DOCSLIB.ORG

A Nuclear Localizationsignal and the C-Terminal Omega Sequence in The

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
A Nuclear Localizationsignal and the C-Terminal Omega Sequence in The Proc. Natl. Acad. Sci. USA Vol. 89, pp. 11837-11841, December 1992 Genetics A nuclear localization signal and the C-terminal omega sequence in the Agrobacterium tumefaciens VirD2 endonuclease are important for tumor formation (DNA transfer/plant tumors/nuclear transport/crown gall) CLAIRE E. SHURVINTON, LARRY HODGES, AND WALT REAM* Department of Agricultural Chemistry and Program in Molecular Biology, Oregon State University, Corvallis, OR 97331-6502 Communicated by Mary-Dell Chilton, August 10, 1992 (receivedfor review April 28, 1992) ABSTRACT The T-DNA portion of the Agrobacterium 1C) (28), and one of them (Fig. 1A) mediates nuclear trans- tumefaciens tumor-inducing (Ti) plasmid integrates into plant port when fused to 8-glucuronidase or /3-galactosidase and nuclear DNA. Direct repeats define the T-DNA ends; transfer synthesized in tobacco cells (29, 30). Proteins enter nuclei by begins when the VirD2 endonuclease produces a site-specific ATP-dependent active transport through nuclear pores (31). nick in the right-hand border repeat and attaches to the 5' end Nuclear import depends upon NLSs, short regions rich in of the nicked strand. Subsequent events generate linear snge- basic amino acids; many NLSs, including those in VirD2 and stranded VirD2-bound DNA molecules that include the entire Xenopus nucleoplasmin, are bipartite sequences that contain T-DNA (T-strands). VirD2 protein contains a nuclear localiza- two interdependent basic domains, both needed for full tion signal (NLS) near the C terminus and may direct bound activity (28) (Fig. 1). Receptors, called NLS binding proteins, T-strands to plant nuclei. We constructed mutations in virD2 recognize NLSs and direct NLS-containing proteins to nu- and showed that the NLS was important for tumorigenesis, clear pores where transport into nuclei occurs (31). Because although T-strand production occurred normally in its ab- VirD2 protein contains at least one NLS (29, 30), it may pilot sence. A tobacco etch virus NLS, substituted for the VirD2 covalently bound T-strands into host nuclei (14, 32); how- NLS, restored tumor-inducing activity. Amino acids (the ever, the importance of the NLS (Fig. 1A) for tumorigenesis omega sequence) at the C terminus of VirD2, outside the NLS remains untested. The NLS in octopine-type VirD2 protein and the endonuclease domain, contributed s fcantly to (KRPRDRHDGELGGRKRAR; Fig. 1A) lies near the C tumorigenesis, suggesting that VirD2 may serve a third im- terminus (aa 396-413; see Fig. 2), which is important for portant function in T-DNA transfer. virulence: a mutant strain lacking only the last two amino acids of VirD2 exhibits very weak virulence, and removal of Agrobacterium tumefaciens causes crown gall tumors on the final 26 aa, including half of the NLS, abolishes tumor- many plants when the bacteria infect wounded tissue (1). The igenesis (26). We performed a detailed genetic analysis and Ti plasmid carries genes essential for tumorigenesis. Trans- discovered that precise deletion of the basic amino acids in ferred DNA (T-DNA) enters plant cells and integrates into the NLS near the C terminus of VirD2 reduced tumor nuclear DNA (2) where expression of certain T-DNA genes induction to about 60% of control values and that an NLS leads to tumorous growth (1). Virulence genes (vir) necessary from tobacco etch virus (TEV) could compensate in part for for T-DNA transfer lie elsewhere on the Ti plasmid; wounded loss of the VirD2 NLS. We also found that a second region, plants produce phenolic compounds that induce vir expres- the omega sequence, at the C terminus of VirD2 played a sion (3). T-DNA transmission requires, in cis, the right-hand major role in tumorigenesis; deletion of the omega sequence 25-base-pair (bp) border sequence, and deletions removing it reduced tumor induction to just 3% of wild type. abolish tumorigenesis (4-6). Loss of a nearby sequence, called overdrive, reduces tumorigenesis several hundredfold (7). The endonuclease encoded by virDI and virD2 nicks the METHODS bottom strand of each border sequence at a specific site (8, Bacteriology. Escherichia coli strains used were SK1592 9), and VirD2 protein attaches covalently at the 5' end of the (thi supE endA sbcBJ5 hsdR4) (33), SF800 (polAl thy gyrA) nicked DNA strand (10-14). Subsequent events displace (34), and CJ236 (dut-J ung-) thi-J relAl pCJ105) (35). A. linear single-stranded DNAs composed of the bottom strand tumefaciens strains of the T-DNA (T-strands) (15-17). VirE2 single-strand DNA (Table 1) contain derivatives of the binding protein binds cooperatively to T-strands (18-23). A. octopine-type plasmid pTiA6NC in the C58 chromosomal tumefaciens probably transfers T-DNA into plant cells via background (36). To select drug-resistant bacteria, we used T-strand intermediates (24). ampicillin (50 Ag/ml) or kanamycin (25 ,Ag/ml) in L-agar or VirD2 contains at least two functional domains. The N-ter- L-broth (33) for E. coli and carbenicillin (100 ,ug/ml), genta- minal 262 amino acids of VirD2 [424 amino acids (aa) total] micin (50 .&g/ml), or kanamycin (100 ,ug/ml) in AB minimal perform border nicking and attachment and suffice for agar or YEP broth (36) for A. tumefaciens. Homogenotiza- T-strand production (10), but mutations at the C terminus tions were performed as described (36). abolish or severely attenuate tumorigenesis (25, 26). The Deletions. A. tumefaciens strain WR1715 harbored a Ti N-terminal endonuclease domains of VirD2 proteins from plasmid with 70% of virD2 deleted (aa 94-388). To construct three different strains show 85% sequence conservation, but this deletion, we isolated the virD operon as a 5783-bp Sst elsewhere they share only short stretches of similarity (27). I-Bgl II fragment from pVK225 (37) and inserted it into Among the short conserved regions, two resemble the Xe- pBS-Bgl (38). Cleavage with Kpn I followed by ligation nopus nucleoplasmin nuclear localization signal (NLS) (Fig. Abbreviations: T-DNA, transferred DNA; NLS, nuclear localization signal; SV40, simian virus 40; T antigen, large tumor antigen; aa, The publication costs of this article were defrayed in part by page charge amino acid(s); TEV, tobacco etch virus; T-strands, linear single- payment. This article must therefore be hereby marked "advertisement" stranded DNAs composed of the bottom strand of the T-DNA. in accordance with 18 U.S.C. §1734 solely to indicate this fact. *To whom reprint requests should be addressed. 11837 Downloaded by guest on October 1, 2021 11838 Genetics: Shurvinton et al. Proc. Natl. Acad. Sci. USA 89 (1992) A Agrobacterium octopine-type VirD2 IWPRDRHDGELGGR13AR (396-413) Agrobacterium nopaline-type VirD2 KRPREDDDGEPSERRER (417-434) Agrobacterium rhizogenes VirD2 KRPRVEDDGEPSERKRAR (406-423) B Agrobacterium octopine-type VirD2 KRRNDEEAGPSGANRRGLK (338-356) Agrobacterium nopaline-type VirD2 XRPHDDDGGPSGAUVTLE (339-357) Agrobacterium rhizogenes VirD2 KRPRDDDEGPSGAKVRLE (328-346) C Xenopus nucleoplasmin KPAATKKAGQA1aCLD (155-172) D SV40 virus large T antigen PKV (126-132) FIG. 1. NLSs from A. tumefaciens, Xenopus, and SV40. Bold typeface denotes basic residues presumed important for nuclear targeting. Plant NLSs have been previously identified (A) or inferred based on sequence similarity (B). Numbers in parentheses indicate positions ofamino acids shown. removed 885 bp (295 codons) from virD2 to produce pWR209 Table 1. Virulence of strains with mutations in virD2 (Al; Fig. 2). We joined pWR2O9 and broad-host-range plas- virD2 Relative mid pVK100 (37) at their Bgi II sites to form pWR211. We Strain allele Disks Tumors perdisk P virulence transformed pWR211 into A. tumefaciens strain MX304 (25) Group a containing a virD2::Tn3-lac gene and isolated a carbenicillin- WR1753 + 110 13.6 ± 11.3 100 sensitive homogenote (WR171S) in which Al replaced the WR1811 A3 113 12.6 ± 10.2 0.3 93 transposon in the Ti plasmid. Southern analysis (33) con- WR1749 A2 107 0.57 ± 0.89 <0.001 4.2 firmed the structure of this Ti plasmid. Group b We tested all mutations in WR1715, the virD2 null mutant. WR1753 + 130 24.8 ± 14.5 100 Plasmids containing the virD promoter, virDI, and wild-type WR1749 A2 132 0.24 ± 0.49 1 or mutant alleles of virD2 in pUC18 (33) were inserted into WR1777 sub#1 131 3.7 ± 3.1 <0.001 15 pVK100 at the EcoPJ site and transformed into WR1715. The Group c virD2+ pVK100 derivative (WR1753; Table 1) restored full WR1753 + 261 15.1 ± 11.1 100 virulence to WR1715. WR1769 A4 266 12.2 ± 8.7 <0.001 81 To remove the NLS near the C terminus of VirD2 WR1753 + 443 18.3 ± 14.2 100 (KRPRDRHDGELGGRKRAR; aa 396-413), we used Nru I WR1768 A5 510 12.5 ± 10.5 <0.001 68 sites (Fig. 2) to remove 135 bp (codons 373-417, including the WR1753 + 701 16.1 ± 15.2 100 NLS) producing A2 (Fig. 2). To create virD2A3, we deleted WR1766 A4+5 582 9.5 ± 10.4 <0.001 59 60 bp (codons 373-392) from the leftmost Nru I site rightward Group d to the HindIII site upstream ofthe KRPR codons (Fig. 2). The WR1753 + 377 15.5 ± 16.4 100 end produced by HindIII cleavage was made blunt by Kle- WR1828 A9 387 10.8 ± 11.7 <0.001 69 now DNA polymerase I. A3 did not remove the NLS (Fig. 2). WR1830 A4+5+9 239 9.9 ± 11.2 0.2 63 We constructed A4 (codons 396-399), A5 (codons 410-413), Group e and A9 (codons 338-356) (Fig. 2) by oligonucleotide-directed WR1753 + 51 10.2 ± 7.2 100 mutagenesis (35). WR1814 ins#1 50 9.4 ± 6.3 0.4 93 Insertions. We inserted a 12-bp oligonucleotide, composed WR1813 ins#2 49 10.1 ± 9.1 0.9 99 of two Xho I sites, into virD2 at Nru I or Tha I sites.
Load more

Recommended publications
  • Differential Control of Dntp Biosynthesis and Genome Integrity
    www.nature.com/scientificreports OPEN Diferential control of dNTP biosynthesis and genome integrity maintenance by the dUTPase Received: 6 November 2015 Accepted: 12 June 2017 superfamily enzymes Published online: 20 July 2017 Rita Hirmondo1, Anna Lopata1, Eva Viola Suranyi1,2, Beata G. Vertessy1,2 & Judit Toth1 dUTPase superfamily enzymes generate dUMP, the obligate precursor for de novo dTTP biosynthesis, from either dUTP (monofunctional dUTPase, Dut) or dCTP (bifunctional dCTP deaminase/dUTPase, Dcd:dut). In addition, the elimination of dUTP by these enzymes prevents harmful uracil incorporation into DNA. These two benefcial outcomes have been thought to be related. Here we determined the relationship between dTTP biosynthesis (dTTP/dCTP balance) and the prevention of DNA uracilation in a mycobacterial model that encodes both the Dut and Dcd:dut enzymes, and has no other ways to produce dUMP. We show that, in dut mutant mycobacteria, the dTTP/dCTP balance remained unchanged, but the uracil content of DNA increased in parallel with the in vitro activity-loss of Dut accompanied with a considerable increase in the mutation rate. Conversely, dcd:dut inactivation resulted in perturbed dTTP/dCTP balance and two-fold increased mutation rate, but did not increase the uracil content of DNA. Thus, unexpectedly, the regulation of dNTP balance and the prevention of DNA uracilation are decoupled and separately brought about by the Dcd:dut and Dut enzymes, respectively. Available evidence suggests that the discovered functional separation is conserved in humans and other organisms. Proper control of the intracellular concentration of deoxyribonucleoside-5-triphosphates (dNTPs), the building blocks of DNA, is critically important for efcient and high-fdelity DNA replication and genomic stability1, 2.
    [Show full text]
  • DUT (NM 001948) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221635 DUT (NM_001948) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DUT (NM_001948) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DUT Synonyms: dUTPase Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221635 representing NM_001948 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTGCTCTGAAGAGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCA TGCAGCTCCGCTTTGCCCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGG CTACGACCTGTACAGTGCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATT CAGATAGCGCTCCCTTCTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTA TTGATGTAGGAGCTGGTGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGG CAAAGAAAAGTTTGAAGTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCA GAAATAGAAGAAGTTCAAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGA AT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221635 representing NM_001948 Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag Chromatograms:
    [Show full text]
  • Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA
    INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2327-2334, 2015 Crucial roles of thymidine kinase 1 and deoxyUTPase in incorporating the antineoplastic nucleosides trifluridine and 2'-deoxy-5-fluorouridine into DNA KAzUKI SAKAMoTo, Tatsushi YoKogAwA, HIRoYUKI UENo, KEI ogUcHI, HIRoMI KAzUNo, KEIJI ISHIDA, NozoMU TANAKA, AKIKo oSADA, YUKARI YAMADA, HIRoYUKI oKABE and KENIcHI Matsuo Drug Discovery and Development I, Discovery and Preclinical Research Division, Taiho Pharmaceutical co., Ltd., Tsukuba, Ibaraki 300-2611, Japan Received March 6, 2015; Accepted April 9, 2015 DoI: 10.3892/ijo.2015.2974 Abstract. Trifluridine (FTD) and 2'-deoxy-5-fluorouridine transported into cells by ENT1 and ENT2 and were phosphor- (FdUrd), a derivative of 5-fluorouracil (5-FU), are antitumor ylated by thymidine kinase 1, which showed a higher catalytic agents that inhibit thymidylate synthase activity and their activity for FTD than for FdUrd. deoxyUTPase (DUT) did not nucleotides are incorporated into DNA. However, it is evident recognize dTTP and FTD-triphosphate (F3dTTP), whereas that several differences occur in the underlying antitumor deoxyuridine-triphosphate (dUTP) and FdUrd-triphosphate mechanisms associated with these nucleoside analogues. (FdUTP) were efficiently degraded by DUT. DNA poly- Recently, TAS-102 (composed of FTD and tipiracil hydrochlo- merase α incorporated both F3dTTP and FdUTP into DNA at ride, TPI) was shown to prolong the survival of patients with sites aligned with adenine on the opposite strand. FTD-treated colorectal cancer who received a median of 2 prior therapies, cells showed differing nuclear morphologies compared to including 5-FU. TAS-102 was recently approved for clinical FdUrd-treated cells. These findings indicate that FTD and use in Japan.
    [Show full text]
  • Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization
    electronic reprint Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights Gergely Rona,´ Mary Marfori, Mat´ e´ Borsos, Ildiko´ Scheer, EnikoTak˝ acs,´ Judit Toth,´ Fruzsina Babos, Anna Magyar, Anna Erdei, Zoltan´ Bozoky,´ Laszl´ o´ Buday, Bostjan Kobe and Beata´ G. Vertessy´ Acta Cryst. (2013). D69, 2495–2505 Copyright c International Union of Crystallography Author(s) of this paper may load this reprint on their own web site or institutional repository provided that this cover page is retained. Republication of this article or its storage in electronic databases other than as specified above is not permitted without prior permission in writing from the IUCr. For further information see http://journals.iucr.org/services/authorrights.html Acta Crystallographica Section D: Biological Crystallography welcomes the submission of papers covering any aspect of structural biology, with a particular emphasis on the struc- tures of biological macromolecules and the methods used to determine them. Reports on new protein structures are particularly encouraged, as are structure–function papers that could include crystallographic binding studies, or structural analysis of mutants or other modified forms of a known protein structure. The key criterion is that such papers should present new insights into biology, chemistry or structure. Papers on crystallo- graphic methods should be oriented towards biological crystallography, and may include new approaches to any aspect of structure determination or analysis. Papers on the crys- tallization of biological molecules will be accepted providing that these focus on new methods or other features that are of general importance or applicability.
    [Show full text]
  • Regulation of Human Dutpase Gene Expression and P53-Mediated Transcriptional Repression in Response to Oxaliplatin-Induced DNA Damage Peter M
    78–95 Nucleic Acids Research, 2009, Vol. 37, No. 1 Published online 16 November 2008 doi:10.1093/nar/gkn910 Regulation of human dUTPase gene expression and p53-mediated transcriptional repression in response to oxaliplatin-induced DNA damage Peter M. Wilson1, William Fazzone1, Melissa J. LaBonte1, Heinz-Josef Lenz2 and Robert D. Ladner1,* 1Department of Pathology and 2Division of Medical Oncology, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, CA 90033, USA Received May 19, 2008; Revised October 28, 2008; Accepted October 29, 2008 ABSTRACT INTRODUCTION Deoxyuridine triphosphate nucleotidohydrolase Deoxyuridine triphosphate nucleotidohydrolase (dUT (dUTPase) catalyzes the hydrolysis of dUTP to Pase) is the sole enzyme responsible for the hydrolysis of dUMP and PPi. Although dUTP is a normal intermedi- dUTP to dUMP and pyrophosphate simultaneously pro- ate in DNA synthesis, its accumulation and misincor- viding substrate for thymidylate synthase (TS) and elim- poration into DNA is lethal. Importantly, uracil inating dUTP from the DNA biosynthetic pathway. Although dUTP is a normal intermediate in DNA synth- misincorporation is a mechanism of cytotoxicity esis, its extensive accumulation and misincorporation induced by fluoropyrimidine chemotherapeutic into DNA is lethal in both prokaryotic and eukaryotic agents including 5-fluorouracil (5-FU) and elevated organisms as evidenced from knockout models (1,2). expression of dUTPase is negatively correlated Importantly, uracil misincorporation also represents with clinical response to 5-FU-therapy. In this study a major mechanism of cytotoxicity induced by the we performed the first functional characterization of TS-inhibitor class of chemotherapeutic agents including the dUTPase promoter and demonstrate a role for the fluoropyrimidines 5-fluorouracil (5-FU), fluorodeox- E2F-1 and Sp1 in driving dUTPase expression.
    [Show full text]
  • Targeting Nucleotide Metabolism Enhances the Efficacy of Anthracyclines and Anti-Metabolites in Triple-Negative Breast Cancer
    www.nature.com/npjbcancer ARTICLE OPEN Targeting nucleotide metabolism enhances the efficacy of anthracyclines and anti-metabolites in triple-negative breast cancer Craig Davison1, Roisin Morelli1, Catherine Knowlson1, Melanie McKechnie1, Robbie Carson1, Xanthi Stachtea1, Kylie A. McLaughlin2, Vivien E. Prise2, Kienan Savage 1, Richard H. Wilson3, Karl A. Mulligan2, Peter M. Wilson2, Robert D. Ladner1,5 and ✉ Melissa J. LaBonte 1,4,5 Triple-negative breast cancer (TNBC) remains the most lethal breast cancer subtype with poor response rates to the current chemotherapies and a lack of additional effective treatment options. We have identified deoxyuridine 5′-triphosphate nucleotidohydrolase (dUTPase) as a critical gatekeeper that protects tumour DNA from the genotoxic misincorporation of uracil during treatment with standard chemotherapeutic agents commonly used in the FEC regimen. dUTPase catalyses the hydrolytic dephosphorylation of deoxyuridine triphosphate (dUTP) to deoxyuridine monophosphate (dUMP), providing dUMP for thymidylate synthase as part of the thymidylate biosynthesis pathway and maintaining low intracellular dUTP concentrations. This is crucial as DNA polymerase cannot distinguish between dUTP and deoxythymidylate triphosphate (dTTP), leading to dUTP misincorporation into DNA. Targeting dUTPase and inducing uracil misincorporation during the repair of DNA damage induced by fluoropyrimidines or anthracyclines represents an effective strategy to induce cell lethality. dUTPase inhibition significantly sensitised TNBC cell lines 1234567890():,; to fluoropyrimidines and anthracyclines through imbalanced nucleotide pools and increased DNA damage leading to decreased proliferation and increased cell death. These results suggest that repair of treatment-mediated DNA damage requires dUTPase to prevent uracil misincorporation and that inhibition of dUTPase is a promising strategy to enhance the efficacy of TNBC chemotherapy.
    [Show full text]
  • The Role of a Key Amino Acid Position in Species- Specific Proteinaceous Dutpase Inhibition
    Article The Role of a Key Amino Acid Position in Species- Specific Proteinaceous dUTPase Inhibition András Benedek 1,2,*, Fanni Temesváry-Kis 1, Tamjidmaa Khatanbaatar 1, Ibolya Leveles 1,2, Éva Viola Surányi 1,2, Judit Eszter Szabó 1,2, Lívius Wunderlich 1 and Beáta G. Vértessy 1,2,* 1 Budapest University of Technology and Economics, Department of Applied Biotechnology and Food Science, H -1111 Budapest, Szent Gellért tér 4, Hungary; [email protected] (F.T-K.); [email protected] (T.K.); [email protected] (L.W.) 2 Research Centre for Natural Sciences, Hungarian Academy of Sciences, H-1117 Budapest, Magyar tudósok körútja 2, Hungary; [email protected] (I.L.); [email protected] (É.V.S.); [email protected] (J.E.S.) * Correspondence: [email protected] (A.B.); [email protected] (B.G.V.) Received: 14 May 2019; Accepted: 27 May 2019; Published: 6 June 2019 Abstract: Protein inhibitors of key DNA repair enzymes play an important role in deciphering physiological pathways responsible for genome integrity, and may also be exploited in biomedical research. The staphylococcal repressor StlSaPIbov1 protein was described to be an efficient inhibitor of dUTPase homologues showing a certain degree of species-specificity. In order to provide insight into the inhibition mechanism, in the present study we investigated the interaction of StlSaPIbov1 and Escherichia coli dUTPase. Although we observed a strong interaction of these proteins, unexpectedly the E. coli dUTPase was not inhibited. Seeking a structural explanation for this phenomenon, we identified a key amino acid position where specific mutations sensitized E.
    [Show full text]
  • CRISPR/Cas9-Mediated Knock-Out of Dutpase in Mice Leads to Early Embryonic Lethality
    bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. CRISPR/Cas9-mediated knock-out of dUTPase in mice leads to early embryonic lethality Hajnalka Laura Pálinkás1,2*, Gergely Rácz 1,3, Zoltán Gál4, Orsolya Hoffmann4, Gergely Tihanyi1,3, Elen Gócza4*, László Hiripi4*, Beáta G. Vértessy1,3* *Corresponding authors 1Institute of Enzymology, RCNS, Hungarian Academy of Sciences, Budapest, Hungary 2Doctoral School of Multidisciplinary Medical Science, University of Szeged, Szeged, Hungary 3Department of Applied Biotechnology and Food Sciences, Budapest University of Technology and Economics, Budapest, Hungary 4Department of Animal Biotechnology, Agricultural Biotechnology Institute, National Agricultural Research and Innovation Centre, Gödöllő, Hungary Correspondence and requests for materials should be addressed to Beáta G. Vértessy (email: [email protected]). Correspondence may also be addressed to Hajnalka Laura Pálinkás ([email protected]), Elen Gócza ([email protected]), and László Hiripi ([email protected]). 1 bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Sanitization of nucleotide pools is essential for genome maintenance. Among the enzymes significant in this mechanism, deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) performs cleavage of dUTP into dUMP and inorganic pyrophosphate. By this reaction the enzyme efficiently prevents uracil incorporation into DNA and provides dUMP, the substrate for de novo thymidylate biosynthesis.
    [Show full text]
  • The Relationship Between Dntp Pool Levels and Mutagenesis in an Escherichia Coli NDP Kinase Mutant
    The relationship between dNTP pool levels and mutagenesis in an Escherichia coli NDP kinase mutant Jared Nordman and Andrew Wright* Department of Molecular Biology and Microbiology, Tufts University School of Medicine, 136 Harrison Avenue, Boston, MA 02111 Edited by Jonathan Beckwith, Harvard Medical School, Boston, MA, and approved May 6, 2008 (received for review March 27, 2008) Loss of nucleoside diphosphate kinase (Ndk) function in Escherichia The human genome contains eight Ndk paralogues, Nm23 coli results in an increased frequency of spontaneous mutation and H1–H8, which have been implicated in multiple cellular pro- an imbalance in dNTP pool levels. It is presumed that the imbalance cesses. For example, human NDP kinase (nm23-H1) was initially in dNTP pool levels is responsible for the mutator phenotype of an identified as a suppressor of tumor metastasis by using meta- E. coli ndk mutant. A human homologue of Ndk and potential static melanoma cell lines (17). Nm23-H2 has been shown to suppressor of tumor metastasis, nm23-H2, can complement the cleave DNA in a mechanism similar to that of the AP lyase family mutagenic phenotype of an E. coli ndk mutant. Here, we show that of DNA repair enzymes, and directly regulate expression of the the antimutagenic property of nm23-H2 in E. coli is independent of c-MYC oncogene (18, 19). Mutational loss of NDP kinase dNTP pool levels, indicating that dNTP pool imbalance is not function in Drosophila leads to developmental defects (20). responsible for the mutator phenotype associated with the loss of Interestingly, restoration of NDP kinase enzymatic activity is ndk function.
    [Show full text]
  • Disruption of Nucleocytoplasmic Trafficking As a Cellular Senescence
    www.nature.com/emm ARTICLE OPEN Disruption of nucleocytoplasmic trafficking as a cellular senescence driver Ji-Hwan Park1,14, Sung Jin Ryu2,13,14, Byung Ju Kim3,13,14, Hyun-Ji Cho3, Chi Hyun Park4, Hyo Jei Claudia Choi2, Eun-Jin Jang3, Eun Jae Yang5, Jeong-A Hwang5, Seung-Hwa Woo5, Jun Hyung Lee5, Ji Hwan Park5, Kyung-Mi Choi6, Young-Yon Kwon6, 6 7 3 3 8 9 10 5 ✉ Cheol-Koo Lee , Joon✉ Tae Park , Sung✉ Chun Cho , Yun-Il Lee , Sung✉ Bae Lee , Jeong A. Han , Kyung A. Cho , Min-Sik Kim , Daehee Hwang11 , Young-Sam Lee3,5 and Sang Chul Park3,12 © The Author(s) 2021 Senescent cells exhibit a reduced response to intrinsic and extrinsic stimuli. This diminished reaction may be explained by the disrupted transmission of nuclear signals. However, this hypothesis requires more evidence before it can be accepted as a mechanism of cellular senescence. A proteomic analysis of the cytoplasmic and nuclear fractions obtained from young and senescent cells revealed disruption of nucleocytoplasmic trafficking (NCT) as an essential feature of replicative senescence (RS) at the global level. Blocking NCT either chemically or genetically induced the acquisition of an RS-like senescence phenotype, named nuclear barrier-induced senescence (NBIS). A transcriptome analysis revealed that, among various types of cellular senescence, NBIS exhibited a gene expression pattern most similar to that of RS. Core proteomic and transcriptomic patterns common to both RS and NBIS included upregulation of the endocytosis-lysosome network and downregulation of NCT in senescent cells, patterns also observed in an aging yeast model.
    [Show full text]
  • Uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer
    A Predictive Signature for Oxaliplatin and 5- uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer Qinchuan Wang Zhejiang University https://orcid.org/0000-0002-2370-6714 Xiyong Liu City of Hope National Medical Center Chen Chen Zhejiang University Jida Chen Zhejiang University Beisi Xu Saint Jude Children's Research Hospital Lini Chen Zhejiang University Jichun Zhou Zhejiang University Yasheng Huang Hangzhou Hospital of Traditional Chinese Medicine Wenjun Chen Zhejiang University Rongyue Teng Zhejiang University Wenhe Zhao Zhejiang University Lidan Jin Zhejiang University Jun Shen Zhejiang University Jianguo Shen Zhejiang University Yun Yen ( [email protected] ) Linbo Wang Zhejiang University Page 1/23 Research Keywords: Locally advanced gastric cancer, adjuvant chemotherapy, overall survival, prediction, mutation Posted Date: June 12th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-34678/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/23 Abstract Background: Adjuvantchemotherapy(AC)plays a substantial role in the treatment of locally advanced gastric cancer (LAGC), but the response remains poor. Weaims to improve its ecacy in LAGC. Methods: We identied the expression of eight genes closely associated with platinum and uorouracil metabolism (RRM1, RRM2, RRM2B, POLH, DUT, TYMS, TYMP, MKI67) in the discovery cohort (N=291). And we further validated the ndings in TCGA (N=279) and GEO. Overall survival (OS) was used as an endpoint. Univariate and multivariate Cox models were applied. A multivariate Cox regression model was simulated to predict theOS. Results: In the discovery cohort,the univariate Coxmodelindicated that AC was benecial to high-RRM1, high-DUT, low-RRM2, low-RRM2B, low-POLH, low-KI67, low-TYMS or low-TYMP patients, the results were validated in the TCGA cohort.
    [Show full text]
  • Novel Opportunities for Thymidylate Metabolism As a Therapeutic Target
    3029 Novel opportunities for thymidylate metabolism as a therapeutic target Peter M. Wilson,1 William Fazzone,1 small-molecule inhibitor to dUTPase represents a viable Melissa J. LaBonte,1 Jinxia Deng,2 strategy to improve the clinical efficacy of these mainstay Nouri Neamati,2 and Robert D. Ladner1 chemotherapeutic agents. [Mol Cancer Ther 2008; 7(9):3029–37] 1Department of Pathology, Norris Comprehensive Cancer Center, Keck School of Medicine, and 2Department of Pharmacology and Pharmaceutical Sciences, School of Pharmacy, University of Southern California, Los Angeles, California Introduction The fluoropyrimidine 5-fluorouracil (5-FU) is widely used in the treatment of a range of cancers, including breast Abstract cancers, and cancers of the aerodigestive and gastrointes- For over 40 years, the fluoropyrimidine 5-fluorouracil tinal tract (1). However, 5-FU has had the greatest effect (5-FU) has remained the central agent in therapeutic and is arguably the most successful drug approved to date regimens employed in the treatment of colorectal cancer for the treatment of colorectal cancer. Throughout 50 years and is frequently combined with the DNA-damaging of clinical development, the response rate of advanced agents oxaliplatin and irinotecan, increasing response colorectal cancer chemotherapy using 5-FU and 5-FU-based rates and improving overall survival. However, many combinations has improved from 10% to 15% to 40% to patients will derive little or no benefit from treatment, 50% primarily due to the introduction of efficacious combi- highlighting the need to identify novel therapeutic targets nation partners such as the topoisomerase I inhibitor to improve the efficacy of current 5-FU-based chemother- irinotecan and the platinum agent oxaliplatin and deter- apeutic strategies.
    [Show full text]