DOCSLIB.ORG

Gene Analysis for Studying the Process of Weight Regain After Weight Loss

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Gene Analysis for Studying the Process of Weight Regain After Weight Loss Gene analysis for studying the process of weight regain after weight loss Citation for published version (APA): Roumans, N. J. T. (2017). Gene analysis for studying the process of weight regain after weight loss. Gildeprint Drukkerijen. https://doi.org/10.26481/dis.20170623nr Document status and date: Published: 01/01/2017 DOI: 10.26481/dis.20170623nr Document Version: Publisher's PDF, also known as Version of record Please check the document version of this publication: • A submitted manuscript is the version of the article upon submission and before peer-review. There can be important differences between the submitted version and the official published version of record. People interested in the research are advised to contact the author for the final version of the publication, or visit the DOI to the publisher's website. • The final author version and the galley proof are versions of the publication after peer review. • The final published version features the final layout of the paper including the volume, issue and page numbers. Link to publication General rights Copyright and moral rights for the publications made accessible in the public portal are retained by the authors and/or other copyright owners and it is a condition of accessing publications that users recognise and abide by the legal requirements associated with these rights. • Users may download and print one copy of any publication from the public portal for the purpose of private study or research. • You may not further distribute the material or use it for any profit-making activity or commercial gain • You may freely distribute the URL identifying the publication in the public portal. If the publication is distributed under the terms of Article 25fa of the Dutch Copyright Act, indicated by the “Taverne” license above, please follow below link for the End User Agreement: www.umlib.nl/taverne-license Take down policy If you believe that this document breaches copyright please contact us at: [email protected] providing details and we will investigate your claim. Download date: 04 Oct. 2021 Gene analysis for studying the process of weight regain after weight loss The studies presented in this thesis were performed within NUTRIM School for Nutrition and Translational Research in Metabolism, which participates in the Graduate School VLAG (Food Technology, Agrobiotechnology, Nutrition and Health Sciences), accredited by the Royal Netherlands Academy of Arts and Sciences. The studies described in this thesis were supported by a grant from Netherlands Organisation for Scientific Research (NWO) TOP, grant number: 200500001. Cover design: Nadia J.T. Roumans and Evelien Jagtman (http://evelienjagtman.com/) Layout: Nadia J.T. Roumans Printed by: Gildeprint – www.gildeprint.nl © Nadia J.T. Roumans, Maastricht 2016 For articles published or accepted for publication, the copyright has been transferred to the respective publisher. No parts of this thesis may be reproduced, stored in a retrieval system, or transmitted in any form or by any means without the permission of the author, or, when appropriate, from the publishers of the manuscript. Gene analysis for studying the process of weight regain after weight loss PROEFSCHRIFT ter verkrijging van de graad doctor aan de Universiteit Maastricht, op gezag van de Rector Magnificus, Prof. dr. Rianne M. Letschert, volgens het besluit van het College van Decanen, in het openbaar te verdedigen op vrijdag 23 Juni 2017 om 10.00 uur door Nadia Johanna Theodora Roumans Geboren te Zeven in Duitsland op 3 Maart 1989 Promotoren Prof. dr. E.C.M. Mariman Prof. dr. M.A. van Baak Beoordelingscommissie Prof. dr. E.E. Blaak, voorzitter Prof. dr. I.C. Arts Prof. dr. A.H. Kersten (Wageningen University & Research) Dr. E.M. van Schothorst (Wageningen University & Research) Prof. dr. L.P.A.J. Schrauwen Financiële ondersteuning Nederlandse Organisatie voor Wetenschappelijk Onderzoek (NWO): TOP grant 200500001 Content Chapter 1 General introduction 7 Chapter 2 Variation in extracellular matrix genes is associated with weight 17 regain after weight loss in a sex-specific manner Chapter 3 A role for leukocyte and ECM remodelling of adipose tissue in 39 the risk for weight regain after weight loss Chapter 4 Weight loss-induced stress in subcutaneous adipose tissue is 65 related to weight regain Chapter 5 Weight loss-induced cellular stress in subcutaneous adipose 87 tissue and the risk for weight regain in overweight and obese adults Chapter 6 Relation between stress- and ECM-related genes and their 113 effect on weight regain Chapter 7 General discussion 145 Addendum Summary 157 Samenvatting 161 Valorization 167 Dankwoord/Acknowledgements 173 Curriculum Vitae 177 List of Publications 181 Chapter 1 General introduction 7 Chapter 1 Obesity The prevalence of overweight and obesity has increased worldwide, presenting major health problems (1). In 2014, the World Health Organization estimated that of adults aged 18 and over, 39% were overweight and 13% were obese (2). The prevalence of overweight and obesity is assessed by using body mass index (BMI), which is defined as weight in kilograms divided by the square of height in meters (kg/m2). Individuals with a BMI≥25 kg/m2 are classified as overweight and individuals with a BMI≥30 kg/m2 are classified as obese. The increasing prevalence of obesity is a major health concern since it increases the risk for developing type 2 diabetes mellitus (3), cardiovascular diseases (4) and certain types of cancer (5). In fact, overweight- and obesity-related health problems were estimated to cause 3.4 million deaths in 2010 (1). Overweight and obesity occur when there is a disturbance in the energy balance, which is determined by energy intake and expenditure. When energy balance is maintained, energy intake and energy expenditure are equal (Figure 1). If energy intake exceeds energy expenditure, the excessive energy is stored as triglycerides (TG) in the white adipose tissue (WAT). This causes weight gain and eventually obesity. On the other hand, if energy expenditure exceeds energy intake, the stored TG are used as fuel for other energy demanding processes elsewhere in the body. Figure 1: Balance between energy intake and energy expenditure. Nowadays the often-observed energy imbalance is mainly caused by the combination of a high calorie intake and a low physical activity (6). In our modern society, food is abundantly available and is also energy dense whereas the demand of physical activity is strongly reduced. However, this ‘obesogenic’ environment cannot fully explain the development of obesity at an individual level, since many people seem to be protected against obesity. This raises the question which factors determine the individual susceptibility to become obese. There is evidence that an individual’s susceptibility for gaining weight is determined in part by genetics (7, 8). Numerous genes have been identified that are associated with obesity (9). Genetic variants or single nucleotide polymorphisms (SNPs), like the polymorphism in the fat mass and obesity-associated (FTO) gene, have been linked to obesity (10-12). An individual with a genetic predisposition is unlikely to develop obesity without being exposed to an obesity-promoting environment, suggesting gene-environment interaction effects (13). For example, the body weight development of children is influenced by the BMI of their parents. A higher BMI for the parent is linked to a higher BMI in their children (14). This parental association is due to the combination of a shared genetic background and a shared lifestyle. Besides genetics, other factors also contribute to the individual’s susceptibility to become obese, such as aging: when people become older they tend to gain weight (15). Also, social, cultural and economic status, and inadequate sleep are associated with the prevalence of obesity (8, 16, 17). 8 General introduction Weight loss and weight regain There is a simple remedy to obesity, i.e. losing weight by limiting energy/food intake and increasing daily physical activity for a longer period of time. A body weight reduction of 5-10% reduces disease risk and improves the metabolic profile resulting in positive health outcomes (18, 19). However, the greatest challenge is the seemingly inevitable weight regain after weight loss, the so-called “yoyo- effect”. In general up to 80% of the people are unsuccessful in maintaining weight loss (20, 21) defined as “keeping off an intentional loss of at least 10% body weight for at least one year” (22). On average about 70% of the lost weight is regained within two years after the dietary intervention (23). Still, some individuals are able to keep off their lost weight, pointing to an individual susceptibility for weight maintenance or weight regain. Similarly to the predisposition to develop overweight or obesity, the individual susceptibility to successful weight loss and weight maintenance seems to be determined by multiple factors. Genetic, behavioural and physiological factors related to body weight might directly or indirectly affect weight loss and weight maintenance. Hormonal and genetic factors change in response to weight loss, thereby either changing to a pre-obese state or favouring weight regain. For instance, circulating mediators of appetite that enhance weight regain did not return to pre-weight loss levels one year after the start of the weight loss intervention (24). In addition, during weight loss circulating leptin concentrations decrease which could lead to
Load more

Recommended publications
  • Validation Using Ovarian Cancer Gene Expres
    Published OnlineFirst May 5, 2015; DOI: 10.1158/1078-0432.CCR-14-3173 Biology of Human Tumors Clinical Cancer Research Creation of a Human Secretome: A Novel Composite Library of Human Secreted Proteins: Validation Using Ovarian Cancer Gene Expression Data and a Virtual Secretome Array Vinod Vathipadiekal1,2, Victoria Wang2,3, Wei Wei1,2, Levi Waldron2,3,4, Ronny Drapkin5, Michael Gillette1,6, Steven Skates2,7, and Michael Birrer1,2 Abstract Purpose: To generate a comprehensive "Secretome" of proteins Plus 2.0 probesets. Using ovarian cancer transcriptomic data, we potentially found in the blood and derive a virtual Affymetrix identified candidate blood-based biomarkers for ovarian cancer array. To validate the utility of this database for the discovery of and performed bioinformatic validation by demonstrating redis- novel serum-based biomarkers using ovarian cancer transcrip- covery of known biomarkers including CA125 and HE4. Two tomic data. novel top biomarkers (FGF18 and GPR172A) were validated in Experimental Design: The secretome was constructed by aggre- serum samples from an independent patient cohort. gating the data from databases of known secreted proteins, Conclusions: We present the secretome, comprising the transmembrane or membrane proteins, signal peptides, G-pro- most comprehensive resource available for protein products tein coupled receptors, or proteins existing in the extracellular that are potentially found in the blood. The associated virtual region, and the virtual array was generated by mapping them to array can be used to translate gene-expression data into cancer Affymetrix probeset identifiers. Whole-genome microarray data biomarker discovery. A list of blood-based biomarkers for from ovarian cancer, normal ovarian surface epithelium, and ovarian cancer detection is reported and includes CA125 and fallopian tube epithelium were used to identify transcripts upre- HE4.
    [Show full text]
  • Dual Proteome-Scale Networks Reveal Cell-Specific Remodeling of the Human Interactome
    bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Dual Proteome-scale Networks Reveal Cell-specific Remodeling of the Human Interactome Edward L. Huttlin1*, Raphael J. Bruckner1,3, Jose Navarrete-Perea1, Joe R. Cannon1,4, Kurt Baltier1,5, Fana Gebreab1, Melanie P. Gygi1, Alexandra Thornock1, Gabriela Zarraga1,6, Stanley Tam1,7, John Szpyt1, Alexandra Panov1, Hannah Parzen1,8, Sipei Fu1, Arvene Golbazi1, Eila Maenpaa1, Keegan Stricker1, Sanjukta Guha Thakurta1, Ramin Rad1, Joshua Pan2, David P. Nusinow1, Joao A. Paulo1, Devin K. Schweppe1, Laura Pontano Vaites1, J. Wade Harper1*, Steven P. Gygi1*# 1Department of Cell Biology, Harvard Medical School, Boston, MA, 02115, USA. 2Broad Institute, Cambridge, MA, 02142, USA. 3Present address: ICCB-Longwood Screening Facility, Harvard Medical School, Boston, MA, 02115, USA. 4Present address: Merck, West Point, PA, 19486, USA. 5Present address: IQ Proteomics, Cambridge, MA, 02139, USA. 6Present address: Vor Biopharma, Cambridge, MA, 02142, USA. 7Present address: Rubius Therapeutics, Cambridge, MA, 02139, USA. 8Present address: RPS North America, South Kingstown, RI, 02879, USA. *Correspondence: [email protected] (E.L.H.), [email protected] (J.W.H.), [email protected] (S.P.G.) #Lead Contact: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.01.19.905109; this version posted January 19, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Glucose-Induced Changes in Gene Expression in Human Pancreatic Islets: Causes Or Consequences of Chronic Hyperglycemia
    Diabetes Volume 66, December 2017 3013 Glucose-Induced Changes in Gene Expression in Human Pancreatic Islets: Causes or Consequences of Chronic Hyperglycemia Emilia Ottosson-Laakso,1 Ulrika Krus,1 Petter Storm,1 Rashmi B. Prasad,1 Nikolay Oskolkov,1 Emma Ahlqvist,1 João Fadista,2 Ola Hansson,1 Leif Groop,1,3 and Petter Vikman1 Diabetes 2017;66:3013–3028 | https://doi.org/10.2337/db17-0311 Dysregulation of gene expression in islets from patients In patients with type 2 diabetes (T2D), islet function de- with type 2 diabetes (T2D) might be causally involved clines progressively. Although the initial pathogenic trigger in the development of hyperglycemia, or it could develop of impaired b-cell function is still unknown, elevated glu- as a consequence of hyperglycemia (i.e., glucotoxicity). cose levels are known to further aggravate b-cell function, a To separate the genes that could be causally involved condition referred to as glucotoxicity, which can stimulate in pathogenesis from those likely to be secondary to hy- apoptosis and lead to reduced b-cell mass (1–5). Prolonged perglycemia, we exposed islets from human donors to exposure to hyperglycemia also can induce endoplasmic re- ISLET STUDIES normal or high glucose concentrations for 24 h and ana- ticulum (ER) stress and production of reactive oxygen spe- fi lyzed gene expression. We compared these ndings with cies (6), which can further impair islet function and thereby gene expression in islets from donors with normal glucose the ability of islets to secrete the insulin needed to meet the tolerance and hyperglycemia (including T2D). The genes increased demands imposed by insulin resistance and obe- whose expression changed in the same direction after sity (7).
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Análise Integrativa De Perfis Transcricionais De Pacientes Com
    UNIVERSIDADE DE SÃO PAULO FACULDADE DE MEDICINA DE RIBEIRÃO PRETO PROGRAMA DE PÓS-GRADUAÇÃO EM GENÉTICA ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Ribeirão Preto – 2012 ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas Tese apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo para obtenção do título de Doutor em Ciências. Área de Concentração: Genética Orientador: Prof. Dr. Eduardo Antonio Donadi Co-orientador: Prof. Dr. Geraldo A. S. Passos Ribeirão Preto – 2012 AUTORIZO A REPRODUÇÃO E DIVULGAÇÃO TOTAL OU PARCIAL DESTE TRABALHO, POR QUALQUER MEIO CONVENCIONAL OU ELETRÔNICO, PARA FINS DE ESTUDO E PESQUISA, DESDE QUE CITADA A FONTE. FICHA CATALOGRÁFICA Evangelista, Adriane Feijó Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas. Ribeirão Preto, 2012 192p. Tese de Doutorado apresentada à Faculdade de Medicina de Ribeirão Preto da Universidade de São Paulo. Área de Concentração: Genética. Orientador: Donadi, Eduardo Antonio Co-orientador: Passos, Geraldo A. 1. Expressão gênica – microarrays 2. Análise bioinformática por module maps 3. Diabetes mellitus tipo 1 4. Diabetes mellitus tipo 2 5. Diabetes mellitus gestacional FOLHA DE APROVAÇÃO ADRIANE FEIJÓ EVANGELISTA Análise integrativa de perfis transcricionais de pacientes com diabetes mellitus tipo 1, tipo 2 e gestacional, comparando-os com manifestações demográficas, clínicas, laboratoriais, fisiopatológicas e terapêuticas.
    [Show full text]
  • Association Between Chymase Gene Polymorphisms and Atrial Fibrillation
    Zhou et al. BMC Cardiovascular Disorders (2019) 19:321 https://doi.org/10.1186/s12872-019-01300-7 RESEARCH ARTICLE Open Access Association between chymase gene polymorphisms and atrial fibrillation in Chinese Han population Dongchen Zhou, Yuewei Chen, Jiaxin Wu, Jiabo Shen, Yushan Shang, Liangrong Zheng and Xudong Xie* Abstract Background: Chymase is the major angiotensin II (Ang II)-forming enzyme in cardiovascular tissue, with an important role in atrial remodeling. This study aimed to examine the association between chymase 1 gene (CMA1) polymorphisms and atrial fibrillation (AF) in a Chinese Han population. Methods: This case-control study enrolled 126 patients with lone AF and 120 age- and sex-matched healthy controls, all from a Chinese Han population. Five CMA1 polymorphisms were genotyped. Results: The CMA1 polymorphism rs1800875 (G-1903A) was associated with AF. The frequency of the GG genotype was significantly higher in AF patients compared with controls (p = 0.009). Haplotype analysis further demonstrated an increased risk of AF associated with the rs1800875-G haplotype (Hap8 TGTTG, odds ratio (OR) = 1.668, 95% CI 1.132–2.458, p = 0.009), and a decreased risk for the rs1800875-A haplotype (Hap5 TATTG, OR = 0.178, 95% CI 0.042– 0.749, p = 0.008). Conclusions: CMA1 polymorphisms may be associated with AF, and the rs1800875 GG genotype might be a susceptibility factor for AF in the Chinese Han population. Keywords: Atrial fibrillation, CMA1, Chymase, Single nucleotide polymorphism, Angiotensin II Background ‘lone AF’, occur in the absence of identifiable underlying Atrial fibrillation (AF) is the most common type of sus- cardiovascular or other comorbid diseases [4].
    [Show full text]
  • Supplementary Materials
    Supplementary materials Supplementary Table S1: MGNC compound library Ingredien Molecule Caco- Mol ID MW AlogP OB (%) BBB DL FASA- HL t Name Name 2 shengdi MOL012254 campesterol 400.8 7.63 37.58 1.34 0.98 0.7 0.21 20.2 shengdi MOL000519 coniferin 314.4 3.16 31.11 0.42 -0.2 0.3 0.27 74.6 beta- shengdi MOL000359 414.8 8.08 36.91 1.32 0.99 0.8 0.23 20.2 sitosterol pachymic shengdi MOL000289 528.9 6.54 33.63 0.1 -0.6 0.8 0 9.27 acid Poricoic acid shengdi MOL000291 484.7 5.64 30.52 -0.08 -0.9 0.8 0 8.67 B Chrysanthem shengdi MOL004492 585 8.24 38.72 0.51 -1 0.6 0.3 17.5 axanthin 20- shengdi MOL011455 Hexadecano 418.6 1.91 32.7 -0.24 -0.4 0.7 0.29 104 ylingenol huanglian MOL001454 berberine 336.4 3.45 36.86 1.24 0.57 0.8 0.19 6.57 huanglian MOL013352 Obacunone 454.6 2.68 43.29 0.01 -0.4 0.8 0.31 -13 huanglian MOL002894 berberrubine 322.4 3.2 35.74 1.07 0.17 0.7 0.24 6.46 huanglian MOL002897 epiberberine 336.4 3.45 43.09 1.17 0.4 0.8 0.19 6.1 huanglian MOL002903 (R)-Canadine 339.4 3.4 55.37 1.04 0.57 0.8 0.2 6.41 huanglian MOL002904 Berlambine 351.4 2.49 36.68 0.97 0.17 0.8 0.28 7.33 Corchorosid huanglian MOL002907 404.6 1.34 105 -0.91 -1.3 0.8 0.29 6.68 e A_qt Magnogrand huanglian MOL000622 266.4 1.18 63.71 0.02 -0.2 0.2 0.3 3.17 iolide huanglian MOL000762 Palmidin A 510.5 4.52 35.36 -0.38 -1.5 0.7 0.39 33.2 huanglian MOL000785 palmatine 352.4 3.65 64.6 1.33 0.37 0.7 0.13 2.25 huanglian MOL000098 quercetin 302.3 1.5 46.43 0.05 -0.8 0.3 0.38 14.4 huanglian MOL001458 coptisine 320.3 3.25 30.67 1.21 0.32 0.9 0.26 9.33 huanglian MOL002668 Worenine
    [Show full text]
  • Comparison of Gene Expression Profiles Between Dental Pulp and Periodontal Ligament Tissues in Humans
    INTERNATIONAL JOURNAL OF MOLECULAR MEDICINE 40: 647-660, 2017 Comparison of gene expression profiles between dental pulp and periodontal ligament tissues in humans AI-XIU GONG1*, JING-HAN ZHANG2*, JING LI1, JUN WU3, LIN WANG4 and DENG-SHUN MIAO3 Departments of 1Stomatology, and 2Neonatology, Children's Hospital of Nanjing Medical University, Nanjing, Jiangsu 210008; 3State Key Laboratory of Reproductive Medicine, The Research Center for Bone and Stem Cells, Department of Anatomy, Histology and Embryology, Nanjing Medical University; 4Jiangsu Key Laboratory of Oral Diseases, Department of Orthodontics, School of Stomatology, Nanjing Medical University, Nanjing, Jiangsu 210029, P.R. China Received March 16, 2016; Accepted June 16, 2017 DOI: 10.3892/ijmm.2017.3065 Abstract. There are anatomical and functional differ- DP samples. The gene expression profiles provide novel insight ences between human dental pulp (DP) and periodontal into the characterization of DP and PDL tissues, and contribute ligament (PDL). However, the molecular biological differ- to our understanding of the potential molecular mechanisms of ences and function of these tissues are poorly understood. dental tissue mineralization and regeneration. In the present study, we employed a cDNA microarray array to screen for differentially expressed genes (DEGs) between Introduction human DP and PDL tissues, and used the online software WebGestalt to perform the functional analysis of the DEGs. Dental pulp (DP) tissue, termed as the ‘ectomesenchyme’, is In addition, the STRING database and KEGG pathway derived from ectodermal cells that grow on the periphery of analysis were applied for interaction network and pathway the neural tube, migrate to the oral position and then differen- analysis of the DEGs.
    [Show full text]
  • CMA1 Rabbit Polyclonal Antibody – TA342809 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA342809 CMA1 Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-CMA1 antibody: synthetic peptide directed towards the C terminal of human CMA1. Synthetic peptide located within the following region: EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 27 kDa Gene Name: chymase 1 Database Link: NP_001827 Entrez Gene 1215 Human P23946 Background: CMA1 is a chymotryptic serine proteinase that belongs to the peptidase family S1. It is expressed in mast cells and thought to function in the degradation of the extracellular matrix, the regulation of submucosal gland secretion, and the generation of vasoactive peptides. In the heart and blood vessels, this protein, rather than angiotensin converting enzyme, is largely responsible for converting angiotensin I to the vasoactive peptide angiotensin II. Angiotensin II has been implicated in blood pressure control and in the pathogenesis of hypertension, cardiac hypertrophy, and heart failure. Thus, this gene product is a target for cardiovascular disease therapies. This product is to be used for laboratory only. Not for diagnostic or therapeutic use.
    [Show full text]
  • Exploring the Relationship Between Gut Microbiota and Major Depressive Disorders
    E3S Web of Conferences 271, 03055 (2021) https://doi.org/10.1051/e3sconf/202127103055 ICEPE 2021 Exploring the Relationship between Gut Microbiota and Major Depressive Disorders Catherine Tian1 1Shanghai American School, Shanghai, China Abstract. Major Depressive Disorder (MDD) is a psychiatric disorder accompanied with a high rate of suicide, morbidity and mortality. With the symptom of an increasing or decreasing appetite, there is a possibility that MDD may have certain connections with gut microbiota, the colonies of microbes which reside in the human digestive system. In recent years, more and more studies started to demonstrate the links between MDD and gut microbiota from animal disease models and human metabolism studies. However, this relationship is still largely understudied, but it is very innovative since functional dissection of this relationship would furnish a new train of thought for more effective treatment of MDD. In this study, by using multiple genetic analytic tools including Allen Brain Atlas, genetic function analytical tools, and MicrobiomeAnalyst, I explored the genes that shows both expression in the brain and the digestive system to affirm that there is a connection between gut microbiota and the MDD. My approach finally identified 7 MDD genes likely to be associated with gut microbiota, implicating 3 molecular pathways: (1) Wnt Signaling, (2) citric acid cycle in the aerobic respiration, and (3) extracellular exosome signaling. These findings may shed light on new directions to understand the mechanism of MDD, potentially facilitating the development of probiotics for better psychiatric disorder treatment. 1 Introduction 1.1 Major Depressive Disorder Major Depressive Disorder (MDD) is a mood disorder that will affect the mood, behavior and other physical parts.
    [Show full text]
  • Based on Network Pharmacology Tools to Investigate the Molecular Mechanism of Cordyceps Sinensis on the Treatment of Diabetic Nephropathy
    Hindawi Journal of Diabetes Research Volume 2021, Article ID 8891093, 12 pages https://doi.org/10.1155/2021/8891093 Research Article Based on Network Pharmacology Tools to Investigate the Molecular Mechanism of Cordyceps sinensis on the Treatment of Diabetic Nephropathy Yan Li,1 Lei Wang,2 Bojun Xu,1 Liangbin Zhao,1 Li Li,1 Keyang Xu,3 Anqi Tang,1 Shasha Zhou,1 Lu Song,1 Xiao Zhang,1 and Huakui Zhan 1 1Hospital of Chengdu University of Traditional Chinese Medicine, Chengdu, 610072 Sichuan, China 2Key Laboratory of Chinese Internal Medicine of Ministry of Education and Dongzhimen Hospital, Beijing University of Chinese Medicine, Beijing 100700, China 3Zhejiang Chinese Medical University, Hangzhou, 310053 Zhejiang, China Correspondence should be addressed to Huakui Zhan; [email protected] Received 27 August 2020; Revised 17 January 2021; Accepted 24 January 2021; Published 8 February 2021 Academic Editor: Michaelangela Barbieri Copyright © 2021 Yan Li et al. This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background. Diabetic nephropathy (DN) is one of the most common complications of diabetes mellitus and is a major cause of end- stage kidney disease. Cordyceps sinensis (Cordyceps, Dong Chong Xia Cao) is a widely applied ingredient for treating patients with DN in China, while the molecular mechanisms remain unclear. This study is aimed at revealing the therapeutic mechanisms of Cordyceps in DN by undertaking a network pharmacology analysis. Materials and Methods. In this study, active ingredients and associated target proteins of Cordyceps sinensis were obtained via Traditional Chinese Medicine Systems Pharmacology Database (TCMSP) and Swiss Target Prediction platform, then reconfirmed by using PubChem databases.
    [Show full text]