DOCSLIB.ORG

Method for Rapidly Screening Microbial Hosts to Identify Certain Strains with Improved Yield And/Or Quality in the Expression of Heterologous Proteins

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Method for Rapidly Screening Microbial Hosts to Identify Certain Strains with Improved Yield And/Or Quality in the Expression of Heterologous Proteins (19) TZZ __ _T (11) EP 2 615 172 A1 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: (2006.01) (2006.01) 17.07.2013 Bulletin 2013/29 C12N 15/78 C12Q 1/68 (21) Application number: 12198545.1 (22) Date of filing: 25.04.2008 (84) Designated Contracting States: • Schneider, Jane C. AT BE BG CH CY CZ DE DK EE ES FI FR GB GR San Diego, CA 92104 (US) HR HU IE IS IT LI LT LU LV MC MT NL NO PL PT • Hershberger, Charles Douglas RO SE SI SK TR Fremont, CA 94536 (US) (30) Priority: 27.04.2007 US 914361 P (74) Representative: Harrison Goddard Foote LLP 4th Floor (62) Document number(s) of the earlier application(s) in Merchant Exchange accordance with Art. 76 EPC: 17-19 Whitworth Street West 08746833.6 / 2 142 651 Manchester M1 5WG (GB) (71) Applicant: Pfenex Inc. Remarks: San Diego, CA 92121 (US) •This application was filed on 20-12-2012 as a divisional application to the application mentioned (72) Inventors: under INID code 62. • Ramseier, Thomas M. •Claims filed after the date of filing of the application/ Newton, MA 02558 (US) after the date of receipt of the divisional application • Coleman, Russell John (Rule 68(4) EPC). San Diego, CA 92101 (US) (54) Method for rapidly screening microbial hosts to identify certain strains with improved yield and/or quality in the expression of heterologous proteins (57) The present invention provides an array for rap- erologous protein of interest in a periplasm compartment, idly identifying a host cell population capable of producing or may secrete the heterologous protein extracellularly heterologous protein with improved yield and/or quality. through an outer cell wall. The strain arrays are useful The array comprises one or more host cell populations for screening for improved expression of any protein of that have been genetically modified to increase the ex- interest, including therapeutic proteins, hormones, a pression of one or more target genes involved in protein growth factors, extracellular receptors or ligands, pro- production, decrease the expression of one or more tar- teases, kinases, blood proteins, chemokines, cytokines, get genes involved in protein degradation, or both. One antibodies and the like. or more of the strains in the array may express the het- EP 2 615 172 A1 Printed by Jouve, 75001 PARIS (FR) EP 2 615 172 A1 Description FIELD OF THE INVENTION 5 [0001] This invention is in the field of protein production, particularly to identifying optimal host cells for large-scale production of properly processed heterologous proteins. BACKGROUND OF THE INVENTION 10 [0002] More than 150 recombinantly produced proteins and polypeptides have been approved by the U.S. Food and Drug Administration (FDA) for use as biotechnology drugs and vaccines, with another 370 in clinical trials. Unlike small molecule therapeutics that are produced through chemical synthesis, proteins and polypeptides are most efficiently produced in living cells. However, current methods of production of recombinant proteins in bacteria often produce improperly folded, aggregated or inactive proteins, and many types of proteins require secondary modifications that are 15 inefficiently achieved using known methods. [0003] Numerous attempts have been developed to increase production of properly folded proteins in recombinant systems. For example, investigators have changed fermentation conditions (Schein (1989)Technology, Bio/ 7: 1141-1149), varied promoter strength, or used overexpressed chaperone proteins (Hockney (1994) Trends Biotechnol. 12:456-463), which can help prevent the formation of inclusion bodies. 20 [0004] Strategies have been developed to excrete proteins from the cell into the supernatant. For example, U.S. Pat. No. 5,348,867; U.S. Pat. No. 6,329,172; PCT Publication No. WO 96/17943; PCT Publication No. WO 02/40696; and U.S. Application Publication 2003/0013150. Other strategies for increased expression are directed to targeting the protein to the periplasm. Some investigations focus on non- Sec type secretion (see for e.g. PCT Publication No. WO 03/079007; U.S. Publication No. 2003/0180937; U.S. Publication No. 2003/0064435; and, PCT Publication No. WO 00/59537). 25 However, the majority of research has focused on the secretion of exogenous proteins with a Sec- type secretion system. [0005] A number of secretion signals have been described for use in expressing recombinant polypeptides or proteins. See, for example, U. S. Pat. No. 5,914,254; U.S. Pat. No. 4,963,495; European Patent No. 0 177 343; U.S. Pat. No. 5,082,783; PCT Publication No. WO 89/10971; U.S. Pat. No. 6,156,552; U.S. Pat. Nos. 6,495,357; 6,509,181; 6,524,827; 6,528,298; 6,558,939; 6,608,018; 6,617,143; U.S. Pat. Nos. 5,595,898; 5,698,435; and 6,204,023; U.S. Pat. No. 30 6,258,560; PCT Publication Nos. WO 01/21662, WO 02/068660 and U. S. Application Publication 2003/0044906; U. S. Pat. No. 5,641,671; and European Patent No. EP 0 121 352. [0006] Heterologous protein production often leads to the formation of insoluble or improperly folded proteins, which are difficult to recover and may be inactive. Furthermore, the presence of specific host cell proteases may degrade the protein of interest and thus reduce the final yield. There is no single factor that will improve the production of all heter- 35 ologous proteins. As a result, there is a need in the art for identifying improved large- scale expression systems capable of secretingand properly processingrecombinant polypeptides to producetransgenic proteinsin properlyprocessed form. SUMMARY OF THE INVENTION 40 [0007] The present invention provides compositions and methods for rapidly identifying a host cell population capable of producing at least one heterologous polypeptide according to a desired specification with improved yield and/or quality. The compositions comprise two or more host cell populations that have been genetically modified to increase the expression of one or more target genes involved in protein production, decrease the expression of one or more target genes involved in protein degradation, express a heterologous gene that affects the protein product, or a combination. 45 The ability to express a polypeptide of interest in a variety of modified host cells provides a rapid and efficient means for determining an optimal host cell for the polypeptide of interest. The desired specification will vary depending on the polypeptide of interest, but includes yield, quality, activity, and the like. [0008] It is recognized that the host cell populations may be modified to express many combinations of nucleic acid sequences that affect the expression levels of endogenous sequences and/or exogenous sequences that facilitate the 50 expression of the polypeptide of interest. In one embodiment, two or more of the host cell populations has been genetically modified to increase the expression of one or more target genes involved in one or more of the proper expression, processing, and/or translocation of a heterologous protein of interest. In another embodiment, the target gene is a protein folding modulator. In another embodiment, the protein folding modulator is selected from the list in Table 1. [0009] In another embodiment, one or more of the host cell populations has been genetically modified to decrease 55 the expression of one or more target genes involved in proteolytic degradation. In another embodiment, the target gene is a protease. In another embodiment, the protease is selected from the list in Table 2. [0010] In one embodiment, nucleotide sequences encoding the proteins of interest are operably linked to aP. fluo- rescens Sec system secretion signal as described herein. One or more of the strains in the array may express the 2 EP 2 615 172 A1 heterologous protein of interest in a periplasm compartment. In certain embodiments, one or more strains may also secrete the heterologous protein extracellularly through an outer cell wall. [0011] Host cells include eukaryotic cells, including yeast cells, insect cells, mammalian cells, plant cells, etc., and prokaryotic cells, including bacterial cells such as P. fluorescens, E. coli, and the like. 5 [0012] As indicated, the library of host cell populations can be rapidly screened to identify certain strain (s) with improved yieldand/or quality ofheterologously expressed protein. Thestrain arrays areuseful for screeningfor improved expression of any protein of interest, including therapeutic proteins, hormones, a growth factors, extracellular receptors or ligands, proteases, kinases, blood proteins, chemokines, cytokines, antibodies and the like. 10 BRIEF DESCRIPTION OF THE FIGURES [0013] Figure 1A depicts plasmid pDOW1261-2 used for engineering genomic deletion inP. fluorescens. Figure 1B is a 15 schematic drawing of the constructions of a gene X deletion. Figure 2 is a Western blot analysis of soluble cells fractions prepared at 0 and 24 hours post- induction (10 and 124, respectively) in Δprc1, ΔdegP2, ΔLa2 and the grpEdnaKJ co-expression strains (Example 6). The top arrows point to thefully assembled monoclonal antibody in theco- expressed strainsbut notin thecontrol (DC440). r = recombinant; n-r= nonrecombinant. 20 DETAILED DESCRIPTION [0014] The present invention now will be described more fully hereinafter with reference to the accompanying drawings, in which some, but not all embodiments of the invention are shown, Indeed, these inventions may be embodied in many 25 different forms and should not be construed as limited to the embodiments set forth herein; rather, these embodiments are provided so that this disclosure will satisfy applicable legal requirements. [0015] Many modifications and other embodiments of the inventions set forth herein will come to mind to one skilled in the art to which these inventions pertain having the benefit of the teachings presented in the foregoing descriptions and the associated drawings. 30 [0016] Therefore, it is to be understood that the inventions are not to be limited to the specific embodiments disclosed and that modifications and other embodiments are intended to be included within the scope of the invention.
Load more

Recommended publications
  • Enoxaparin Sodium Solution for Injection, Manufacturer's Standard
    PRODUCT MONOGRAPH INCLUDING PATIENT MEDICATION INFORMATION PrLOVENOX® Enoxaparin sodium solution for injection 30 mg in 0.3 mL solution (100 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 40 mg in 0.4 mL solution (100 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 60 mg in 0.6 mL solution (100 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 80 mg in 0.8 mL solution (100 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 100 mg in 1 mL solution (100 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 300 mg in 3 mL solution (100 mg/mL), multidose vials for subcutaneous or intravenous injection PrLOVENOX® HP Enoxaparin sodium (High Potency) solution for injection 120 mg in 0.8 mL solution (150 mg/mL), pre-filled syringes for subcutaneous or intravenous injection 150 mg in 1 mL solution (150 mg/mL), pre-filled syringes for subcutaneous or intravenous injection Manufacturer’s standard Anticoagulant/Antithrombotic Agent ATC Code: B01AB05 Product Monograph – LOVENOX (enoxaparin) Page 1 of 113 sanofi-aventis Canada Inc. Date of Initial Approval: 2905 Place Louis-R.-Renaud February 9, 1993 Laval, Quebec H7V 0A3 Date of Revision September 7, 2021 Submission Control Number: 252514 s-a version 15.0 dated September 7, 2021 Product Monograph – LOVENOX (enoxaparin) Page 2 of 113 TABLE OF CONTENTS Sections or subsections that are not applicable at the time of authorization are not listed. TABLE OF CONTENTS ..............................................................................................................
    [Show full text]
  • Recombinant E. Coli Lon Protease (C-6His)
    9853 Pacific Heights Blvd. Suite D. San Diego, CA 92121, USA Tel: 858-263-4982 Email: [email protected] 32-7101: Recombinant E. coli Lon Protease (C-6His) Gene : lon Gene ID : 945085 Uniprot ID : P0A9M0 Description Source: E.coli. MW :88.6kD. Recombinant E.coli Lon Protease is produced by our E.coli expression system and the target gene encoding Asn2-Lys784 is expressed with a 6His tag at the C-terminus. Lon Protease, is a member of the Lon protease family. They are found in archaea, bacteria and eukaryotes. Lon protease is ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short-lived regulatory proteins, including some antitoxins. It required for cellular homeostasis and for survival from DNA damage and developmental changes induced by stress. It degrades polypeptides processively to yield small peptide fragments that are 5 to 10 amino acids long and binds to DNA in a double-stranded, site- specific manner. Endogenous substrates include the regulatory proteins RcsA and SulA, the transcriptional activator SoxS, and UmuD. Its overproduction specifically inhibits translation through at least two different pathways, one of them being the YoeB- YefM toxin-antitoxin system. Product Info Amount : 10 µg / 50 µg Content : Supplied as a 0.2 µm filtered solution of 50mM TrisHCl, 100mM KCl, 10% Glycerol, pH 7.5 . Storage condition : Store at -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. Amino Acid : MGNPERSERIEIPVLPLRDVVVYPHMVIPLFVGREKSIRCLEAAMDHDKKIMLVAQKEASTDEPGVN
    [Show full text]
  • Metalloproteases): a Review
    Accepted Manuscript Therapeutic applications of collagenase (metalloproteases): A review Hamzeh Alipour, Abbasali Raz, Sedigheh Zakeri, Navid Dinparast Djadid PII: S2221-1691(16)30793-6 DOI: 10.1016/j.apjtb.2016.07.017 Reference: APJTB 369 To appear in: Asian Pacific Journal of Tropical Biomedicine Received Date: 14 February 2016 Revised Date: 27 February 2016 Accepted Date: 27 July 2016 Please cite this article as: Alipour H, Raz A, Zakeri S, Djadid ND, Therapeutic applications of collagenase (metalloproteases): A review, Asian Pacific Journal of Tropical Biomedicine (2016), doi: 10.1016/j.apjtb.2016.07.017. This is a PDF file of an unedited manuscript that has been accepted for publication. As a service to our customers we are providing this early version of the manuscript. The manuscript will undergo copyediting, typesetting, and review of the resulting proof before it is published in its final form. Please note that during the production process errors may be discovered which could affect the content, and all legal disclaimers that apply to the journal pertain. ACCEPTED MANUSCRIPT Title: Therapeutic applications of collagenase (metalloproteases): A review Authors: Hamzeh Alipour 1,2,# , Abbasali Raz 1,# , Sedigheh Zakeri 1, Navid Dinparast Djadid 1* Affiliations: 1Malaria and Vector Research Group, Biotechnology Research Center, Pasteur Institute of Iran, Tehran, Iran 2Department of Medical Entomology, School of Health, Research Center for Health Sciences, Shiraz University of Medical Sciences, Shiraz, Iran Keywords: Enzyme Therapeutic application Collagenase MANUSCRIPT Non-invasive Metalloproteinase *Corresponding author: Navid Dinparast Djadid, Malaria and Vector Research Group, Biotechnology Research Center, Pasteur Institute of Iran, Tehran, Iran. Tel: +91 23573763 E-mail: [email protected] Foundation Project: Supported by Pasteur Institute of Iran and Iran National Science Foundation (Grant No.
    [Show full text]
  • Cytokine Nomenclature
    RayBiotech, Inc. The protein array pioneer company Cytokine Nomenclature Cytokine Name Official Full Name Genbank Related Names Symbol 4-1BB TNFRSF Tumor necrosis factor NP_001552 CD137, ILA, 4-1BB ligand receptor 9 receptor superfamily .2. member 9 6Ckine CCL21 6-Cysteine Chemokine NM_002989 Small-inducible cytokine A21, Beta chemokine exodus-2, Secondary lymphoid-tissue chemokine, SLC, SCYA21 ACE ACE Angiotensin-converting NP_000780 CD143, DCP, DCP1 enzyme .1. NP_690043 .1. ACE-2 ACE2 Angiotensin-converting NP_068576 ACE-related carboxypeptidase, enzyme 2 .1 Angiotensin-converting enzyme homolog ACTH ACTH Adrenocorticotropic NP_000930 POMC, Pro-opiomelanocortin, hormone .1. Corticotropin-lipotropin, NPP, NP_001030 Melanotropin gamma, Gamma- 333.1 MSH, Potential peptide, Corticotropin, Melanotropin alpha, Alpha-MSH, Corticotropin-like intermediary peptide, CLIP, Lipotropin beta, Beta-LPH, Lipotropin gamma, Gamma-LPH, Melanotropin beta, Beta-MSH, Beta-endorphin, Met-enkephalin ACTHR ACTHR Adrenocorticotropic NP_000520 Melanocortin receptor 2, MC2-R hormone receptor .1 Activin A INHBA Activin A NM_002192 Activin beta-A chain, Erythroid differentiation protein, EDF, INHBA Activin B INHBB Activin B NM_002193 Inhibin beta B chain, Activin beta-B chain Activin C INHBC Activin C NM005538 Inhibin, beta C Activin RIA ACVR1 Activin receptor type-1 NM_001105 Activin receptor type I, ACTR-I, Serine/threonine-protein kinase receptor R1, SKR1, Activin receptor-like kinase 2, ALK-2, TGF-B superfamily receptor type I, TSR-I, ACVRLK2 Activin RIB ACVR1B
    [Show full text]
  • 2-Diss Preface1
    Purification and preliminary characterization of Bothrops moojeni venom components active on haemostasis (Botmo Thesis) Inauguraldissertation zur Erlangung der Würde eines Doktors der Philosophie vorgelegt der Philosophisch-Naturwissenschaftlichen Fakultät der Universität Basel von Anna Maria Perchu ć aus Warschau, Polen Referent: Prof. Dr. Beat Ernst Korreferent: Prof. Dr. phil. Jürg Meier Basel, 2010 Genehmigt von der Philosophisch-Naturwissenschaftlichen Fakultät auf Antrag von Herrn Prof. Dr. Beat Ernst und Herrn Prof. Dr. phil. Jürg Meier Basel, den 16. September 2008 Prof. Dr. Eberhard Parlow Dekan Wissenschaft ist der gegenwärtige Stand unseres Irrtums Jakob Franz Kern (1897-1924) Anna Maria Perchuć – Botmo Thesis I Acknowledgements To my Doktorvater Prof. Dr. Beat Ernst for his patience, support and scientific advice. To Prof. Dr. phil. Jürg Meier (my Korreferent) and to Prof. Dr. Reto Brun for their input to my PhD exam. To Pentaphatm Ltd. for giving me the opportunity to work on the “Bothrops moojeni Venom Proteomics Project”. To Marianne and Bea for helpful discussions, scientific, practical and personal support, their enthusiasm and friendship. To Reto for giving me the encouragement and guidance and for coordinating the Botmo Project. To the whole Hämostase und Test-Kit-Entwicklung Team for their friendly and helpful cooperation. To Laure, Reto, Philou and the whole Atheris Team for their scientific assistance. To Marc and his Synthesis Team for their involvement in the Botmo Project, their help, support and sense of humour. To Uwe and Andre for the fruitful cooperation. To Andreas for his great assistance and many valuable suggestions. To Remo and Martin for their support in the cell culture lab.
    [Show full text]
  • The Evolving Role of Direct Thrombin Inhibitors in Acute Coronary
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE Journal of the American College of Cardiology providedVol. by 41, Elsevier No. 4 - SupplPublisher S Connector © 2003 by the American College of Cardiology Foundation ISSN 0735-1097/03/$30.00 Published by Elsevier Science Inc. PII S0735-1097(02)02687-6 The Evolving Role of Direct Thrombin Inhibitors in Acute Coronary Syndromes John Eikelboom, MBBS, MSC, FRACP, FRCPA,* Harvey White, MB, CHB, DSC, FRACP, FACC,† Salim Yusuf, MBBS, DPHIL, FRCP (UK), FRCPC, FACC‡ Perth, Australia; Auckland, New Zealand; and Hamilton, Ontario, Canada The central role of thrombin in the initiation and propagation of intravascular thrombus provides a strong rationale for direct thrombin inhibitors in acute coronary syndromes (ACS). Direct thrombin inhibitors are theoretically likely to be more effective than indirect thrombin inhibitors, such as unfractionated heparin or low-molecular-weight heparin, because the heparins block only circulating thrombin, whereas direct thrombin inhibitors block both circulating and clot-bound thrombin. Several initial phase 3 trials did not demonstrate a convincing benefit of direct thrombin inhibitors over unfractionated heparin. However, the Direct Thrombin Inhibitor Trialists’ Collaboration meta-analysis confirms the superiority of direct thrombin inhibitors, particularly hirudin and bivalirudin, over unfractionated heparin for the prevention of death or myocardial infarction (MI) during treatment in patients with ACS, primarily due to a reduction in MI (odds ratio, 0.80; 95% confidence interval, 0.70 to 0.91) with little impact on death. The absolute risk reduction in the composite of death or MI at the end of treatment (0.8%) was similar at 30 days (0.7%), indicating no loss of benefit after cessation of therapy.
    [Show full text]
  • Streptokinase) and Streptococcal Desoxyribonuclease on Fibrinous, Purulent, and Sanguinous Pleural Exudations
    THE EFFECT IN PATIENTS OF STREPTOCOCCAL FIBRINOLYSIN (STREPTOKINASE) AND STREPTOCOCCAL DESOXYRIBONUCLEASE ON FIBRINOUS, PURULENT, AND SANGUINOUS PLEURAL EXUDATIONS William S. Tillett, Sol Sherry J Clin Invest. 1949;28(1):173-190. https://doi.org/10.1172/JCI102046. Research Article Find the latest version: https://jci.me/102046/pdf THE EFFECT IN PATIENTS OF STREPTOCOCCAL FIBRINOLYSIN (STREPTOKINASE) AND STREPTOCOCCAL DESOXYRIBO- NUCLEASE ON FIBRINOUS, PURULENT, AND SAN- GUINOUS PLEURAL EXUDATIONS' By WILLIAM S. TILLETT AND SOL SHERRY (From the Department of Medicine, New York University College of Medicine, and the Third Medical Division of Bellevue Hospital, New York City) (Received for publication August 6, 1948) The results described in this article were ob- coccal groups C and G (3). The product is tained by the injection of concentrated and par- abundantly excreted into the culture medium in tially purified preparations derived from broth which the organisms are grown and is readily ob- cultures of hemolytic streptococci into the pleural tainable free from the bacterial cells in sterile cavity of selected patients who were suffering filtrates. from different types of diseases that gave rise to The fibrinolytic action, in tests conducted un- pleural exudations. The possibility has been ex- der optimal laboratory conditions, is unusually plored of utilizing two of the defined properties rapid in action on the fibrin coagulum of normal elaborated by hemolytic streptococci that have the human blood, requiring only a few minutes when unique capacity of causing rapid lysis of the solid whole plasma is employed as a source of fibrin, elements (fibrin and nucleoprotein) that are sig- and an even shorter time when preparations of nificant parts of exudates.
    [Show full text]
  • Serine Proteases with Altered Sensitivity to Activity-Modulating
    (19) & (11) EP 2 045 321 A2 (12) EUROPEAN PATENT APPLICATION (43) Date of publication: (51) Int Cl.: 08.04.2009 Bulletin 2009/15 C12N 9/00 (2006.01) C12N 15/00 (2006.01) C12Q 1/37 (2006.01) (21) Application number: 09150549.5 (22) Date of filing: 26.05.2006 (84) Designated Contracting States: • Haupts, Ulrich AT BE BG CH CY CZ DE DK EE ES FI FR GB GR 51519 Odenthal (DE) HU IE IS IT LI LT LU LV MC NL PL PT RO SE SI • Coco, Wayne SK TR 50737 Köln (DE) •Tebbe, Jan (30) Priority: 27.05.2005 EP 05104543 50733 Köln (DE) • Votsmeier, Christian (62) Document number(s) of the earlier application(s) in 50259 Pulheim (DE) accordance with Art. 76 EPC: • Scheidig, Andreas 06763303.2 / 1 883 696 50823 Köln (DE) (71) Applicant: Direvo Biotech AG (74) Representative: von Kreisler Selting Werner 50829 Köln (DE) Patentanwälte P.O. Box 10 22 41 (72) Inventors: 50462 Köln (DE) • Koltermann, André 82057 Icking (DE) Remarks: • Kettling, Ulrich This application was filed on 14-01-2009 as a 81477 München (DE) divisional application to the application mentioned under INID code 62. (54) Serine proteases with altered sensitivity to activity-modulating substances (57) The present invention provides variants of ser- screening of the library in the presence of one or several ine proteases of the S1 class with altered sensitivity to activity-modulating substances, selection of variants with one or more activity-modulating substances. A method altered sensitivity to one or several activity-modulating for the generation of such proteases is disclosed, com- substances and isolation of those polynucleotide se- prising the provision of a protease library encoding poly- quences that encode for the selected variants.
    [Show full text]
  • Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected]
    University of South Florida Scholar Commons Graduate Theses and Dissertations Graduate School July 2017 Role of Amylase in Ovarian Cancer Mai Mohamed University of South Florida, [email protected] Follow this and additional works at: http://scholarcommons.usf.edu/etd Part of the Pathology Commons Scholar Commons Citation Mohamed, Mai, "Role of Amylase in Ovarian Cancer" (2017). Graduate Theses and Dissertations. http://scholarcommons.usf.edu/etd/6907 This Dissertation is brought to you for free and open access by the Graduate School at Scholar Commons. It has been accepted for inclusion in Graduate Theses and Dissertations by an authorized administrator of Scholar Commons. For more information, please contact [email protected]. Role of Amylase in Ovarian Cancer by Mai Mohamed A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy Department of Pathology and Cell Biology Morsani College of Medicine University of South Florida Major Professor: Patricia Kruk, Ph.D. Paula C. Bickford, Ph.D. Meera Nanjundan, Ph.D. Marzenna Wiranowska, Ph.D. Lauri Wright, Ph.D. Date of Approval: June 29, 2017 Keywords: ovarian cancer, amylase, computational analyses, glycocalyx, cellular invasion Copyright © 2017, Mai Mohamed Dedication This dissertation is dedicated to my parents, Ahmed and Fatma, who have always stressed the importance of education, and, throughout my education, have been my strongest source of encouragement and support. They always believed in me and I am eternally grateful to them. I would also like to thank my brothers, Mohamed and Hussien, and my sister, Mariam. I would also like to thank my husband, Ahmed.
    [Show full text]
  • Review Article the Role of Microbial Aspartic Protease Enzyme in Food and Beverage Industries
    Hindawi Journal of Food Quality Volume 2018, Article ID 7957269, 15 pages https://doi.org/10.1155/2018/7957269 Review Article The Role of Microbial Aspartic Protease Enzyme in Food and Beverage Industries Jermen Mamo and Fassil Assefa Microbial, Cellular and Molecular Biology Department, College of Natural Science, Addis Ababa University, P.O. Box 1176, Addis Ababa, Ethiopia Correspondence should be addressed to Jermen Mamo; [email protected] Received 3 April 2018; Revised 16 May 2018; Accepted 29 May 2018; Published 3 July 2018 Academic Editor: Antimo Di Maro Copyright © 2018 Jermen Mamo and Fassil Assefa. is is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Proteases represent one of the three largest groups of industrial enzymes and account for about 60% of the total global enzymes sale. According to the Nomenclature Committee of the International Union of Biochemistry and Molecular Biology, proteases are classied in enzymes of class 3, the hydrolases, and the subclass 3.4, the peptide hydrolases or peptidase. Proteases are generally grouped into two main classes based on their site of action, that is, exopeptidases and endopeptidases. Protease has also been grouped into four classes based on their catalytic action: aspartic, cysteine, metallo, and serine proteases. However, lately, three new systems have been dened: the threonine-based proteasome system, the glutamate-glutamine system of eqolisin, and the serine-glutamate-aspartate system of sedolisin. Aspartic proteases (EC 3.4.23) are peptidases that display various activities and specicities.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2006/0110747 A1 Ramseier Et Al
    US 200601 10747A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2006/0110747 A1 Ramseier et al. (43) Pub. Date: May 25, 2006 (54) PROCESS FOR IMPROVED PROTEIN (60) Provisional application No. 60/591489, filed on Jul. EXPRESSION BY STRAIN ENGINEERING 26, 2004. (75) Inventors: Thomas M. Ramseier, Poway, CA Publication Classification (US); Hongfan Jin, San Diego, CA (51) Int. Cl. (US); Charles H. Squires, Poway, CA CI2O I/68 (2006.01) (US) GOIN 33/53 (2006.01) CI2N 15/74 (2006.01) Correspondence Address: (52) U.S. Cl. ................................ 435/6: 435/7.1; 435/471 KING & SPALDING LLP 118O PEACHTREE STREET (57) ABSTRACT ATLANTA, GA 30309 (US) This invention is a process for improving the production levels of recombinant proteins or peptides or improving the (73) Assignee: Dow Global Technologies Inc., Midland, level of active recombinant proteins or peptides expressed in MI (US) host cells. The invention is a process of comparing two genetic profiles of a cell that expresses a recombinant (21) Appl. No.: 11/189,375 protein and modifying the cell to change the expression of a gene product that is upregulated in response to the recom (22) Filed: Jul. 26, 2005 binant protein expression. The process can improve protein production or can improve protein quality, for example, by Related U.S. Application Data increasing solubility of a recombinant protein. Patent Application Publication May 25, 2006 Sheet 1 of 15 US 2006/0110747 A1 Figure 1 09 010909070£020\,0 10°0 Patent Application Publication May 25, 2006 Sheet 2 of 15 US 2006/0110747 A1 Figure 2 Ester sers Custer || || || || || HH-I-H 1 H4 s a cisiers TT closers | | | | | | Ya S T RXFO 1961.
    [Show full text]
  • (12) Patent Application Publication (10) Pub. No.: US 2008/0305517 A1 Griffin Et Al
    US 2008O305517A1 (19) United States (12) Patent Application Publication (10) Pub. No.: US 2008/0305517 A1 Griffin et al. (43) Pub. Date: Dec. 11, 2008 (54) TRANSGLUTAMINASE CROSSLINKED (30) Foreign Application Priority Data COLLAGEN BOMATERAL FOR MEDICAL MPLANT MATERALS Sep. 10, 2004 (GB) ................................... O42O091.1 (75) Inventors: Martin Griffin, Nottingham (GB); Publication Classification Russell Collighan, Birmingham (51) Int. Cl. (GB); David Chau, Birmingham CI2N 5/06 (2006.01) (GB); Elisabetta Verderio CI2P 2L/02 (2006.01) Edwards, Nottingham (GB) A6IF 2/28 (2006.01) A6F I3/00 (2006.01) Correspondence Address: FSH & RICHARDSON PC (52) U.S. Cl. ..................... 435/68.1; 435/395; 623/16.11; 602/48 P.O. BOX 1022 MINNEAPOLIS, MN 55440-1022 (US) (57) ABSTRACT (73) Assignee: ASTON UNIVERSITY, The present invention provides a method for producing an Birmingham, West Midlands (GB) improved biomaterial comprising treating a collagen bioma terial with a transglutaminase under conditions which permit (21) Appl. No.: 111574,918 the formation of cross-links within the collagen. Preferably, the transglutaminase is a tissue transglutaminase, a plasma (22) PCT Filed: Sep. 12, 2005 transglutaminase or a microbial transglutaminase. In a pre ferred embodiment, the collagen biomaterial further com (86). PCT No.: PCT/GBOS/O352O prises a cell adhesion factor, Such as fibronectin. The inven tion further provides biomaterials obtainable by the methods S371 (c)(1), of the invention, and medical implants and wound dressings (2), (4) Date: Aug. 11, 2008 comprising the same. -- Collagen (3 mg/ml) -O- Coll-mTG (50ug/ml) -v- Co-mTG (250ug/ml) -v- Coll-mTG-R281 -- Coll-R281 O 5 10 15 20 25 Time (min) Patent Application Publication Dec.
    [Show full text]