CoV-2 in humans such as fever, cough, fatigue, pneumonia, and headache. Furthermore, patients infected with similar strains (SARS-CoV and MERS-CoV) suffered testis, liver, or thyroid damage. Angiotensin-converting enzyme 2 (ACE2) serves as an entry point into cells for some strains of coronavirus (SARS-CoV, MERS-CoV, SARS-CoV-2). Our hypothesis was that as ACE2 is essential to the SARS-CoV-2 virus invasion, then brain regions where ACE2 is the most expressed are more likely to be disturbed by the infection. Thus, the expression of other genes which are also over-expressed in those damaged areas could be affected. We used mRNA expression levels data of genes provided by the Allen Human Brain Atlas (ABA), and computed spatial correlations with the LinkRbrain platform.