DOCSLIB.ORG

Dutpase (DUT ) Is Mutated in a Novel Monogenic Syndrome with Diabetes and Bone Marrow Failure

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Dutpase (DUT ) Is Mutated in a Novel Monogenic Syndrome with Diabetes and Bone Marrow Failure 1086 Diabetes Volume 66, April 2017 Reinaldo Sousa Dos Santos,1 Mathilde Daures,2 Anne Philippi,2 Sophie Romero,2 Lorella Marselli,3 Piero Marchetti,3 Valérie Senée,2 Delphine Bacq,4 Céline Besse,4 Baz Baz,5 Laura Marroquí,1 Sarah Ivanoff,6 Julien Masliah-Planchon,6 Marc Nicolino,7 Jean Soulier,6 Gérard Socié,8 Decio L. Eizirik,1 Jean-François Gautier,5 and Cécile Julier2 dUTPase (DUT ) Is Mutated in a Novel Monogenic Syndrome With Diabetes and Bone Marrow Failure Diabetes 2017;66:1086–1096 | DOI: 10.2337/db16-0839 We describe a new syndrome characterized by early- tight control of DNA metabolism for b-cell integrity and onset diabetes associated with bone marrow failure, warrant close metabolic monitoring of patients treated by affecting mostly the erythrocytic lineage. Using whole- drugs affecting dUTP balance. exome sequencing in a remotely consanguineous patient from a family with two affected siblings, we Diabetes may be caused by rare monogenic mutations, fi identi ed a single homozygous missense mutation accounting for 1%–5% of all cases of the disease (1,2), > (chr15.hg19:g.48,626,619A G) located in the dUTPase i.e., .2 million individuals worldwide. These mutations DUT ( ) gene (National Center for Biotechnology Informa- have been identified in the context of familial or atypical tion Gene ID 1854), affecting both the mitochondrial clinical presentations, which may affect various organs (DUT-M p.Y142C) and the nuclear (DUT-N p.Y54C) iso- (1,2). Some of these monogenic diabetes entities remain forms. We found the same homozygous mutation in an unrecognized as such and are currently misdiagnosed as unrelated consanguineous patient with diabetes and bone marrow aplasia from a family with two affected siblings, type 1 diabetes (T1D) or type 2 diabetes (T2D). Rare syn- whereas none of the >60,000 subjects from the Exome dromic associations may be particularly challenging to rec- fi Aggregation Consortium (ExAC) was homozygous for this ognize as speci c entities due to the high prevalence of fi mutation. This replicated observation probability was diabetes. The identi cation and study of familial cases is highly significant, thus confirming the role of this DUT of critical importance in this situation. The recognition of mutation in this syndrome. DUT is a key enzyme for main- these rare monogenic entities and their clinical and genetic taining DNA integrity by preventing misincorporation of characterization is important for correct diagnosis and to uracil into DNA, which results in DNA toxicity and cell improve patient’s treatment, besides providing informa- GENETICS/GENOMES/PROTEOMICS/METABOLOMICS death. We showed that DUT silencing in human and rat tion on disease mechanisms. Here, we studied two index pancreatic b-cells results in apoptosis via the intrinsic cell patients from two unrelated families having two siblings death pathway. Our findings support the importance of affected by a novel syndrome associating diabetes and bone 1ULB Center for Diabetes Research, Medical Faculty, Université Libre de Bruxelles, 7Hôpital Femme-Mère-Enfant, Division of Pediatric Endocrinology, Hospices Brussels, Belgium Civils de Lyon, Université Lyon 1, Lyon, France 2INSERM UMRS 958, Faculté de Médecine Paris Diderot, Université Paris Diderot- 8Hematology Transplantation, Department of Hematology, Immunology and On- Paris 7, Université Sorbonne Paris Cité, Paris, France cology, Hôpital Saint-Louis, Assistance Publique-Hôpitaux de Paris, Paris, France 3 Department of Clinical and Experimental Medicine, Islet Cell Laboratory, Univer- Corresponding author: Cécile Julier, [email protected]. sity of Pisa, Pisa, Italy Received 10 July 2016 and accepted 5 January 2017. 4Centre National de Génotypage, Institut de Génomique, Commissariat à l’Energie Atomique, Evry, France This article contains Supplementary Data online at http://diabetes 5Hôpital Lariboisière, Assistance Publique-Hôpitaux de Paris, Department of .diabetesjournals.org/lookup/suppl/doi:10.2337/db16-0839/-/DC1. Diabetes and Endocrinology, Université Paris Diderot-Paris 7, Université Sorbonne R.S.D.S., M.D., and A.P. contributed equally to this work. D.L.E., J.-F.G., and C.J. Paris Cité, Paris, France contributed equally to this work. 6Aplastic Anemia Reference Centre, Hematology Laboratory, Hôpital Saint-Louis, © 2017 by the American Diabetes Association. Readers may use this article as Assistance Publique-Hôpitaux de Paris, INSERM U944, Université Paris long as the work is properly cited, the use is educational and not for profit, and the Diderot-Paris 7, Université Sorbonne Paris Cité, Paris, France work is not altered. More information is available at http://www.diabetesjournals .org/content/license. diabetes.diabetesjournals.org Dos Santos and Associates 1087 marrow failure. Through genetic studies of these families, methodology (SureSelect Human All Exon Kits Version 2; we identified the same mutation in the dUTPase (DUT) Agilent, Massy, France) with the company’s biotinylated oligo- gene (National Center for Biotechnology Information Gene nucleotide probe library (Human All Exon 50 Mb, version 2; ID 1854) as responsible for this syndrome. We then per- Agilent). Genomic DNA was then sequenced on a sequencer as formed DUT silencing in human and rat pancreatic b-cells paired-end 75 bases (Illumina HiSeq 2000; Illumina, San to investigate further the mechanisms responsible for di- Diego, CA). Image analysis and base calling were performed abetes resulting from DUT deficiency. with real-time analysis Pipeline version 1.14 with default pa- rameters (Illumina). The bioinformatic analysis of sequencing RESEARCH DESIGN AND METHODS data was based on a pipeline (Consensus Assessment of Se- Patients and Families quence and Variation [CASAVA] 1.8, Illumina). CASAVA per- We studied two unrelated families with patients with diabetes forms alignment against human reference genome (build 137), affected by various degrees of bone marrow failure, ranging calls the SNPs based on the allele calls and depth, and detects from dyserythropoiesis to bone marrow aplasia. Family 1 (pa- variants (SNPs and indels). Genetic variation annotation was tients 1 and 2) was a French family with healthy second cousin performed by the company’s pipeline (IntegraGen), and results consanguineous parents. Family 2 (patients 3 and 4) was an were provided per sample in tabulated text files. Mean se- Egyptian family with first cousin consanguineous parents. At quencing depth was 513 per base. Exome variant analysis the time of the genetic study, only patient 1 (French) and was then performed using an in-house python pipeline on patient 3 (Egyptian, living in France) were available. Detailed genetic variation annotation results. Variants were filtered clinical information from patient 2 (deceased) was available consecutively based on their quality (variant quality [Phred but no biological material. Limited clinical information was Q score] .20 and depth $53), their genotype (homozygous available from patient 4 (Egyptian, alive but living in Egypt), status), the predicted consequence on coding capacity who was not available for study. Participating subjects or their (missense, nonsense, splice-site, and coding insertion/ families gave their written informed consent to participate to deletion—frameshift or inframe), and their rare status the study, which was approved by the ethics committees of based on information available in public databases Saint-Antoine Hospital, Saint-Louis Hospital, or the Hospice (ExAC, release 0.3 (6); Exome Variant Server [EVS, re- Civils de Lyon. Genomic DNA was extracted from peripheral lease ESP6500SI-V2]; and Single Nucleotide Polymorphism blood using standard procedure. database [dbSNP, v.138]) and in an in-house database (control subjects, IntegraGen). Variants that were found Genome-Wide Linkage Analysis . Genome-wide linkage analysis was used to detect regions in the homozygous status or with a MAF 0.005 in any homozygous identical by descent (IBD) in patient 1 (family public or in-house database were excluded. 1). This was performed using a subset of 7,676 autosomal Mutation Confirmation and Screening common variants from the Human Exome BeadChip (Illu- by DNA Sequencing mina, San Diego, CA), selected to be evenly distributed over Resequencing of the DUT mutation identified by exome the genome, with high minor allele frequencies (MAFs) sequencing (patient 1), sequencing of DUT coding regions (mean 0.41) and no linkage disequilibrium between single (patient 3), and sequencing of DUT exons and regulatory nucleotide polymorphism (SNP)pairs.Forgenotyping,sam- regions (18 additional selected patients and families: four ples processing and labeling were performed on the Infinium with diabetes and bone marrow failure and 14 with di- assay according to the manufacturer’s instructions. In addi- abetes of likely monogenic origin compatible with linkage tion to family 1 (patient 1), 132 independent Caucasian fam- to the DUT chromosome region [see Supplementary Data]) ilies (324 subjects) were genotyped for the same SNP array, was performed on PCR-amplified DNA using an Applied and these data were used for quality controls and estimation Biosystems 3730 DNA Analyzer (Foster City, CA). PCR and of allele frequencies. Absence of pairwise linkage disequilib- sequencing primers are shown in Supplementary Table 1. rium was confirmed using PLINK (3) and Haploview (4) Sequencing of 95 additional selected patients with software. Allele frequencies were estimated by maximization bone marrow failure or myelodysplastic
Load more

Recommended publications
  • Differential Control of Dntp Biosynthesis and Genome Integrity
    www.nature.com/scientificreports OPEN Diferential control of dNTP biosynthesis and genome integrity maintenance by the dUTPase Received: 6 November 2015 Accepted: 12 June 2017 superfamily enzymes Published online: 20 July 2017 Rita Hirmondo1, Anna Lopata1, Eva Viola Suranyi1,2, Beata G. Vertessy1,2 & Judit Toth1 dUTPase superfamily enzymes generate dUMP, the obligate precursor for de novo dTTP biosynthesis, from either dUTP (monofunctional dUTPase, Dut) or dCTP (bifunctional dCTP deaminase/dUTPase, Dcd:dut). In addition, the elimination of dUTP by these enzymes prevents harmful uracil incorporation into DNA. These two benefcial outcomes have been thought to be related. Here we determined the relationship between dTTP biosynthesis (dTTP/dCTP balance) and the prevention of DNA uracilation in a mycobacterial model that encodes both the Dut and Dcd:dut enzymes, and has no other ways to produce dUMP. We show that, in dut mutant mycobacteria, the dTTP/dCTP balance remained unchanged, but the uracil content of DNA increased in parallel with the in vitro activity-loss of Dut accompanied with a considerable increase in the mutation rate. Conversely, dcd:dut inactivation resulted in perturbed dTTP/dCTP balance and two-fold increased mutation rate, but did not increase the uracil content of DNA. Thus, unexpectedly, the regulation of dNTP balance and the prevention of DNA uracilation are decoupled and separately brought about by the Dcd:dut and Dut enzymes, respectively. Available evidence suggests that the discovered functional separation is conserved in humans and other organisms. Proper control of the intracellular concentration of deoxyribonucleoside-5-triphosphates (dNTPs), the building blocks of DNA, is critically important for efcient and high-fdelity DNA replication and genomic stability1, 2.
    [Show full text]
  • DUT (NM 001948) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221635 DUT (NM_001948) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DUT (NM_001948) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DUT Synonyms: dUTPase Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221635 representing NM_001948 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTGCTCTGAAGAGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCA TGCAGCTCCGCTTTGCCCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGG CTACGACCTGTACAGTGCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATT CAGATAGCGCTCCCTTCTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTA TTGATGTAGGAGCTGGTGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGG CAAAGAAAAGTTTGAAGTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCA GAAATAGAAGAAGTTCAAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGA AT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221635 representing NM_001948 Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag Chromatograms:
    [Show full text]
  • Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA
    INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2327-2334, 2015 Crucial roles of thymidine kinase 1 and deoxyUTPase in incorporating the antineoplastic nucleosides trifluridine and 2'-deoxy-5-fluorouridine into DNA KAzUKI SAKAMoTo, Tatsushi YoKogAwA, HIRoYUKI UENo, KEI ogUcHI, HIRoMI KAzUNo, KEIJI ISHIDA, NozoMU TANAKA, AKIKo oSADA, YUKARI YAMADA, HIRoYUKI oKABE and KENIcHI Matsuo Drug Discovery and Development I, Discovery and Preclinical Research Division, Taiho Pharmaceutical co., Ltd., Tsukuba, Ibaraki 300-2611, Japan Received March 6, 2015; Accepted April 9, 2015 DoI: 10.3892/ijo.2015.2974 Abstract. Trifluridine (FTD) and 2'-deoxy-5-fluorouridine transported into cells by ENT1 and ENT2 and were phosphor- (FdUrd), a derivative of 5-fluorouracil (5-FU), are antitumor ylated by thymidine kinase 1, which showed a higher catalytic agents that inhibit thymidylate synthase activity and their activity for FTD than for FdUrd. deoxyUTPase (DUT) did not nucleotides are incorporated into DNA. However, it is evident recognize dTTP and FTD-triphosphate (F3dTTP), whereas that several differences occur in the underlying antitumor deoxyuridine-triphosphate (dUTP) and FdUrd-triphosphate mechanisms associated with these nucleoside analogues. (FdUTP) were efficiently degraded by DUT. DNA poly- Recently, TAS-102 (composed of FTD and tipiracil hydrochlo- merase α incorporated both F3dTTP and FdUTP into DNA at ride, TPI) was shown to prolong the survival of patients with sites aligned with adenine on the opposite strand. FTD-treated colorectal cancer who received a median of 2 prior therapies, cells showed differing nuclear morphologies compared to including 5-FU. TAS-102 was recently approved for clinical FdUrd-treated cells. These findings indicate that FTD and use in Japan.
    [Show full text]
  • Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization
    electronic reprint Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights Gergely Rona,´ Mary Marfori, Mat´ e´ Borsos, Ildiko´ Scheer, EnikoTak˝ acs,´ Judit Toth,´ Fruzsina Babos, Anna Magyar, Anna Erdei, Zoltan´ Bozoky,´ Laszl´ o´ Buday, Bostjan Kobe and Beata´ G. Vertessy´ Acta Cryst. (2013). D69, 2495–2505 Copyright c International Union of Crystallography Author(s) of this paper may load this reprint on their own web site or institutional repository provided that this cover page is retained. Republication of this article or its storage in electronic databases other than as specified above is not permitted without prior permission in writing from the IUCr. For further information see http://journals.iucr.org/services/authorrights.html Acta Crystallographica Section D: Biological Crystallography welcomes the submission of papers covering any aspect of structural biology, with a particular emphasis on the struc- tures of biological macromolecules and the methods used to determine them. Reports on new protein structures are particularly encouraged, as are structure–function papers that could include crystallographic binding studies, or structural analysis of mutants or other modified forms of a known protein structure. The key criterion is that such papers should present new insights into biology, chemistry or structure. Papers on crystallo- graphic methods should be oriented towards biological crystallography, and may include new approaches to any aspect of structure determination or analysis. Papers on the crys- tallization of biological molecules will be accepted providing that these focus on new methods or other features that are of general importance or applicability.
    [Show full text]
  • Regulation of Human Dutpase Gene Expression and P53-Mediated Transcriptional Repression in Response to Oxaliplatin-Induced DNA Damage Peter M
    78–95 Nucleic Acids Research, 2009, Vol. 37, No. 1 Published online 16 November 2008 doi:10.1093/nar/gkn910 Regulation of human dUTPase gene expression and p53-mediated transcriptional repression in response to oxaliplatin-induced DNA damage Peter M. Wilson1, William Fazzone1, Melissa J. LaBonte1, Heinz-Josef Lenz2 and Robert D. Ladner1,* 1Department of Pathology and 2Division of Medical Oncology, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, CA 90033, USA Received May 19, 2008; Revised October 28, 2008; Accepted October 29, 2008 ABSTRACT INTRODUCTION Deoxyuridine triphosphate nucleotidohydrolase Deoxyuridine triphosphate nucleotidohydrolase (dUT (dUTPase) catalyzes the hydrolysis of dUTP to Pase) is the sole enzyme responsible for the hydrolysis of dUMP and PPi. Although dUTP is a normal intermedi- dUTP to dUMP and pyrophosphate simultaneously pro- ate in DNA synthesis, its accumulation and misincor- viding substrate for thymidylate synthase (TS) and elim- poration into DNA is lethal. Importantly, uracil inating dUTP from the DNA biosynthetic pathway. Although dUTP is a normal intermediate in DNA synth- misincorporation is a mechanism of cytotoxicity esis, its extensive accumulation and misincorporation induced by fluoropyrimidine chemotherapeutic into DNA is lethal in both prokaryotic and eukaryotic agents including 5-fluorouracil (5-FU) and elevated organisms as evidenced from knockout models (1,2). expression of dUTPase is negatively correlated Importantly, uracil misincorporation also represents with clinical response to 5-FU-therapy. In this study a major mechanism of cytotoxicity induced by the we performed the first functional characterization of TS-inhibitor class of chemotherapeutic agents including the dUTPase promoter and demonstrate a role for the fluoropyrimidines 5-fluorouracil (5-FU), fluorodeox- E2F-1 and Sp1 in driving dUTPase expression.
    [Show full text]
  • Targeting Nucleotide Metabolism Enhances the Efficacy of Anthracyclines and Anti-Metabolites in Triple-Negative Breast Cancer
    www.nature.com/npjbcancer ARTICLE OPEN Targeting nucleotide metabolism enhances the efficacy of anthracyclines and anti-metabolites in triple-negative breast cancer Craig Davison1, Roisin Morelli1, Catherine Knowlson1, Melanie McKechnie1, Robbie Carson1, Xanthi Stachtea1, Kylie A. McLaughlin2, Vivien E. Prise2, Kienan Savage 1, Richard H. Wilson3, Karl A. Mulligan2, Peter M. Wilson2, Robert D. Ladner1,5 and ✉ Melissa J. LaBonte 1,4,5 Triple-negative breast cancer (TNBC) remains the most lethal breast cancer subtype with poor response rates to the current chemotherapies and a lack of additional effective treatment options. We have identified deoxyuridine 5′-triphosphate nucleotidohydrolase (dUTPase) as a critical gatekeeper that protects tumour DNA from the genotoxic misincorporation of uracil during treatment with standard chemotherapeutic agents commonly used in the FEC regimen. dUTPase catalyses the hydrolytic dephosphorylation of deoxyuridine triphosphate (dUTP) to deoxyuridine monophosphate (dUMP), providing dUMP for thymidylate synthase as part of the thymidylate biosynthesis pathway and maintaining low intracellular dUTP concentrations. This is crucial as DNA polymerase cannot distinguish between dUTP and deoxythymidylate triphosphate (dTTP), leading to dUTP misincorporation into DNA. Targeting dUTPase and inducing uracil misincorporation during the repair of DNA damage induced by fluoropyrimidines or anthracyclines represents an effective strategy to induce cell lethality. dUTPase inhibition significantly sensitised TNBC cell lines 1234567890():,; to fluoropyrimidines and anthracyclines through imbalanced nucleotide pools and increased DNA damage leading to decreased proliferation and increased cell death. These results suggest that repair of treatment-mediated DNA damage requires dUTPase to prevent uracil misincorporation and that inhibition of dUTPase is a promising strategy to enhance the efficacy of TNBC chemotherapy.
    [Show full text]
  • The Role of a Key Amino Acid Position in Species- Specific Proteinaceous Dutpase Inhibition
    Article The Role of a Key Amino Acid Position in Species- Specific Proteinaceous dUTPase Inhibition András Benedek 1,2,*, Fanni Temesváry-Kis 1, Tamjidmaa Khatanbaatar 1, Ibolya Leveles 1,2, Éva Viola Surányi 1,2, Judit Eszter Szabó 1,2, Lívius Wunderlich 1 and Beáta G. Vértessy 1,2,* 1 Budapest University of Technology and Economics, Department of Applied Biotechnology and Food Science, H -1111 Budapest, Szent Gellért tér 4, Hungary; [email protected] (F.T-K.); [email protected] (T.K.); [email protected] (L.W.) 2 Research Centre for Natural Sciences, Hungarian Academy of Sciences, H-1117 Budapest, Magyar tudósok körútja 2, Hungary; [email protected] (I.L.); [email protected] (É.V.S.); [email protected] (J.E.S.) * Correspondence: [email protected] (A.B.); [email protected] (B.G.V.) Received: 14 May 2019; Accepted: 27 May 2019; Published: 6 June 2019 Abstract: Protein inhibitors of key DNA repair enzymes play an important role in deciphering physiological pathways responsible for genome integrity, and may also be exploited in biomedical research. The staphylococcal repressor StlSaPIbov1 protein was described to be an efficient inhibitor of dUTPase homologues showing a certain degree of species-specificity. In order to provide insight into the inhibition mechanism, in the present study we investigated the interaction of StlSaPIbov1 and Escherichia coli dUTPase. Although we observed a strong interaction of these proteins, unexpectedly the E. coli dUTPase was not inhibited. Seeking a structural explanation for this phenomenon, we identified a key amino acid position where specific mutations sensitized E.
    [Show full text]
  • CRISPR/Cas9-Mediated Knock-Out of Dutpase in Mice Leads to Early Embryonic Lethality
    bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. CRISPR/Cas9-mediated knock-out of dUTPase in mice leads to early embryonic lethality Hajnalka Laura Pálinkás1,2*, Gergely Rácz 1,3, Zoltán Gál4, Orsolya Hoffmann4, Gergely Tihanyi1,3, Elen Gócza4*, László Hiripi4*, Beáta G. Vértessy1,3* *Corresponding authors 1Institute of Enzymology, RCNS, Hungarian Academy of Sciences, Budapest, Hungary 2Doctoral School of Multidisciplinary Medical Science, University of Szeged, Szeged, Hungary 3Department of Applied Biotechnology and Food Sciences, Budapest University of Technology and Economics, Budapest, Hungary 4Department of Animal Biotechnology, Agricultural Biotechnology Institute, National Agricultural Research and Innovation Centre, Gödöllő, Hungary Correspondence and requests for materials should be addressed to Beáta G. Vértessy (email: [email protected]). Correspondence may also be addressed to Hajnalka Laura Pálinkás ([email protected]), Elen Gócza ([email protected]), and László Hiripi ([email protected]). 1 bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Sanitization of nucleotide pools is essential for genome maintenance. Among the enzymes significant in this mechanism, deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) performs cleavage of dUTP into dUMP and inorganic pyrophosphate. By this reaction the enzyme efficiently prevents uracil incorporation into DNA and provides dUMP, the substrate for de novo thymidylate biosynthesis.
    [Show full text]
  • The Relationship Between Dntp Pool Levels and Mutagenesis in an Escherichia Coli NDP Kinase Mutant
    The relationship between dNTP pool levels and mutagenesis in an Escherichia coli NDP kinase mutant Jared Nordman and Andrew Wright* Department of Molecular Biology and Microbiology, Tufts University School of Medicine, 136 Harrison Avenue, Boston, MA 02111 Edited by Jonathan Beckwith, Harvard Medical School, Boston, MA, and approved May 6, 2008 (received for review March 27, 2008) Loss of nucleoside diphosphate kinase (Ndk) function in Escherichia The human genome contains eight Ndk paralogues, Nm23 coli results in an increased frequency of spontaneous mutation and H1–H8, which have been implicated in multiple cellular pro- an imbalance in dNTP pool levels. It is presumed that the imbalance cesses. For example, human NDP kinase (nm23-H1) was initially in dNTP pool levels is responsible for the mutator phenotype of an identified as a suppressor of tumor metastasis by using meta- E. coli ndk mutant. A human homologue of Ndk and potential static melanoma cell lines (17). Nm23-H2 has been shown to suppressor of tumor metastasis, nm23-H2, can complement the cleave DNA in a mechanism similar to that of the AP lyase family mutagenic phenotype of an E. coli ndk mutant. Here, we show that of DNA repair enzymes, and directly regulate expression of the the antimutagenic property of nm23-H2 in E. coli is independent of c-MYC oncogene (18, 19). Mutational loss of NDP kinase dNTP pool levels, indicating that dNTP pool imbalance is not function in Drosophila leads to developmental defects (20). responsible for the mutator phenotype associated with the loss of Interestingly, restoration of NDP kinase enzymatic activity is ndk function.
    [Show full text]
  • Disruption of Nucleocytoplasmic Trafficking As a Cellular Senescence
    www.nature.com/emm ARTICLE OPEN Disruption of nucleocytoplasmic trafficking as a cellular senescence driver Ji-Hwan Park1,14, Sung Jin Ryu2,13,14, Byung Ju Kim3,13,14, Hyun-Ji Cho3, Chi Hyun Park4, Hyo Jei Claudia Choi2, Eun-Jin Jang3, Eun Jae Yang5, Jeong-A Hwang5, Seung-Hwa Woo5, Jun Hyung Lee5, Ji Hwan Park5, Kyung-Mi Choi6, Young-Yon Kwon6, 6 7 3 3 8 9 10 5 ✉ Cheol-Koo Lee , Joon✉ Tae Park , Sung✉ Chun Cho , Yun-Il Lee , Sung✉ Bae Lee , Jeong A. Han , Kyung A. Cho , Min-Sik Kim , Daehee Hwang11 , Young-Sam Lee3,5 and Sang Chul Park3,12 © The Author(s) 2021 Senescent cells exhibit a reduced response to intrinsic and extrinsic stimuli. This diminished reaction may be explained by the disrupted transmission of nuclear signals. However, this hypothesis requires more evidence before it can be accepted as a mechanism of cellular senescence. A proteomic analysis of the cytoplasmic and nuclear fractions obtained from young and senescent cells revealed disruption of nucleocytoplasmic trafficking (NCT) as an essential feature of replicative senescence (RS) at the global level. Blocking NCT either chemically or genetically induced the acquisition of an RS-like senescence phenotype, named nuclear barrier-induced senescence (NBIS). A transcriptome analysis revealed that, among various types of cellular senescence, NBIS exhibited a gene expression pattern most similar to that of RS. Core proteomic and transcriptomic patterns common to both RS and NBIS included upregulation of the endocytosis-lysosome network and downregulation of NCT in senescent cells, patterns also observed in an aging yeast model.
    [Show full text]
  • Uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer
    A Predictive Signature for Oxaliplatin and 5- uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer Qinchuan Wang Zhejiang University https://orcid.org/0000-0002-2370-6714 Xiyong Liu City of Hope National Medical Center Chen Chen Zhejiang University Jida Chen Zhejiang University Beisi Xu Saint Jude Children's Research Hospital Lini Chen Zhejiang University Jichun Zhou Zhejiang University Yasheng Huang Hangzhou Hospital of Traditional Chinese Medicine Wenjun Chen Zhejiang University Rongyue Teng Zhejiang University Wenhe Zhao Zhejiang University Lidan Jin Zhejiang University Jun Shen Zhejiang University Jianguo Shen Zhejiang University Yun Yen ( [email protected] ) Linbo Wang Zhejiang University Page 1/23 Research Keywords: Locally advanced gastric cancer, adjuvant chemotherapy, overall survival, prediction, mutation Posted Date: June 12th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-34678/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/23 Abstract Background: Adjuvantchemotherapy(AC)plays a substantial role in the treatment of locally advanced gastric cancer (LAGC), but the response remains poor. Weaims to improve its ecacy in LAGC. Methods: We identied the expression of eight genes closely associated with platinum and uorouracil metabolism (RRM1, RRM2, RRM2B, POLH, DUT, TYMS, TYMP, MKI67) in the discovery cohort (N=291). And we further validated the ndings in TCGA (N=279) and GEO. Overall survival (OS) was used as an endpoint. Univariate and multivariate Cox models were applied. A multivariate Cox regression model was simulated to predict theOS. Results: In the discovery cohort,the univariate Coxmodelindicated that AC was benecial to high-RRM1, high-DUT, low-RRM2, low-RRM2B, low-POLH, low-KI67, low-TYMS or low-TYMP patients, the results were validated in the TCGA cohort.
    [Show full text]
  • Novel Opportunities for Thymidylate Metabolism As a Therapeutic Target
    3029 Novel opportunities for thymidylate metabolism as a therapeutic target Peter M. Wilson,1 William Fazzone,1 small-molecule inhibitor to dUTPase represents a viable Melissa J. LaBonte,1 Jinxia Deng,2 strategy to improve the clinical efficacy of these mainstay Nouri Neamati,2 and Robert D. Ladner1 chemotherapeutic agents. [Mol Cancer Ther 2008; 7(9):3029–37] 1Department of Pathology, Norris Comprehensive Cancer Center, Keck School of Medicine, and 2Department of Pharmacology and Pharmaceutical Sciences, School of Pharmacy, University of Southern California, Los Angeles, California Introduction The fluoropyrimidine 5-fluorouracil (5-FU) is widely used in the treatment of a range of cancers, including breast Abstract cancers, and cancers of the aerodigestive and gastrointes- For over 40 years, the fluoropyrimidine 5-fluorouracil tinal tract (1). However, 5-FU has had the greatest effect (5-FU) has remained the central agent in therapeutic and is arguably the most successful drug approved to date regimens employed in the treatment of colorectal cancer for the treatment of colorectal cancer. Throughout 50 years and is frequently combined with the DNA-damaging of clinical development, the response rate of advanced agents oxaliplatin and irinotecan, increasing response colorectal cancer chemotherapy using 5-FU and 5-FU-based rates and improving overall survival. However, many combinations has improved from 10% to 15% to 40% to patients will derive little or no benefit from treatment, 50% primarily due to the introduction of efficacious combi- highlighting the need to identify novel therapeutic targets nation partners such as the topoisomerase I inhibitor to improve the efficacy of current 5-FU-based chemother- irinotecan and the platinum agent oxaliplatin and deter- apeutic strategies.
    [Show full text]