DOCSLIB.ORG

Disruption of Nucleocytoplasmic Trafficking As a Cellular Senescence

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text

Load more

www.nature.com/emm ARTICLE OPEN Disruption of nucleocytoplasmic trafficking as a cellular senescence driver Ji-Hwan Park1,14, Sung Jin Ryu2,13,14, Byung Ju Kim3,13,14, Hyun-Ji Cho3, Chi Hyun Park4, Hyo Jei Claudia Choi2, Eun-Jin Jang3, Eun Jae Yang5, Jeong-A Hwang5, Seung-Hwa Woo5, Jun Hyung Lee5, Ji Hwan Park5, Kyung-Mi Choi6, Young-Yon Kwon6, 6 7 3 3 8 9 10 5 ✉ Cheol-Koo Lee , Joon✉ Tae Park , Sung✉ Chun Cho , Yun-Il Lee , Sung✉ Bae Lee , Jeong A. Han , Kyung A. Cho , Min-Sik Kim , Daehee Hwang11 , Young-Sam Lee3,5 and Sang Chul Park3,12 © The Author(s) 2021 Senescent cells exhibit a reduced response to intrinsic and extrinsic stimuli. This diminished reaction may be explained by the disrupted transmission of nuclear signals. However, this hypothesis requires more evidence before it can be accepted as a mechanism of cellular senescence. A proteomic analysis of the cytoplasmic and nuclear fractions obtained from young and senescent cells revealed disruption of nucleocytoplasmic trafficking (NCT) as an essential feature of replicative senescence (RS) at the global level. Blocking NCT either chemically or genetically induced the acquisition of an RS-like senescence phenotype, named nuclear barrier-induced senescence (NBIS). A transcriptome analysis revealed that, among various types of cellular senescence, NBIS exhibited a gene expression pattern most similar to that of RS. Core proteomic and transcriptomic patterns common to both RS and NBIS included upregulation of the endocytosis-lysosome network and downregulation of NCT in senescent cells, patterns also observed in an aging yeast model. These results imply coordinated aging-dependent reduction in the transmission of extrinsic signals to the nucleus and in the nucleus-to-cytoplasm supply of proteins/RNAs. We further showed that the aging-associated decrease in Sp1 transcription factor expression was critical for the downregulation of NCT. Our results suggest that NBIS is a modality of cellular senescence that may represent the nature of physiological aging in eukaryotes. Experimental & Molecular Medicine (2021) 53:1092–1108; https://doi.org/10.1038/s12276-021-00643-6 INTRODUCTION An increasing amount of evidence has indicated a novel Cellular senescence is characterized by the arrest of cell proliferation, senescence-associated feature, i.e., resistance to intrinsic and extrinsic which can be induced by various intrinsic and extrinsic stress factors; signals7–9. This resistance can be explained by a novel concept, i.e., according to these factors, cellular senescence can be categorized as dysfunctional transmission of signals between the cytoplasm and replicative senescence (RS), which is caused by long-term cell nucleus10–13. Under normal conditions, nucleocytoplasmic trafficking division; oncogene-induced senescence (OIS); DNA damage-induced (NCT) proteins14 select signals that can pass through the nuclear senescence (DDIS); and oxidative stress-induced senescence (OSIS). membrane through a process called selective permeability during All these types of senescence share common senescent hallmarks, signal transduction. For example, NCT is activated by the Ran protein such as permanent growth arrest, genomic instability, senescence- gradient across a nuclear pore13. Disruption of the Ran gradient is associated β-galactosidase (SA-β-gal) expression, the senescence- frequently observed in senescent cells, including DDIS models15,and associated secretory phenotype, and heterochromatin foci forma- in fibroblasts of patients with Hutchinson-Gilford progeria syn- tion1 in addition to common transcriptomic signatures of cellular drome16. Correspondingly, depletion of the Ran protein in mouse senescence2. However, several differential senescence-associated embryonic fibroblasts accelerates cellular senescence17.Agedyeast features unique to these individual modalities lead to the question cells also show decreased transport across the nuclear membrane18. of the nature of physiological aging. The shared and distinctive Moreover, the nuclear entry of Sp1, a key transcription factor that features of the individual cellular senescence models have been induces the expression of NCT-related genes, is decreased in extensively reviewed3–6. senescent cells19. Furthermore, secondary mitotic and apoptotic 1Korea Bioinformation Center, Korea Research Institute of Bioscience & Biotechnology, Daejeon 34141, Republic of Korea. 2Samsung Advanced Institute of Technology, Samsung Electronics Co., Ltd., Suwon 16677, Republic of Korea. 3Present address: Well Aging Research Center, Division of Biotechnology, DGIST, Daegu 42988, Republic of Korea. 4Department of Computer Science and Engineering, Kangwon National University, Chuncheon 24341, Republic of Korea. 5Department of New Biology, DGIST, Daegu 42988, Republic of Korea. 6Department of Biotechnology, College of Life Sciences and Biotechnology, Korea University, Seoul 02841, Republic of Korea. 7Division of Life Sciences, College of Life Sciences and Bioengineering, Incheon National University, Incheon 22012, Republic of Korea. 8Department of Brain & Cognitive Science, DGIST, Daegu 42988, Republic of Korea. 9Department of Biochemistry and Molecular Biology, Kangwon National University School of Medicine, Chuncheon 24341, Republic of Korea. 10Department of Biochemistry, Chonnam National University, Medical School, Gwangju 61469, Republic of Korea. 11Department of Biological Sciences, Seoul National University, Seoul 08826, Republic of Korea. 12The Future Life & Society Research Center, Advanced Institute of Aging Science, Chonnam National University, Gwangju 61469, Republic of Korea. 13Present address: UBLBio Corporation, Suwon 16679, ✉ Republic of Korea. 14These authors contributed equally: Ji-Hwan Park, Sung Jin Ryu, Byung Ju Kim. email: [email protected]; [email protected]; [email protected]; scpark@snu. ac.kr Received: 13 October 2020 Revised: 20 April 2021 Accepted: 10 May 2021 Published online: 29 June 2021 J.-H. Park et al. 1093 a Young Old LMB-treated d (n=3) (n=3) (n=3) Nucleus Cytoplasm Nucleus Cell cycle Cytoplasm DNA replication Cell cycle DNA repair Tryptic digestion chromosome organization Spliceosome Peptide samples RNA processing RNA processing & 10-plex TMT labeling RNA transport transport ribosome assembly TMT labeled peptides (2 sets) Ribosome biogenesis in eukaryotes Universal nuclear export Nucleocytoplasmic Young Old LMB-treated reference nuclear import trafficking 126 127N 127C 128N 128C 129N 129C 130N 130C 131 Nucleus integrin-mediated signaling pathway (set 1) endocytosis Endocytic & Cytoplasm lysosome network (set 2) Lysosome mitochondrial transport Mitochondrial organization & mitochondrion organization transport Fatty acid metabolism Glucose & fatty acid mid-pH reverse phase mRP metabolism (mRP) fractionation Glycolysis / Gluconeogenesis immune response-activating signal transduction 24 mRP peptide fractions innate immune response Immune response, Intracellular signaling cytokine-mediated signaling pathway Nucleus Cytoplasm small GTPase mediated LC-MS/MS signal transduction 1234567890();,: Easy-nLC & Q-Exactive Ras protein signal transduction 24 LC-MS/MS dataset 24 LC-MS/MS dataset 6 006 (Nucleus, Set 1) (Cytoplasm, Set 2) Z-score Up Down Z-score b e Nucleus Cytoplasm HDFs 16 16 p7 p23 p33 p42 p47 p53 (DT, day) 1 1.5 5 8 10 14 kDa - 70 12 Down Up 12 Down Up Imp α1 (389) (336) (213) (270) value) 8 8 - 100 P Imp β ( 10 -log 4 4 CRM1 - 100 - 50 0 0 RCC1 -6-4-20246-6 -4 -2 0 2 4 6 - 25 log2-fold-change log2-fold-change RanBP1 c Up Down pS10H3 - 15 Nucleus Cytoplasm Nucleus Cytoplasm (336) (270) (389) (213) p53 - 50 p16 - 15 311 25 245 375 14 199 Actin - 40 signals, such as signals transmitted through the p-ERK, p-P38, and p- functional concept formed on the basis of dysregulated NCT proteins Jun kinase signaling pathways, are trapped in the cytoplasm of in senescent cells. This barrier disrupts the selective permeability of senescent cells8,19–23. Considering the findings showing that NCT is signals passing through the nuclear membrane, which is actively disrupted during cellular senescence, we previously proposed a modulated by intact NCT proteins. This nuclear barrier hypothesis nuclear barrier hypothesis of aging12,24. The nuclear barrier is a was originally based on the expression of several molecular markers; Experimental & Molecular Medicine (2021) 53:1092 – 1108 J.-H. Park et al. 1094 Fig. 1 Proteomic analysis reveals the presence of a nuclear barrier in senescent cells. a Overall scheme of proteomic analysis of nuclear and cytoplasmic fractions of young, senescent (RS), and leptomycin B-treated (LMB-NBIS) HDFs. Three biological replicates (n = 3) were analyzed. Sets 1 and 2, nuclear and cytoplasmic fractions, respectively; tandem mass tag (TMT) 126, 127N, and 127C for young HDFs; TMT 128N, 128C, and 129N for RS; and TMT 129C, 130N, and 130C for LMB-NBIS. b Volcano plots showing upregulated (red) and downregulated (blue) proteins in the nucleus (left) and cytoplasm (right). c Relationships between upregulated (left) or downregulated (right) proteins in the nucleus and cytoplasm of RS. d Cellular processes (GOBPs) significantly (P < 0.1) enriched by upregulated (red) or downregulated (blue) genes in RS. The Z- score indicates –N-1(P), where P is the enrichment P value determined with DAVID software and N−1(·) is the inverse normal distribution. e Immunoblot of NCT-related proteins using whole-cell lysates of HDFs at different passages during senescence. Doubling times (DTs) corresponding to passage numbers are shown.
Recommended publications
  • Differential Control of Dntp Biosynthesis and Genome Integrity

    Differential Control of Dntp Biosynthesis and Genome Integrity

    www.nature.com/scientificreports OPEN Diferential control of dNTP biosynthesis and genome integrity maintenance by the dUTPase Received: 6 November 2015 Accepted: 12 June 2017 superfamily enzymes Published online: 20 July 2017 Rita Hirmondo1, Anna Lopata1, Eva Viola Suranyi1,2, Beata G. Vertessy1,2 & Judit Toth1 dUTPase superfamily enzymes generate dUMP, the obligate precursor for de novo dTTP biosynthesis, from either dUTP (monofunctional dUTPase, Dut) or dCTP (bifunctional dCTP deaminase/dUTPase, Dcd:dut). In addition, the elimination of dUTP by these enzymes prevents harmful uracil incorporation into DNA. These two benefcial outcomes have been thought to be related. Here we determined the relationship between dTTP biosynthesis (dTTP/dCTP balance) and the prevention of DNA uracilation in a mycobacterial model that encodes both the Dut and Dcd:dut enzymes, and has no other ways to produce dUMP. We show that, in dut mutant mycobacteria, the dTTP/dCTP balance remained unchanged, but the uracil content of DNA increased in parallel with the in vitro activity-loss of Dut accompanied with a considerable increase in the mutation rate. Conversely, dcd:dut inactivation resulted in perturbed dTTP/dCTP balance and two-fold increased mutation rate, but did not increase the uracil content of DNA. Thus, unexpectedly, the regulation of dNTP balance and the prevention of DNA uracilation are decoupled and separately brought about by the Dcd:dut and Dut enzymes, respectively. Available evidence suggests that the discovered functional separation is conserved in humans and other organisms. Proper control of the intracellular concentration of deoxyribonucleoside-5-triphosphates (dNTPs), the building blocks of DNA, is critically important for efcient and high-fdelity DNA replication and genomic stability1, 2.
  • DUT (NM 001948) Human Tagged ORF Clone Product Data

    DUT (NM 001948) Human Tagged ORF Clone Product Data

    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221635 DUT (NM_001948) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DUT (NM_001948) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DUT Synonyms: dUTPase Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221635 representing NM_001948 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTGCTCTGAAGAGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCA TGCAGCTCCGCTTTGCCCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGG CTACGACCTGTACAGTGCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATT CAGATAGCGCTCCCTTCTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTA TTGATGTAGGAGCTGGTGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGG CAAAGAAAAGTTTGAAGTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCA GAAATAGAAGAAGTTCAAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGA AT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221635 representing NM_001948 Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag Chromatograms:
  • Reconfiguring Nature's Cholesterol Accepting Lipoproteins As

    Reconfiguring Nature's Cholesterol Accepting Lipoproteins As

    nanomaterials Review Reconfiguring Nature’s Cholesterol Accepting Lipoproteins as Nanoparticle Platforms for Transport and Delivery of Therapeutic and Imaging Agents , Skylar T. Chuang y z, Siobanth Cruz y and Vasanthy Narayanaswami * Department of Chemistry and Biochemistry, California State University, Long Beach, 1250 Bellflower Blvd, Long Beach, CA 90840, USA; [email protected] (S.T.C.); [email protected] (S.C.) * Correspondence: [email protected]; Tel.: +1-562-985-4953; Fax: +1-562-985-8557 These authors contributed equally to this work. y Current address: Department of Chemistry and Chemical Biology, Rutgers University, 123 Bevier Road, z Piscataway, NJ 08854, USA. Received: 2 March 2020; Accepted: 29 April 2020; Published: 8 May 2020 Abstract: Apolipoproteins are critical structural and functional components of lipoproteins, which are large supramolecular assemblies composed predominantly of lipids and proteins, and other biomolecules such as nucleic acids. A signature feature of apolipoproteins is the preponderance of amphipathic α-helical motifs that dictate their ability to make extensive non-covalent inter- or intra-molecular helix–helix interactions in lipid-free states or helix–lipid interactions with hydrophobic biomolecules in lipid-associated states. This review focuses on the latter ability of apolipoproteins, which has been capitalized on to reconstitute synthetic nanoscale binary/ternary lipoprotein complexes composed of apolipoproteins/peptides and lipids that mimic native high-density lipoproteins (HDLs) with the goal to transport drugs. It traces the historical development of our understanding of these nanostructures and how the cholesterol accepting property of HDL has been reconfigured to develop them as drug-loading platforms. The review provides the structural perspective of these platforms with different types of apolipoproteins and an overview of their synthesis.
  • Download Download

    Download Download

    Supplementary Figure S1. Results of flow cytometry analysis, performed to estimate CD34 positivity, after immunomagnetic separation in two different experiments. As monoclonal antibody for labeling the sample, the fluorescein isothiocyanate (FITC)- conjugated mouse anti-human CD34 MoAb (Mylteni) was used. Briefly, cell samples were incubated in the presence of the indicated MoAbs, at the proper dilution, in PBS containing 5% FCS and 1% Fc receptor (FcR) blocking reagent (Miltenyi) for 30 min at 4 C. Cells were then washed twice, resuspended with PBS and analyzed by a Coulter Epics XL (Coulter Electronics Inc., Hialeah, FL, USA) flow cytometer. only use Non-commercial 1 Supplementary Table S1. Complete list of the datasets used in this study and their sources. GEO Total samples Geo selected GEO accession of used Platform Reference series in series samples samples GSM142565 GSM142566 GSM142567 GSM142568 GSE6146 HG-U133A 14 8 - GSM142569 GSM142571 GSM142572 GSM142574 GSM51391 GSM51392 GSE2666 HG-U133A 36 4 1 GSM51393 GSM51394 only GSM321583 GSE12803 HG-U133A 20 3 GSM321584 2 GSM321585 use Promyelocytes_1 Promyelocytes_2 Promyelocytes_3 Promyelocytes_4 HG-U133A 8 8 3 GSE64282 Promyelocytes_5 Promyelocytes_6 Promyelocytes_7 Promyelocytes_8 Non-commercial 2 Supplementary Table S2. Chromosomal regions up-regulated in CD34+ samples as identified by the LAP procedure with the two-class statistics coded in the PREDA R package and an FDR threshold of 0.5. Functional enrichment analysis has been performed using DAVID (http://david.abcc.ncifcrf.gov/)
  • Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA

    Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA

    INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2327-2334, 2015 Crucial roles of thymidine kinase 1 and deoxyUTPase in incorporating the antineoplastic nucleosides trifluridine and 2'-deoxy-5-fluorouridine into DNA KAzUKI SAKAMoTo, Tatsushi YoKogAwA, HIRoYUKI UENo, KEI ogUcHI, HIRoMI KAzUNo, KEIJI ISHIDA, NozoMU TANAKA, AKIKo oSADA, YUKARI YAMADA, HIRoYUKI oKABE and KENIcHI Matsuo Drug Discovery and Development I, Discovery and Preclinical Research Division, Taiho Pharmaceutical co., Ltd., Tsukuba, Ibaraki 300-2611, Japan Received March 6, 2015; Accepted April 9, 2015 DoI: 10.3892/ijo.2015.2974 Abstract. Trifluridine (FTD) and 2'-deoxy-5-fluorouridine transported into cells by ENT1 and ENT2 and were phosphor- (FdUrd), a derivative of 5-fluorouracil (5-FU), are antitumor ylated by thymidine kinase 1, which showed a higher catalytic agents that inhibit thymidylate synthase activity and their activity for FTD than for FdUrd. deoxyUTPase (DUT) did not nucleotides are incorporated into DNA. However, it is evident recognize dTTP and FTD-triphosphate (F3dTTP), whereas that several differences occur in the underlying antitumor deoxyuridine-triphosphate (dUTP) and FdUrd-triphosphate mechanisms associated with these nucleoside analogues. (FdUTP) were efficiently degraded by DUT. DNA poly- Recently, TAS-102 (composed of FTD and tipiracil hydrochlo- merase α incorporated both F3dTTP and FdUTP into DNA at ride, TPI) was shown to prolong the survival of patients with sites aligned with adenine on the opposite strand. FTD-treated colorectal cancer who received a median of 2 prior therapies, cells showed differing nuclear morphologies compared to including 5-FU. TAS-102 was recently approved for clinical FdUrd-treated cells. These findings indicate that FTD and use in Japan.
  • Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization

    Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization

    electronic reprint Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights Gergely Rona,´ Mary Marfori, Mat´ e´ Borsos, Ildiko´ Scheer, EnikoTak˝ acs,´ Judit Toth,´ Fruzsina Babos, Anna Magyar, Anna Erdei, Zoltan´ Bozoky,´ Laszl´ o´ Buday, Bostjan Kobe and Beata´ G. Vertessy´ Acta Cryst. (2013). D69, 2495–2505 Copyright c International Union of Crystallography Author(s) of this paper may load this reprint on their own web site or institutional repository provided that this cover page is retained. Republication of this article or its storage in electronic databases other than as specified above is not permitted without prior permission in writing from the IUCr. For further information see http://journals.iucr.org/services/authorrights.html Acta Crystallographica Section D: Biological Crystallography welcomes the submission of papers covering any aspect of structural biology, with a particular emphasis on the struc- tures of biological macromolecules and the methods used to determine them. Reports on new protein structures are particularly encouraged, as are structure–function papers that could include crystallographic binding studies, or structural analysis of mutants or other modified forms of a known protein structure. The key criterion is that such papers should present new insights into biology, chemistry or structure. Papers on crystallo- graphic methods should be oriented towards biological crystallography, and may include new approaches to any aspect of structure determination or analysis. Papers on the crys- tallization of biological molecules will be accepted providing that these focus on new methods or other features that are of general importance or applicability.
  • Module IV Nucleus

    Module IV Nucleus

    Module IV Nucleus Structure and functions of interphase nucleus, Nuclear membrane, pore complex, structure and functions of nucleolus Chromosomes – Structure; Heterochromatin, Euchromatin, Nucleosomes, Nucleus is the most important part of the cell situated in the cytoplasm. All the cellular activities are controlled by it. Nucleus is a directing and organizing unit without which the cell could not exist. It was discovered by Robert Brown (1831) in flowering plants and is now recognized as the structure that contains the hereditary material of the cell. The study of nucleus or karyosome constitutes karyology. The location of nucleus varies in the cell depending upon the species. Usually it is situated in the centre of the cell surrounded on all sides by cytoplasm. In green algae, Acetabularia, it shows various positions, though mainly present in the basal part of cell. Generally the nuclei are scattered in the cytoplasm. Morphology: 1. Shape: The shape of nucleus is variable according to cell type. It is generally spheroid but ellipsoid or flattened nuclei may also occur in certain cells. The nuclear margins are generally smooth but they may be lobulated bearing small infoldings of nuclear membrane as in leucocytes. In certain white blood corpuscles the nucleus is dumbbell-shaped and exhibits variation during life history stages. In human neutrophil, it is trilobed. 2. Number: Mostly cell contains a single nucleus, known as mononucleate cell. Cells containing two nuclei are known as binucleate cells (e.g., Paramecium), and cells of cartilage and liver. Sometimes more than two nuclei (3 to 100 nuclei) are present in a single cell.
  • Molecular Genetics of Microcephaly Primary Hereditary: an Overview

    Molecular Genetics of Microcephaly Primary Hereditary: an Overview

    brain sciences Review Molecular Genetics of Microcephaly Primary Hereditary: An Overview Nikistratos Siskos † , Electra Stylianopoulou †, Georgios Skavdis and Maria E. Grigoriou * Department of Molecular Biology & Genetics, Democritus University of Thrace, 68100 Alexandroupolis, Greece; [email protected] (N.S.); [email protected] (E.S.); [email protected] (G.S.) * Correspondence: [email protected] † Equal contribution. Abstract: MicroCephaly Primary Hereditary (MCPH) is a rare congenital neurodevelopmental disorder characterized by a significant reduction of the occipitofrontal head circumference and mild to moderate mental disability. Patients have small brains, though with overall normal architecture; therefore, studying MCPH can reveal not only the pathological mechanisms leading to this condition, but also the mechanisms operating during normal development. MCPH is genetically heterogeneous, with 27 genes listed so far in the Online Mendelian Inheritance in Man (OMIM) database. In this review, we discuss the role of MCPH proteins and delineate the molecular mechanisms and common pathways in which they participate. Keywords: microcephaly; MCPH; MCPH1–MCPH27; molecular genetics; cell cycle 1. Introduction Citation: Siskos, N.; Stylianopoulou, Microcephaly, from the Greek word µικρoκεϕαλi´α (mikrokephalia), meaning small E.; Skavdis, G.; Grigoriou, M.E. head, is a term used to describe a cranium with reduction of the occipitofrontal head circum- Molecular Genetics of Microcephaly ference equal, or more that teo standard deviations
  • Sleeping Beauty Transposon Mutagenesis Identifies Genes That

    Sleeping Beauty Transposon Mutagenesis Identifies Genes That

    Sleeping Beauty transposon mutagenesis identifies PNAS PLUS genes that cooperate with mutant Smad4 in gastric cancer development Haruna Takedaa,b, Alistair G. Rustc,d, Jerrold M. Warda, Christopher Chin Kuan Yewa, Nancy A. Jenkinsa,e, and Neal G. Copelanda,e,1 aDivision of Genomics and Genetics, Institute of Molecular and Cell Biology, Agency for Science, Technology and Research, Singapore 138673; bDepartment of Pathology, School of Medicine, Kanazawa Medical University, Ishikawa 920-0293, Japan; cExperimental Cancer Genetics, Wellcome Trust Sanger Institute, Cambridge CB10 1HH, United Kingdom; dTumour Profiling Unit, The Institute of Cancer Research, Chester Beatty Laboratories, London SW3 6JB, United Kingdom; and eCancer Research Program, Houston Methodist Research Institute, Houston, TX 77030 Contributed by Neal G. Copeland, February 27, 2016 (sent for review October 15, 2015; reviewed by Yoshiaki Ito and David A. Largaespada) Mutations in SMAD4 predispose to the development of gastroin- animal models that mimic human GC, researchers have infected testinal cancer, which is the third leading cause of cancer-related mice with H. pylori and then, treated them with carcinogens. They deaths. To identify genes driving gastric cancer (GC) development, have also used genetic engineering to develop a variety of trans- we performed a Sleeping Beauty (SB) transposon mutagenesis genic and KO mouse models of GC (10). Smad4 KO mice are one + − screen in the stomach of Smad4 / mutant mice. This screen iden- GC model that has been of particular interest to us (11, 12). tified 59 candidate GC trunk drivers and a much larger number of Heterozygous Smad4 KO mice develop polyps in the pyloric re- candidate GC progression genes.
  • The Role of the Rho Gtpases in Neuronal Development

    The Role of the Rho Gtpases in Neuronal Development

    Downloaded from genesdev.cshlp.org on September 24, 2021 - Published by Cold Spring Harbor Laboratory Press REVIEW The role of the Rho GTPases in neuronal development Eve-Ellen Govek,1,2, Sarah E. Newey,1 and Linda Van Aelst1,2,3 1Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 11724, USA; 2Molecular and Cellular Biology Program, State University of New York at Stony Brook, Stony Brook, New York, 11794, USA Our brain serves as a center for cognitive function and and an inactive GDP-bound state. Their activity is de- neurons within the brain relay and store information termined by the ratio of GTP to GDP in the cell and can about our surroundings and experiences. Modulation of be influenced by a number of different regulatory mol- this complex neuronal circuitry allows us to process that ecules. Guanine nucleotide exchange factors (GEFs) ac- information and respond appropriately. Proper develop- tivate GTPases by enhancing the exchange of bound ment of neurons is therefore vital to the mental health of GDP for GTP (Schmidt and Hall 2002); GTPase activat- an individual, and perturbations in their signaling or ing proteins (GAPs) act as negative regulators of GTPases morphology are likely to result in cognitive impairment. by enhancing the intrinsic rate of GTP hydrolysis of a The development of a neuron requires a series of steps GTPase (Bernards 2003; Bernards and Settleman 2004); that begins with migration from its birth place and ini- and guanine nucleotide dissociation inhibitors (GDIs) tiation of process outgrowth, and ultimately leads to dif- prevent exchange of GDP for GTP and also inhibit the ferentiation and the formation of connections that allow intrinsic GTPase activity of GTP-bound GTPases (Zalc- it to communicate with appropriate targets.
  • Nuclear Pore Complexes and Nucleocytoplasmic Exchange

    Nuclear Pore Complexes and Nucleocytoplasmic Exchange

    Pore Relations: Nuclear Pore Complexes and Nucleocytoplasmic Exchange Michael P. Rout and John D. Aitchison Laboratory of Cellular and Structural Biology The Rockefeller University, 1230 York Ave, New York, NY 10021 USA [email protected] 212 327 8135 Department of Cell Biology University of Alberta Edmonton, Alberta T6G 2H7 Canada [email protected] 780 492 6062 1 Introduction One of the main characteristics distinguishing eukaryotes from prokaryotes is that eukaryotes compartmentalize many life processes within membrane bound organelles. The most obvious of these is the nucleus, bounded by a double-membraned nuclear envelope (NE). The NE thus acts as a barrier separating the nucleoplasm from the cytoplasm. An efficient, regulated and continuous exchange system between the nucleoplasm and cytoplasm is therefore necessary to maintain the structures of the nucleus and the communication between the genetic material and the rest of the cell. The sole mediators of this exchange are the nuclear pore complexes (NPCs), large proteinaceous assemblies embedded within reflexed pores of the NE membranes (Davis, 1995). While small molecules (such as nucleotides, water and ions) can freely diffuse across the NPCs, macromolecules such as proteins and ribonucleoprotein (RNP) particles are actively transported in a highly regulated and selective manner. Transport through the NPC requires specific soluble factors which recognize transport substrates in either the nucleoplasm or cytoplasm and mediate their transport by docking them to specific components of the NPC (Mattaj and Englmeier, 1998). In order to understand how transport works, we must first catalog the soluble transport factors and NPC components, and then study the details of how they interact.
  • LRP1B Mutations Are Associated with Favorable Outcomes to Immune Checkpoint Inhibitors Across Multiple Cancer Types

    LRP1B Mutations Are Associated with Favorable Outcomes to Immune Checkpoint Inhibitors Across Multiple Cancer Types

    Open access Original research J Immunother Cancer: first published as 10.1136/jitc-2020-001792 on 2 March 2021. Downloaded from LRP1B mutations are associated with favorable outcomes to immune checkpoint inhibitors across multiple cancer types 1 2 3 4 Landon C Brown , Matthew D Tucker , Ramy Sedhom, Eric B Schwartz, 5 1 1 1 Jason Zhu, Chester Kao, Matthew K Labriola , Rajan T Gupta, 1 6 1 1 1 Daniele Marin, Yuan Wu, Santosh Gupta, Tian Zhang , Michael R Harrison, Daniel J George,1 Ajjai Alva,4 Emmanuel S Antonarakis,3 Andrew J Armstrong1 To cite: Brown LC, Tucker MD, ABSTRACT lung cancer (NSCLC) and renal cell carci- Sedhom R, et al. LRP1B Background Low- density lipoprotein receptor- related noma.1–3 However, not all patients respond mutations are associated with protein 1b (encoded by LRP1B) is a putative tumor favorable outcomes to immune to treatment with ICIs. The use of predictive suppressor, and preliminary evidence suggests LRP1B- checkpoint inhibitors across biomarkers for response has been explored mutated cancers may have improved outcomes with multiple cancer types. Journal in many tumor types with varying degrees immune checkpoint inhibitors (ICI). for ImmunoTherapy of Cancer of success. Programmed-death ligand-1 (PD- Methods We conducted a multicenter, retrospective pan- 2021;9:e001792. doi:10.1136/ L1) expression,1 microsatellite instability jitc-2020-001792 cancer analysis of patients with LRP1B alterations treated 4 with ICI at Duke University, Johns Hopkins University (JHU) (MSI)/mismatch repair deficiency and 5 6 These data were presented at and University of Michigan (UM). The primary objective tumor mutational burden (TMB) are the the ASCO annual meeting 2020, was to assess the association between overall response only FDA- approved predictive biomarkers for Abstract # 3007.