DOCSLIB.ORG

Disease-Induced Modulation of Drug Transporters at the Blood–Brain Barrier Level

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Disease-Induced Modulation of Drug Transporters at the Blood–Brain Barrier Level International Journal of Molecular Sciences Review Disease-Induced Modulation of Drug Transporters at the Blood–Brain Barrier Level Sweilem B. Al Rihani 1 , Lucy I. Darakjian 1, Malavika Deodhar 1 , Pamela Dow 1 , Jacques Turgeon 1,2 and Veronique Michaud 1,2,* 1 Tabula Rasa HealthCare, Precision Pharmacotherapy Research and Development Institute, Orlando, FL 32827, USA; [email protected] (S.B.A.R.); [email protected] (L.I.D.); [email protected] (M.D.); [email protected] (P.D.); [email protected] (J.T.) 2 Faculty of Pharmacy, Université de Montréal, Montreal, QC H3C 3J7, Canada * Correspondence: [email protected]; Tel.: +1-856-938-8697 Abstract: The blood–brain barrier (BBB) is a highly selective and restrictive semipermeable network of cells and blood vessel constituents. All components of the neurovascular unit give to the BBB its crucial and protective function, i.e., to regulate homeostasis in the central nervous system (CNS) by removing substances from the endothelial compartment and supplying the brain with nutrients and other endogenous compounds. Many transporters have been identified that play a role in maintaining BBB integrity and homeostasis. As such, the restrictive nature of the BBB provides an obstacle for drug delivery to the CNS. Nevertheless, according to their physicochemical or pharmacological properties, drugs may reach the CNS by passive diffusion or be subjected to putative influx and/or efflux through BBB membrane transporters, allowing or limiting their distribution to the CNS. Drug transporters functionally expressed on various compartments of the BBB involve numerous proteins from either the ATP-binding cassette (ABC) or the solute carrier (SLC) superfamilies. Pathophysiological stressors, Citation: Al Rihani, S.B.; Darakjian, age, and age-associated disorders may alter the expression level and functionality of transporter L.I.; Deodhar, M.; Dow, P.; Turgeon, J.; protein elements that modulate drug distribution and accumulation into the brain, namely, drug Michaud, V. Disease-Induced efficacy and toxicity. This review focuses and sheds light on the influence of inflammatory conditions Modulation of Drug Transporters at and diseases such as Alzheimer’s disease, epilepsy, and stroke on the expression and functionality of the Blood–Brain Barrier Level. Int. J. the BBB drug transporters, the consequential modulation of drug distribution to the brain, and their Mol. Sci. 2021, 22, 3742. https:// impact on drug efficacy and toxicity. doi.org/10.3390/ijms22073742 Keywords: the blood–brain barrier; drug transporters; Alzheimer’s disease; stroke; epilepsy; neu- Academic Editor: Ryszard Pluta roinflammation Received: 3 February 2021 Accepted: 1 April 2021 Published: 3 April 2021 1. The Blood–Brain Barrier The blood–brain barrier (BBB) is a complex cellular barrier composed of a tightly sealed Publisher’s Note: MDPI stays neutral monolayer of specialized brain capillary endothelial cells lined on a basement membrane with regard to jurisdictional claims in published maps and institutional affil- and surrounded by adjacent perivascular astrocytes, pericytes, and microglia. The major iations. function of the BBB is to separate the circulating blood from the brain extracellular fluid and maintain homeostasis in the central nervous system (CNS) (Figure1). 1.1. BBB Facts and Figures For an average adult, the human brain represents 2% of total body mass. Remarkably, Copyright: © 2021 by the authors. despite this relatively small contribution to total body weight, the brain is composed of Licensee MDPI, Basel, Switzerland. ~170 billion neuronal, glial, or non-neuronal cells [1]. Under resting conditions, about 20% This article is an open access article distributed under the terms and of total blood flow from the heart is received by the brain in healthy adults [2,3]. The BBB 2 conditions of the Creative Commons has a large surface area of almost 15 to 25 m , a total length of capillaries of ~400 miles, Attribution (CC BY) license (https:// microcapillaries with a diameter of 7–10 µm, and an average inter-capillary distance of creativecommons.org/licenses/by/ ~40 µm [1,4–6]. These characteristics allow very selective diffusion and penetration of 4.0/). compounds [1,4]. The large BBB surface area and its critical role in maintaining homeostasis Int. J. Mol. Sci. 2021, 22, 3742. https://doi.org/10.3390/ijms22073742 https://www.mdpi.com/journal/ijms Int. J. Mol. Sci. 2021, 22, 3742 2 of 29 Int. J. Mol. Sci. 2021, 22, x FOR PEER REVIEW 2 of 30 of the brain require regulation and support from accompanying brain cells, which all together form the neurovascular unit (NVU). Figure 1.1. The blood–brainblood–brain barrier.barrier. (Created withwith BioRender,BioRender, accessedaccessed onon 2727 JanuaryJanuary 2021).2021). 1.2.1.1. TheBBB Neurovascular Facts and Figures Unit TheFor an NVU average is a relativelyadult, the newhuman concept brain inrepresents neuroscience. 2% of total The NVUbody mass. was originally Remarkably, de- scribeddespite inthis 1996 relatively as a three-party small contribution unit composed to total of body neurons, weight, cerebral the brain blood is composed vessels, and of astrocytes,~170 billion collectivelyneuronal, glial regulating, or non-neuronal cerebral bloodcells [1] flow. Under [7,8 ].resting In 2001, conditions, during theabout Stroke 20% Progress Review Group meeting of the National Institute of Neurological Disorders and of total blood flow from the heart is received by the brain in healthy adults [2,3]. The BBB Stroke, endothelial cells were recognized as the NVU blood vessel component to empha- has a large surface area of almost 15 to 25 m2, a total length of capillaries of ~400 miles, sizes the unique relationship between brain cells and cerebral vasculature [9,10]. Since microcapillaries with a diameter of 7–10 µm, and an average inter-capillary distance of then, the NVU has gained much interest from the neuroscience community and provided a ~40 µm [1,4–6]. These characteristics allow very selective diffusion and penetration of better understanding of the inter-play and signaling between these different cell types. The compounds [1,4]. The large BBB surface area and its critical role in maintaining homeo- gate function of the BBB is mainly due to the tightly sealed monolayer of endothelial cells stasis of the brain require regulation and support from accompanying brain cells, which lining the brain capillaries but the interaction of these endothelial cells with surrounding all together form the neurovascular unit (NVU). neurons, astrocytes, microglia, and pericytes is key to maintaining proper integrity and function of the BBB [11]. Furthermore, the NVU has become the center of attention for our 1.2. The Neurovascular Unit understanding of the pathology of several neurodegenerative diseases and, consequently, may representThe NVU ais potential a relativel therapeuticy new concept target in [12 neuroscience.]. The NVU was originally de- scribed in 1996 as a three-party unit composed of neurons, cerebral blood vessels, and 1.3.astrocytes, Movement collectively across the regulating BBB cerebral blood flow [7,8]. In 2001, during the Stroke Pro- gressThe Review BBB playsGroup an meeting essential of role the in National maintaining Institute proper of CNSNeurological functions Disorders by selectively and regulatingStroke, endothelial movement cells of were essential recogni nutrientszed as the and NVU toxins blood into vessel and out component of the CNS. to empha- While severalsizes the molecules unique relationship are restricted between from entering brain thecells brain, and cerebral many molecules vasculature can move[9,10]. across Since thethen, BBB the membrane NVU has gained using fourmuch basic interest mechanisms, from the neuroscience namely, passive community diffusion, and endocytosis, provided anda better carrier-mediated understanding transport of the inter or active-play transport,and signaling depending between on these the characteristics different cell oftypes. the moleculeThe gate function and the directionof the BBB of is the mainly transport due (Figureto the tightly2)[13]. sealed monolayer of endothelial cells lining the brain capillaries but the interaction of these endothelial cells with sur- rounding neurons, astrocytes, microglia, and pericytes is key to maintaining proper integ- rity and function of the BBB [11]. Furthermore, the NVU has become the center of attention for our understanding of the pathology of several neurodegenerative diseases and, con- sequently, may represent a potential therapeutic target [12]. Int. J. Mol. Sci. 2021, 22, x FOR PEER REVIEW 3 of 30 1.3. Movement across the BBB The BBB plays an essential role in maintaining proper CNS functions by selectively regulating movement of essential nutrients and toxins into and out of the CNS. While several molecules are restricted from entering the brain, many molecules can move across Int. J. Mol. Sci. 2021, 22, 3742 the BBB membrane using four basic mechanisms, namely, passive diffusion, endocytosis,3 of 29 and carrier-mediated transport or active transport, depending on the characteristics of the molecule and the direction of the transport (Figure 2) [13]. Figure 2.2. Transport pathwayspathways acrossacross thethe blood–brainblood–brain barrier (BBB).(BBB). The passagepassage of variousvarious molecules through the brain implies four basic mechanisms allowing specific molecules to move across the BBB membrane including: (1) the passive implies four basic mechanisms allowing specific molecules to move
Load more

Recommended publications
  • Screening and Identification of Key Biomarkers in Clear Cell Renal Cell Carcinoma Based on Bioinformatics Analysis
    bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Screening and identification of key biomarkers in clear cell renal cell carcinoma based on bioinformatics analysis Basavaraj Vastrad1, Chanabasayya Vastrad*2 , Iranna Kotturshetti 1. Department of Biochemistry, Basaveshwar College of Pharmacy, Gadag, Karnataka 582103, India. 2. Biostatistics and Bioinformatics, Chanabasava Nilaya, Bharthinagar, Dharwad 580001, Karanataka, India. 3. Department of Ayurveda, Rajiv Gandhi Education Society`s Ayurvedic Medical College, Ron, Karnataka 562209, India. * Chanabasayya Vastrad [email protected] Ph: +919480073398 Chanabasava Nilaya, Bharthinagar, Dharwad 580001 , Karanataka, India bioRxiv preprint doi: https://doi.org/10.1101/2020.12.21.423889; this version posted December 23, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Clear cell renal cell carcinoma (ccRCC) is one of the most common types of malignancy of the urinary system. The pathogenesis and effective diagnosis of ccRCC have become popular topics for research in the previous decade. In the current study, an integrated bioinformatics analysis was performed to identify core genes associated in ccRCC. An expression dataset (GSE105261) was downloaded from the Gene Expression Omnibus database, and included 26 ccRCC and 9 normal kideny samples. Assessment of the microarray dataset led to the recognition of differentially expressed genes (DEGs), which was subsequently used for pathway and gene ontology (GO) enrichment analysis.
    [Show full text]
  • (Glut1ds): Methylxanthines Potentiate GLUT1 Haploinsufficiency in Vitro
    0031-3998/01/5002-0254 PEDIATRIC RESEARCH Vol. 50, No. 2, 2001 Copyright © 2001 International Pediatric Research Foundation, Inc. Printed in U.S.A. Glucose Transporter Type 1 Deficiency Syndrome (Glut1DS): Methylxanthines Potentiate GLUT1 Haploinsufficiency In Vitro YUAN-YUAN HO, HONG YANG, JÖRG KLEPPER, JORGE FISCHBARG, DONG WANG, AND DARRYL C. DE VIVO Department of Neurology, Columbia University, New York, New York 10032, U.S.A. [Y.Y.H., H.Y., D.W., D.C.D.]; Department of Pediatrics, University of Essen, Essen, Germany 45122 [J.K.]; and Departments of Physiology and Cellular Biophysics, and Ophthalmology, Columbia University, New York, New York 10032, U.S.A. [J.F.] ABSTRACT Methylxanthines such as caffeine and theophylline are known substrate for Glut1. The combined effects of caffeine (3 mM) and to inhibit glucose transport. We have studied such inhibition in phenobarbital (10 mM) on glucose transport, as determined in the glucose transporter type 1 deficiency syndrome (Glut1DS) by patient 15 and the maternal control, show no additive or syner- erythrocyte glucose transport assays. Data from four patients gistic inhibition. These data indicate that caffeine and phenobar- with individual mutations in the GLUT1 gene are discussed: bital have similar Glut1 inhibitory properties in these two sub- patient 1 (hemizygosity), 3 (S66F), 15 (368Ins23), and 17 jects. Our study suggests that Glut1DS patients may have a (R333W). Zero-trans influx of 14C-labeled 3-O-methyl glucose reduced safety margin for methylxanthines. Consumption of (3-OMG) into erythrocytes of patients is reduced (patient 1, 51%; methylxanthine-containing products may aggravate the neuro- 3, 45%; 15, 31%; 17, 52%) compared with maternal controls.
    [Show full text]
  • Viewed Under 23 (B) Or 203 (C) fi M M Male Cko Mice, and Largely Unaffected Magni Cation; Scale Bars, 500 M (B) and 50 M (C)
    BRIEF COMMUNICATION www.jasn.org Renal Fanconi Syndrome and Hypophosphatemic Rickets in the Absence of Xenotropic and Polytropic Retroviral Receptor in the Nephron Camille Ansermet,* Matthias B. Moor,* Gabriel Centeno,* Muriel Auberson,* † † ‡ Dorothy Zhang Hu, Roland Baron, Svetlana Nikolaeva,* Barbara Haenzi,* | Natalya Katanaeva,* Ivan Gautschi,* Vladimir Katanaev,*§ Samuel Rotman, Robert Koesters,¶ †† Laurent Schild,* Sylvain Pradervand,** Olivier Bonny,* and Dmitri Firsov* BRIEF COMMUNICATION *Department of Pharmacology and Toxicology and **Genomic Technologies Facility, University of Lausanne, Lausanne, Switzerland; †Department of Oral Medicine, Infection, and Immunity, Harvard School of Dental Medicine, Boston, Massachusetts; ‡Institute of Evolutionary Physiology and Biochemistry, St. Petersburg, Russia; §School of Biomedicine, Far Eastern Federal University, Vladivostok, Russia; |Services of Pathology and ††Nephrology, Department of Medicine, University Hospital of Lausanne, Lausanne, Switzerland; and ¶Université Pierre et Marie Curie, Paris, France ABSTRACT Tight control of extracellular and intracellular inorganic phosphate (Pi) levels is crit- leaves.4 Most recently, Legati et al. have ical to most biochemical and physiologic processes. Urinary Pi is freely filtered at the shown an association between genetic kidney glomerulus and is reabsorbed in the renal tubule by the action of the apical polymorphisms in Xpr1 and primary fa- sodium-dependent phosphate transporters, NaPi-IIa/NaPi-IIc/Pit2. However, the milial brain calcification disorder.5 How- molecular identity of the protein(s) participating in the basolateral Pi efflux remains ever, the role of XPR1 in the maintenance unknown. Evidence has suggested that xenotropic and polytropic retroviral recep- of Pi homeostasis remains unknown. Here, tor 1 (XPR1) might be involved in this process. Here, we show that conditional in- we addressed this issue in mice deficient for activation of Xpr1 in the renal tubule in mice resulted in impaired renal Pi Xpr1 in the nephron.
    [Show full text]
  • Regulation of Myocardial Glucose Transporters GLUT1 and GLUT4 in Chronically Anemic Fetal Lambs
    0031-3998/05/5804-0713 PEDIATRIC RESEARCH Vol. 58, No. 4, 2005 Copyright © 2005 International Pediatric Research Foundation, Inc. Printed in U.S.A. Regulation of Myocardial Glucose Transporters GLUT1 and GLUT4 in Chronically Anemic Fetal Lambs J. CARTER RALPHE, PETER N. NAU, CHRISTOPHER E. MASCIO, JEFFREY L. SEGAR, AND THOMAS D. SCHOLZ Department of Pediatrics [J.C.R., P.N.N., J.L.S., T.D.S.], Department of Surgery [C.E.M.], University of Iowa, Iowa City, Iowa 52242 ABSTRACT Little is known about the chronic adaptations that take place steady state, GLUT4 protein localized to the sarcolemma mem- in the fetal heart to allow for increased substrate delivery in brane. These findings suggest that the glucose transporters are response to chronic stress. Because glucose is an important fuel post-transcriptionally regulated in myocardium of chronically for the fetal cardiomyocytes, we hypothesized that myocardial anemic fetal sheep with changes that mimic normal postnatal glucose transporters 1 and 4 (GLUT1 and GLUT4, respectively) development. Unlike the postnatal heart, localization of GLUT4 are up-regulated in the fetal sheep heart that is chronically to the cell membrane suggests the importance of GLUT4 in basal stressed by anemia. Fetal sheep at 128 d gestation underwent glucose uptake in the stressed fetal heart. (Pediatr Res 58: daily isovolumic hemorrhage and determination of myocardial 713–718, 2005) blood flow, oxygen consumption, and substrate utilization. At the endof3or7dofanemia, myocardial levels of GLUT1 and Abbreviations GLUT4 mRNA and protein were measured and subcellular ERK, extracellular-regulated kinase localization was determined. Despite stable heart rate and blood GLUT1(4), glucose transporter 1 (4) pressure, anemia caused a nearly 4-fold increase in right and left HIF-1␣, hypoxia-inducible factor 1␣ ventricular (RV and LV) free wall blood flow.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • Differential Expression of Hydroxyurea Transporters in Normal and Polycythemia Vera Hematopoietic Stem and Progenitor Cell Subpopulations
    Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2021 Differential expression of hydroxyurea transporters in normal and polycythemia vera hematopoietic stem and progenitor cell subpopulations Tan, Ge ; Meier-Abt, Fabienne Abstract: Polycythemia vera (PV) is a myeloproliferative neoplasm marked by hyperproliferation of the myeloid lineages and the presence of an activating JAK2 mutation. Hydroxyurea (HU) is a standard treat- ment for high-risk patients with PV. Because disease-driving mechanisms are thought to arise in PV stem cells, effective treatments should target primarily the stem cell compartment. We tested for theantipro- liferative effect of patient treatment with HU in fluorescence-activated cell sorting-isolated hematopoietic stem/multipotent progenitor cells (HSC/MPPs) and more committed erythroid progenitors (common myeloid/megakaryocyte-erythrocyte progenitors [CMP/MEPs]) in PV using RNA-sequencing and gene set enrichment analysis. HU treatment led to significant downregulation of gene sets associated with cell proliferation in PV HSCs/MPPs, but not in PV CMP/MEPs. To explore the mechanism underlying this finding, we assessed for expression of solute carrier membrane transporters, which mediate trans- membrane movement of drugs such as HU into target cells. The active HU uptake transporter OCTN1 was upregulated in HSC/MPPs compared with CMP/MEPs of untreated patients with PV, and the HU diffusion facilitator urea transporter B (UTB) was downregulated in HSC/MPPs compared withCM- P/MEPs in all patient and control groups tested. These findings indicate a higher accumulation ofHU within PV HSC/MPPs compared with PV CMP/MEPs and provide an explanation for the differential effects of HU in HSC/MPPs and CMP/MEPs of patients with PV.
    [Show full text]
  • The Role of Excitotoxicity in the Pathogenesis of Amyotrophic Lateral Sclerosis ⁎ L
    CORE Metadata, citation and similar papers at core.ac.uk Provided by Elsevier - Publisher Connector Biochimica et Biophysica Acta 1762 (2006) 1068–1082 www.elsevier.com/locate/bbadis Review The role of excitotoxicity in the pathogenesis of amyotrophic lateral sclerosis ⁎ L. Van Den Bosch , P. Van Damme, E. Bogaert, W. Robberecht Neurobiology, Campus Gasthuisberg O&N2, PB1022, Herestraat 49, B-3000 Leuven, Belgium Received 21 February 2006; received in revised form 4 May 2006; accepted 10 May 2006 Available online 17 May 2006 Abstract Unfortunately and despite all efforts, amyotrophic lateral sclerosis (ALS) remains an incurable neurodegenerative disorder characterized by the progressive and selective death of motor neurons. The cause of this process is mostly unknown, but evidence is available that excitotoxicity plays an important role. In this review, we will give an overview of the arguments in favor of the involvement of excitotoxicity in ALS. The most important one is that the only drug proven to slow the disease process in humans, riluzole, has anti-excitotoxic properties. Moreover, consumption of excitotoxins can give rise to selective motor neuron death, indicating that motor neurons are extremely sensitive to excessive stimulation of glutamate receptors. We will summarize the intrinsic properties of motor neurons that could render these cells particularly sensitive to excitotoxicity. Most of these characteristics relate to the way motor neurons handle Ca2+, as they combine two exceptional characteristics: a low Ca2+-buffering capacity and a high number of Ca2+-permeable AMPA receptors. These properties most likely are essential to perform their normal function, but under pathological conditions they could become responsible for the selective death of motor neurons.
    [Show full text]
  • Anti-SLC22A13 (Aa 38-139) Polyclonal Antibody (DPAB-DC3801) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-SLC22A13 (aa 38-139) polyclonal antibody (DPAB-DC3801) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small molecules. This protein can function to mediate urate uptake and is a high affinity nicotinate exchanger in the kidneys and the intestine. Immunogen SLC22A13 (NP_004247, 38 a.a. ~ 139 a.a) partial recombinant protein with GST tag. The sequence is AHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLDTAGHPEPCLMFRPPPANASLQDILSH RFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDT Source/Host Mouse Species Reactivity Human Conjugate Unconjugated Applications WB (Recombinant protein), ELISA, Size 50 μl Buffer 50 % glycerol Preservative None Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION Gene Name SLC22A13 solute carrier family 22 (organic anion/urate transporter), member 13 [ Homo sapiens (human) ] Official Symbol SLC22A13 Synonyms SLC22A13; solute carrier family 22 (organic anion/urate transporter), member 13; OAT10; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved OCTL1; OCTL3; ORCTL3; ORCTL-3; solute carrier family 22 member 13; organic cation transporter-like 3; organic-cation transporter like 3; organic cationic transporter-like 3; solute carrier family 22, member 13; solute carrier family 22 (organic anion transporter), member 13; Entrez Gene ID 9390 Protein Refseq NP_004247 UniProt ID Q9Y226 Chromosome Location 3p21.3 Function nicotinate transporter activity; organic cation transmembrane transporter activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
    [Show full text]
  • The Concise Guide to Pharmacology 2019/20
    Edinburgh Research Explorer THE CONCISE GUIDE TO PHARMACOLOGY 2019/20 Citation for published version: Cgtp Collaborators 2019, 'THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Transporters', British Journal of Pharmacology, vol. 176 Suppl 1, pp. S397-S493. https://doi.org/10.1111/bph.14753 Digital Object Identifier (DOI): 10.1111/bph.14753 Link: Link to publication record in Edinburgh Research Explorer Document Version: Publisher's PDF, also known as Version of record Published In: British Journal of Pharmacology General rights Copyright for the publications made accessible via the Edinburgh Research Explorer is retained by the author(s) and / or other copyright owners and it is a condition of accessing these publications that users recognise and abide by the legal requirements associated with these rights. Take down policy The University of Edinburgh has made every reasonable effort to ensure that Edinburgh Research Explorer content complies with UK legislation. If you believe that the public display of this file breaches copyright please contact [email protected] providing details, and we will remove access to the work immediately and investigate your claim. Download date: 28. Sep. 2021 S.P.H. Alexander et al. The Concise Guide to PHARMACOLOGY 2019/20: Transporters. British Journal of Pharmacology (2019) 176, S397–S493 THE CONCISE GUIDE TO PHARMACOLOGY 2019/20: Transporters Stephen PH Alexander1 , Eamonn Kelly2, Alistair Mathie3 ,JohnAPeters4 , Emma L Veale3 , Jane F Armstrong5 , Elena Faccenda5 ,SimonDHarding5 ,AdamJPawson5 , Joanna L
    [Show full text]
  • Repurposing Potential of Riluzole As an ITAF Inhibitor in Mtor Therapy Resistant Glioblastoma
    International Journal of Molecular Sciences Article Repurposing Potential of Riluzole as an ITAF Inhibitor in mTOR Therapy Resistant Glioblastoma Angelica Benavides-Serrato 1, Jacquelyn T. Saunders 1 , Brent Holmes 1, Robert N. Nishimura 1,2, Alan Lichtenstein 1,3,4 and Joseph Gera 1,3,4,5,* 1 Department of Research & Development, Greater Los Angeles Veterans Affairs Healthcare System, Los Angeles, CA 91343, USA; [email protected] (A.B.-S.); [email protected] (J.T.S.); [email protected] (B.H.); [email protected] (R.N.N.); [email protected] (A.L.) 2 Department of Neurology, David Geffen School of Medicine at UCLA, Los Angeles, CA 90095, USA 3 Jonnson Comprehensive Cancer Center, University of California-Los Angeles, Los Angeles, CA 90095, USA 4 Department of Medicine, David Geffen School of Medicine at UCLA, Los Angeles, CA 90095, USA 5 Molecular Biology Institute, University of California-Los Angeles, Los Angeles, CA 90095, USA * Correspondence: [email protected]; Tel.: +00-1-818-895-9416 Received: 12 December 2019; Accepted: 31 December 2019; Published: 5 January 2020 Abstract: Internal ribosome entry site (IRES)-mediated protein synthesis has been demonstrated to play an important role in resistance to mechanistic target of rapamycin (mTOR) targeted therapies. Previously, we have demonstrated that the IRES trans-acting factor (ITAF), hnRNP A1 is required to promote IRES activity and small molecule inhibitors which bind specifically to this ITAF and curtail IRES activity, leading to mTOR inhibitor sensitivity. Here we report the identification of riluzole (Rilutek®), an FDA-approved drug for amyotrophic lateral sclerosis (ALS), via an in silico docking analysis of FDA-approved compounds, as an inhibitor of hnRNP A1.
    [Show full text]
  • Pharmacy and Poisons (Third and Fourth Schedule Amendment) Order 2017
    Q UO N T FA R U T A F E BERMUDA PHARMACY AND POISONS (THIRD AND FOURTH SCHEDULE AMENDMENT) ORDER 2017 BR 111 / 2017 The Minister responsible for health, in exercise of the power conferred by section 48A(1) of the Pharmacy and Poisons Act 1979, makes the following Order: Citation 1 This Order may be cited as the Pharmacy and Poisons (Third and Fourth Schedule Amendment) Order 2017. Repeals and replaces the Third and Fourth Schedule of the Pharmacy and Poisons Act 1979 2 The Third and Fourth Schedules to the Pharmacy and Poisons Act 1979 are repealed and replaced with— “THIRD SCHEDULE (Sections 25(6); 27(1))) DRUGS OBTAINABLE ONLY ON PRESCRIPTION EXCEPT WHERE SPECIFIED IN THE FOURTH SCHEDULE (PART I AND PART II) Note: The following annotations used in this Schedule have the following meanings: md (maximum dose) i.e. the maximum quantity of the substance contained in the amount of a medicinal product which is recommended to be taken or administered at any one time. 1 PHARMACY AND POISONS (THIRD AND FOURTH SCHEDULE AMENDMENT) ORDER 2017 mdd (maximum daily dose) i.e. the maximum quantity of the substance that is contained in the amount of a medicinal product which is recommended to be taken or administered in any period of 24 hours. mg milligram ms (maximum strength) i.e. either or, if so specified, both of the following: (a) the maximum quantity of the substance by weight or volume that is contained in the dosage unit of a medicinal product; or (b) the maximum percentage of the substance contained in a medicinal product calculated in terms of w/w, w/v, v/w, or v/v, as appropriate.
    [Show full text]
  • Cellular and Molecular Signatures in the Disease Tissue of Early
    Cellular and Molecular Signatures in the Disease Tissue of Early Rheumatoid Arthritis Stratify Clinical Response to csDMARD-Therapy and Predict Radiographic Progression Frances Humby1,* Myles Lewis1,* Nandhini Ramamoorthi2, Jason Hackney3, Michael Barnes1, Michele Bombardieri1, Francesca Setiadi2, Stephen Kelly1, Fabiola Bene1, Maria di Cicco1, Sudeh Riahi1, Vidalba Rocher-Ros1, Nora Ng1, Ilias Lazorou1, Rebecca E. Hands1, Desiree van der Heijde4, Robert Landewé5, Annette van der Helm-van Mil4, Alberto Cauli6, Iain B. McInnes7, Christopher D. Buckley8, Ernest Choy9, Peter Taylor10, Michael J. Townsend2 & Costantino Pitzalis1 1Centre for Experimental Medicine and Rheumatology, William Harvey Research Institute, Barts and The London School of Medicine and Dentistry, Queen Mary University of London, Charterhouse Square, London EC1M 6BQ, UK. Departments of 2Biomarker Discovery OMNI, 3Bioinformatics and Computational Biology, Genentech Research and Early Development, South San Francisco, California 94080 USA 4Department of Rheumatology, Leiden University Medical Center, The Netherlands 5Department of Clinical Immunology & Rheumatology, Amsterdam Rheumatology & Immunology Center, Amsterdam, The Netherlands 6Rheumatology Unit, Department of Medical Sciences, Policlinico of the University of Cagliari, Cagliari, Italy 7Institute of Infection, Immunity and Inflammation, University of Glasgow, Glasgow G12 8TA, UK 8Rheumatology Research Group, Institute of Inflammation and Ageing (IIA), University of Birmingham, Birmingham B15 2WB, UK 9Institute of
    [Show full text]