DOCSLIB.ORG

Cytochrome P450 Nomenclature and Alignment of Selected Sequences

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Cytochrome P450 Nomenclature and Alignment of Selected Sequences APPENDIX A Cytochrome P450 Nomenclature and Alignment of Selected Sequences DAVID R. NELSON 1. Doing the Numbers This chapter is a summary of sequence data available for cytochrome P450 genes and proteins. It serves as a vehicle to update the nomenclature since the last major listing was published in January of 1993. 1 It is now April, 1994, about 16 months since that list appeared, and many new P450 sequences have been determined. Table I consists of 368 entries, covering 281 genes and 15 pseudogenes. Also included are 29 different expressed sequence tags (ESTs) or peR fragments from Caenorhabditis elegans, Arabidopsis thaliana, and Catharanthus roseus that have not yet been assigned to P450 families. Some of the Arabidopsis sequences are probably from the same gene, so the 29 EST sequences really represent less than 29 genes. Nevertheless, at least 325 different cytochrome P450 sequences are listed in Table I. This is amazing progress since the first P450 sequence was published in 1982. The sequences belong to 50 families and 82 subfamilies, and they come from 67 species. Fourteen new families have appeared since the 1993 nomenclature update. 1 There are 19 vertebrates (12 mammals, 5 fish, and 2 birds). Invertebrates include six insect species, the nematode worm C. elegans, with five ESTs but no complete sequences, a spiny lobster, and a pond snail. Plants have 13 species represented and there are 11 lower eukaryote P450s. The bacteria now have 8 genera and 15 species including gram-positive as well as gram-negative bacteria. A cyanobacterium is present and there is a partial sequence from the heat-tolerant bacterium Streptomyces thermotolerans, but no sequence is available from an archaebacterium. DAVID R. NELSON • Departtnent of Biochemistry, The University of Tennessee, Memphis, Memphis, Tennessee 38163. Cytochrome P450: Structure, Mechanism, and Biochemistry (Second Edition), edited by Paul R. Ortiz de Montellano. Plenum Press, New York, 1995. 575 576 APPENDIX A In a single species, rats have 45 genes and 2 pseudogenes. Rats will have CYPIB 1, CYP8, and CYP21 genes, but these are not sequenced yet. This gives a total of 50 genes in the rat. Humans have 34 genes and 7 pseudogenes so far. Nineteen of the human sequences are included in Fig. 1. Humans appear to have fewer sequences in the 2B, 2C, and 2D subfamilies when compared to rats. It is interesting to estimate the number ofP450s in C. elegans, assuming random sampling. About 3-4% of the genome of C. elegans has been sequenced, and there are four different P450 ESTs represented. This extrapolates to about 100 P450 sequences in C. elegans. Of course, the numbers are very small and the estimate could be off by quite a bit. A more representative value will be available when about 10% of the genome is done, probably within a year. 2. The Scope of Table I Table I does not reproduce all of the data in the 1993 nomenclature update. That would be a great waste, since there are over 700 references and 1200 accession numbers given there. The table is meant to be used in conjunction with that earlier tabulation to obtain comprehensive coverage through the end of 1993 and the early part of 1994. Table I does include all of the gene names from the 1993 list, plus any new entries made since then. New entries include reference to journal articles and Genbank accession numbers if they are available. References from the 1993 update that were incomplete or lacked accession numbers, have been included again to complete them. The 1993 update should be consulted for trivial names (Tables 2 and 4) and chromosomal mapping data (Table 1). This old information has not changed since 1993. 3. Cytochrome P450 Sequence Alignment The sequences in this alignment represent 65 of the 82 subfamilies and 41 of the 50 cytochrome P450 families. Those families and subfamilies not included were confidential or unavailable at the time the alignment was made. The sequences are arranged in the same order as the branching pattern ofthe phylogenetic tree in Fig. 2. This automatically clusters the most similar sequences together for ease of comparison. On the left, the sequences are numbered for identification. On the right, the number of amino acids up to that point is given. To the far right on the first page, the Genbank accession numbers are given for each sequence. Two sequences have an insert that has been removed to save space. In sequence 22 CYP5 human, 27 amino acids have been removed between amino acids 298 and 299-IVRDVFSSTGCKPNPSRQHQPSPMARP. Sequence 24 CYP6B 1 had 7 amino acids removed between 280 and 281-EDVKALE. These inserts occur before the I-helix in a highly variable part of the P450 sequences. 4. Phylogenetic Tree of Cytochrome P450 Sequences This tree was computed using a PAM250 scoring matrix. This tree and more detailed trees of individual families and groups of families are the basis for the nomenclature described in detail in the 1993 nomenclature update. l The percent similarity between P450 NOMENCLATURE AND SEQUENCE DATA 577 1 2C9 mp4 human -----------------------MOS---------------lVV-lVLCLS 12 M21940 2 2El j human ---------------------- -MFALGV- ---------- -TVA-lLWAA 15 J02843 3 2Hl CHP3 chicken -----------------------MOFLGLP----·------TIL-llVCIS 16 M13454 42Fl IIFl human ---------------------. ·MOSI- -------- -----STA-llLLLL 13 J02906 5 2B6 lM2 human ---------------------·-MELS-----·--------VLL-FLALLT 13 Xl6864 62Gl olfl rat -----------------------MALGGAF-----------SIF-MTLCLS 16 J04715 72A6 IIA3 human -----------------------MLASGML-----------lVA-LLVCLT 16 X13929 8 2Kl trout -------------·-MSLIEOILQTSSTVT-----------LLG-TVLFLL 24 Ll1528 9 2Jl ib rabbi t ----------------MVAALSSLAAALGAGLH--------PKT-LLLGAV 26 090405 10 206 dbl human -------- -. ------------ -MGL -- -EALV-- ----- -PLA-VIVAI F 16 Y00300 11 lAl Pl human -----------------·--MLFPISMSATEFL--------LAS-VIFCLV 22 X04300 12 17 17a human ----------------------------------------MWEL-VALlLL 10 M14564 13 21 C21 human -------------------------------------------M-LLLGLL 7 Ml7252 14 71Al avocado -----------------------MAIL-----·-·----VSLLF-LAIALT 15 M32885 15 71Bl Thlaspi arvense -------------------- ---MOLL -------- --- -L -YIV-AALVI F 14 L24438 16 75Al petunia -------------------- ---MMLL TELG- --- --- -AATSI-FLIAHI 19 X71130 17 76Al eggplant o X71658 18 73 Jerusalem artichoke -----------------------MOLLLI----------EKTLV-ALFAAI 27 Zl7369 19 78 Zea mays ---------------------------------------ALLAW-ATSPGG 11 L23029 20 77Al eggplant ---------------------------------------IFTAF·SLlFSl 11 X71655 21 3A3 Hlp human -----------------------MALIPOlAME-------TWLL-LAVSLV 20 M13785 22 5Al TXS human ----------------MMEALGFLKLEVNGPMV·------TVAL-SVALLA 27 M74055 23 6Al Musca domestica -----------------------MOFGSFLLYA-------LGVL----ASL 17 M25367 24 6Bl Butterfly --------------------------MLYLLAL-------VTVL----AGL 14 M80828 25 4A 11 human ----------------------- -MSVSVLSPSRLLGOVSGILQ-AASLLI 26 L04751 26 4Bl IVBl human ------------------------MSGTATMVPSFLSLSFSSLG-LWASGL 26 J02871 27 4F3 human ------------------------MPQLSlSSLGLWPMAASPWL-LLLLVG 26 012620 28 4Cl cockroach ----------------------------·---·--MEFITILLS-TALFHS 15 M63798 29 4El Orosophi la o K00045 30 401 Orosophi la ----------------------------------MFLVIGAILA-SALFVG 16 X67645 31 102 BM3 B. megaterium o J04832 32 110 Anabaena cyanobact. o M38044 33 72Al Catharanthus ros. --------- -MEMOMOT I RKAIAAT I FAL VMAWAWRV- LOWAWF - TPKR I E 39 Ll0081 34 53 bphA Asperg. niger ------------ -----------MlAl- -- - --LLS-PYGAYLG-LAL- LV 19 X52521 35 10 pond snail MAIMKKFIHHSLKQLIKPNLTSTKRVVSTSPRKEQGVAAISLEP-SEMAQC 50 S46130 36 llAl scc human ------------------------MLAKGLPPRSVlVKGCQTFL-SAPREG 26 M28253 37 llBl llBl human ---------------------------- --- --MALRAKAEVCM-AVPWLS 17 x55764 38 24 250H 03 24hyd rat -------------MSCPIOKRRTLIAFLRRLROLGQPPRSVTSK-AS-ASR 36 L04618 39 27 270H human ------------ -MAALGCARLRWAL --- RGAGRGLCPHGARAK -AAI PAA 34 M62401 40 51 140M S. cerevisiae ----MSATKSIVGEALEYVNIGLSHFL-ALPLAQ-----RISLI-III-PF 39 M15663 41 7 Chol7a human ---------------. ------- -MMTTSL 1- - -WGIAIAACCC-LWLI L- 22 X56088 42 56 0lT2 S. cerevisiae -----------------------MELL----·---K-LLCLILF-LTLSYV 18 X55713 43 52Al alkl C. tropicalis ----MSSSPSIAQEFlATITPYVEYCQ·ENYTKWYYFIPlVILS-LNLISM 45 M15945 44 5201 AlK4-A C. maltosa -------------MAIF--------------·TPELWLICFAVT-VYIFOY 22 012716 45 52Bl alk6 C. tropicalis ----------·MSLTETTATFIY----·---NYWYIIFHLYFYTTSKIIKY 32 Z13013 4652Cl alk7 C. tropicalis ----------- ----. ---------- ----MYQLFCFLAGIIVV-YKAAQY 20 Z13014 47 19 arom human ------------------------MVLE-------------MLN-PIHYNI 13 M28420 48 105A SUl Str. griseolus -------------------------------------TOTATTP-QTTOAP 13 M32238 49 1050 P450soy St.griseus ----------------------------MTESTTOPARQNLOPT-SPAPAT 22 X63601 50 105B SU2 Str. griseolus -------------------------------- ---- -TTAERTA-PPOALT 13 M32239 51 105C Streptomyces sp. ----------------------------·--------MTQA--------AP 6 M31939 52 lOSE Rhodococ.fascians ----------------------------. -. ------------ -- -MAGTA 5 Z29635 53 107Al eryF Sacc.eryth. -------------------------------------M-TT--V-POLESO 10 M54983 54 55 Fusarium oxysporum ---------------------------. --. ----- -MASGAP- ----- -- 6 M63340 55 112 BJ-l Bradyrhiz.jap. ------------------------------. ---------- -MS-EQQPLP 8 L02323 56 114 BJ-3 Bradyrhiz.jap. o L12971 57 113 eryK Sacc.eryth. -------------------------·-VCAOVETTCCA-RRTLT-TIOEVP 22 L05776 58 106Al BMl B.megaterium -------------------------------------MNKE-------VIP
Load more

Recommended publications
  • NIH Public Access Author Manuscript Pharmacogenet Genomics
    NIH Public Access Author Manuscript Pharmacogenet Genomics. Author manuscript; available in PMC 2013 February 01. NIH-PA Author ManuscriptPublished NIH-PA Author Manuscript in final edited NIH-PA Author Manuscript form as: Pharmacogenet Genomics. 2012 February ; 22(2): 159–165. doi:10.1097/FPC.0b013e32834d4962. PharmGKB summary: very important pharmacogene information for cytochrome P450, family 2, subfamily C, polypeptide 19 Stuart A. Scotta, Katrin Sangkuhlc, Alan R. Shuldinere,f, Jean-Sébastien Hulotb,g, Caroline F. Thornc, Russ B. Altmanc,d, and Teri E. Kleinc aDepartment of Genetics and Genomic Sciences bCardiovascular Research Center, Mount Sinai School of Medicine, New York, New York cDepartments of Genetics dBioengineering, Stanford University, Stanford, California eDivision of Endocrinology, Diabetes and Nutrition, University of Maryland School of Medicine fGeriatric Research and Education Clinical Center, Veterans Administration Medical Center, Baltimore, Maryland, USA gDepartment of Pharmacology, Université Pierre et Marie Curie-Paris 6, INSERM UMR S 956, Pitié-Salpêtrière University Hospital, Paris, France Abstract This PharmGKB summary briefly discusses the CYP2C19 gene and current understanding of its function, regulation, and pharmacogenomic relevance. Keywords antidepressants; clopidogrel; CYP2C19*17; CYP2C19*2; CYP2C19; proton pump inhibitors; rs4244285 Introduction The cytochrome P450, family 2, subfamily C, polypeptide 19 (CYP2C19) gene is located within a cluster of cytochrome P450 genes (centromere-CYP2C18-CYP2C19-CYP2C9- CYP2C8-telomere) on chromosome 10q23.33. The CYP2C19 enzyme contributes to the metabolism of a large number of clinically relevant drugs and drug classes such as antidepressants [1], benzodiazepines [2], mephenytoin [3], proton pump inhibitors (PPIs) [4], and the antiplatelet prodrug clopidogrel [5]. Similar to other CYP450 genes, inherited genetic variation in CYP2C19 and its variable hepatic expression contributes to the interindividual phenotypic variability in CYP2C19 substrate metabolism.
    [Show full text]
  • Identification and Developmental Expression of the Full Complement Of
    Goldstone et al. BMC Genomics 2010, 11:643 http://www.biomedcentral.com/1471-2164/11/643 RESEARCH ARTICLE Open Access Identification and developmental expression of the full complement of Cytochrome P450 genes in Zebrafish Jared V Goldstone1, Andrew G McArthur2, Akira Kubota1, Juliano Zanette1,3, Thiago Parente1,4, Maria E Jönsson1,5, David R Nelson6, John J Stegeman1* Abstract Background: Increasing use of zebrafish in drug discovery and mechanistic toxicology demands knowledge of cytochrome P450 (CYP) gene regulation and function. CYP enzymes catalyze oxidative transformation leading to activation or inactivation of many endogenous and exogenous chemicals, with consequences for normal physiology and disease processes. Many CYPs potentially have roles in developmental specification, and many chemicals that cause developmental abnormalities are substrates for CYPs. Here we identify and annotate the full suite of CYP genes in zebrafish, compare these to the human CYP gene complement, and determine the expression of CYP genes during normal development. Results: Zebrafish have a total of 94 CYP genes, distributed among 18 gene families found also in mammals. There are 32 genes in CYP families 5 to 51, most of which are direct orthologs of human CYPs that are involved in endogenous functions including synthesis or inactivation of regulatory molecules. The high degree of sequence similarity suggests conservation of enzyme activities for these CYPs, confirmed in reports for some steroidogenic enzymes (e.g. CYP19, aromatase; CYP11A, P450scc; CYP17, steroid 17a-hydroxylase), and the CYP26 retinoic acid hydroxylases. Complexity is much greater in gene families 1, 2, and 3, which include CYPs prominent in metabolism of drugs and pollutants, as well as of endogenous substrates.
    [Show full text]
  • A Copper Protein and a Cytochrome Bind at the Same Site on Bacterial Cytochrome C Peroxidase† Sofia R
    14566 Biochemistry 2004, 43, 14566-14576 A Copper Protein and a Cytochrome Bind at the Same Site on Bacterial Cytochrome c Peroxidase† Sofia R. Pauleta,‡,§ Alan Cooper,⊥ Margaret Nutley,⊥ Neil Errington,| Stephen Harding,| Francoise Guerlesquin,3 Celia F. Goodhew,‡ Isabel Moura,§ Jose J. G. Moura,§ and Graham W. Pettigrew‡ Veterinary Biomedical Sciences, Royal (Dick) School of Veterinary Studies, UniVersity of Edinburgh, Summerhall, Edinburgh EH9 1QH, U.K., Department of Chemistry, UniVersity of Glasgow, Glasgow G12 8QQ, U.K., Centre for Macromolecular Hydrodynamics, UniVersity of Nottingham, Sutton Bonington, Nottingham LE12 5 RD, U.K., Unite de Bioenergetique et Ingenierie des Proteines, IBSM-CNRS, 31 chemin Joseph Aiguier, 13402 Marseilles cedex 20, France, Requimte, Departamento de Quimica, CQFB, UniVersidade NoVa de Lisboa, 2829-516 Monte de Caparica, Portugal ReceiVed July 5, 2004; ReVised Manuscript ReceiVed September 9, 2004 ABSTRACT: Pseudoazurin binds at a single site on cytochrome c peroxidase from Paracoccus pantotrophus with a Kd of 16.4 µMat25°C, pH 6.0, in an endothermic reaction that is driven by a large entropy change. Sedimentation velocity experiments confirmed the presence of a single site, although results at higher pseudoazurin concentrations are complicated by the dimerization of the protein. Microcalorimetry, ultracentrifugation, and 1H NMR spectroscopy studies in which cytochrome c550, pseudoazurin, and cytochrome c peroxidase were all present could be modeled using a competitive binding algorithm. Molecular docking simulation of the binding of pseudoazurin to the peroxidase in combination with the chemical shift perturbation pattern for pseudoazurin in the presence of the peroxidase revealed a group of solutions that were situated close to the electron-transferring heme with Cu-Fe distances of about 14 Å.
    [Show full text]
  • Identification and Characterization of CYP2C18 in the Cynomolgus Macaque (Macaca Fascicularis)
    NOTE Toxicology Identification and Characterization of CYP2C18 in the Cynomolgus Macaque (Macaca fascicularis) Yasuhiro UNO1)*, Kiyomi MATSUNO1), Chika NAKAMURA1), Masahiro UTOH1) and Hiroshi YAMAZAKI2) 1)Pharmacokinetics and Bioanalysis Center (PBC), Shin Nippon Biomedical Laboratories (SNBL), Kainan, Wakayama 642–0017 and 2)Laboratory of Drug Metabolism and Pharmacokinetics, Showa Pharmaceutical University, Machida, Tokyo 194–8543, Japan (Received 3 August 2009/Accepted 15 September 2009/Published online in J-STAGE 25 November 2009) ABSTRACT. The macaque is widely used for investigation of drug metabolism due to its evolutionary closeness to the human. However, the genetic backgrounds of drug-metabolizing enzymes have not been fully investigated; therefore, identification and characterization of drug-metabolizing enzyme genes are important for understanding drug metabolism in this species. In this study, we isolated and char- acterized a novel cytochrome P450 2C18 (CYP2C18) cDNA in cynomolgus macaques. This cDNA was highly homologous (96%) to human CYP2C18 cDNA. Cynomolgus CYP2C18 was preferentially expressed in the liver and kidney. Moreover, a metabolic assay using cynomolgus CYP2C18 protein heterologously expressed in Escherichia coli revealed its activity toward S-mephenytoin 4’-hydrox- ylation. These results suggest that cynomolgus CYP2C18 could function as a drug-metabolizing enzyme in the liver. KEY WORDS: cloning, CYP2C18, cytochrome P450, liver, monkey. J. Vet. Med. Sci. 72(2): 225–228, 2010 Cytochrome P450 (CYP) is a superfamily of some of the Such species differences also could be explained by func- most important drug-metabolizing enzymes and consists of tional disparity of the orthologous CYPs between the two a large number of subfamilies [14]. In humans, the CYP2C species, such as, if an ortholog to human CYP with low (or subfamilies contain important enzymes that metabolize no) expression and drug-metabolizing activity, for example approximately 20% of all prescribed drugs [3].
    [Show full text]
  • Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid
    Comprehensive Summaries of Uppsala Dissertations from the Faculty of Pharmacy 231 _____________________________ _____________________________ Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid Cloning, Expression and Catalytic Properties of CYP4F8 and CYP4F21 BY JOHAN BYLUND ACTA UNIVERSITATIS UPSALIENSIS UPPSALA 2000 Dissertation for the Degree of Doctor of Philosophy (Faculty of Pharmacy) in Pharmaceutical Pharmacology presented at Uppsala University in 2000 ABSTRACT Bylund, J. 2000. Cytochrome P450 Enzymes in Oxygenation of Prostaglandin Endoperoxides and Arachidonic Acid: Cloning, Expression and Catalytic Properties of CYP4F8 and CYP4F21. Acta Universitatis Upsaliensis. Comprehensive Summaries of Uppsala Dissertations from Faculty of Pharmacy 231 50 pp. Uppsala. ISBN 91-554-4784-8. Cytochrome P450 (P450 or CYP) is an enzyme system involved in the oxygenation of a wide range of endogenous compounds as well as foreign chemicals and drugs. This thesis describes investigations of P450-catalyzed oxygenation of prostaglandins, linoleic and arachidonic acids. The formation of bisallylic hydroxy metabolites of linoleic and arachidonic acids was studied with human recombinant P450s and with human liver microsomes. Several P450 enzymes catalyzed the formation of bisallylic hydroxy metabolites. Inhibition studies and stereochemical analysis of metabolites suggest that the enzyme CYP1A2 may contribute to the biosynthesis of bisallylic hydroxy fatty acid metabolites in adult human liver microsomes. 19R-Hydroxy-PGE and 20-hydroxy-PGE are major components of human and ovine semen, respectively. They are formed in the seminal vesicles, but the mechanism of their biosynthesis is unknown. Reverse transcription-polymerase chain reaction using degenerate primers for mammalian CYP4 family genes, revealed expression of two novel P450 genes in human and ovine seminal vesicles.
    [Show full text]
  • Transcriptomic Characterization of Fibrolamellar Hepatocellular
    Transcriptomic characterization of fibrolamellar PNAS PLUS hepatocellular carcinoma Elana P. Simona, Catherine A. Freijeb, Benjamin A. Farbera,c, Gadi Lalazara, David G. Darcya,c, Joshua N. Honeymana,c, Rachel Chiaroni-Clarkea, Brian D. Dilld, Henrik Molinad, Umesh K. Bhanote, Michael P. La Quagliac, Brad R. Rosenbergb,f, and Sanford M. Simona,1 aLaboratory of Cellular Biophysics, The Rockefeller University, New York, NY 10065; bPresidential Fellows Laboratory, The Rockefeller University, New York, NY 10065; cDivision of Pediatric Surgery, Department of Surgery, Memorial Sloan-Kettering Cancer Center, New York, NY 10065; dProteomics Resource Center, The Rockefeller University, New York, NY 10065; ePathology Core Facility, Memorial Sloan-Kettering Cancer Center, New York, NY 10065; and fJohn C. Whitehead Presidential Fellows Program, The Rockefeller University, New York, NY 10065 Edited by Susan S. Taylor, University of California, San Diego, La Jolla, CA, and approved September 22, 2015 (received for review December 29, 2014) Fibrolamellar hepatocellular carcinoma (FLHCC) tumors all carry a exon of DNAJB1 and all but the first exon of PRKACA. This deletion of ∼400 kb in chromosome 19, resulting in a fusion of the produced a chimeric RNA transcript and a translated chimeric genes for the heat shock protein, DNAJ (Hsp40) homolog, subfam- protein that retains the full catalytic activity of wild-type PKA. ily B, member 1, DNAJB1, and the catalytic subunit of protein ki- This chimeric protein was found in 15 of 15 FLHCC patients nase A, PRKACA. The resulting chimeric transcript produces a (21) in the absence of any other recurrent mutations in the DNA fusion protein that retains kinase activity.
    [Show full text]
  • Synonymous Single Nucleotide Polymorphisms in Human Cytochrome
    DMD Fast Forward. Published on February 9, 2009 as doi:10.1124/dmd.108.026047 DMD #26047 TITLE PAGE: A BIOINFORMATICS APPROACH FOR THE PHENOTYPE PREDICTION OF NON- SYNONYMOUS SINGLE NUCLEOTIDE POLYMORPHISMS IN HUMAN CYTOCHROME P450S LIN-LIN WANG, YONG LI, SHU-FENG ZHOU Department of Nutrition and Food Hygiene, School of Public Health, Peking University, Beijing 100191, P. R. China (LL Wang & Y Li) Discipline of Chinese Medicine, School of Health Sciences, RMIT University, Bundoora, Victoria 3083, Australia (LL Wang & SF Zhou). 1 Copyright 2009 by the American Society for Pharmacology and Experimental Therapeutics. DMD #26047 RUNNING TITLE PAGE: a) Running title: Prediction of phenotype of human CYPs. b) Author for correspondence: A/Prof. Shu-Feng Zhou, MD, PhD Discipline of Chinese Medicine, School of Health Sciences, RMIT University, WHO Collaborating Center for Traditional Medicine, Bundoora, Victoria 3083, Australia. Tel: + 61 3 9925 7794; fax: +61 3 9925 7178. Email: [email protected] c) Number of text pages: 21 Number of tables: 10 Number of figures: 2 Number of references: 40 Number of words in Abstract: 249 Number of words in Introduction: 749 Number of words in Discussion: 1459 d) Non-standard abbreviations: CYP, cytochrome P450; nsSNP, non-synonymous single nucleotide polymorphism. 2 DMD #26047 ABSTRACT Non-synonymous single nucleotide polymorphisms (nsSNPs) in coding regions that can lead to amino acid changes may cause alteration of protein function and account for susceptivity to disease. Identification of deleterious nsSNPs from tolerant nsSNPs is important for characterizing the genetic basis of human disease, assessing individual susceptibility to disease, understanding the pathogenesis of disease, identifying molecular targets for drug treatment and conducting individualized pharmacotherapy.
    [Show full text]
  • Human Cytochrome P450 CYP2A13
    [CANCER RESEARCH 60, 5074–5079, September 15, 2000] Human Cytochrome P450 CYP2A13: Predominant Expression in the Respiratory Tract and Its High Efficiency Metabolic Activation of a Tobacco-specific Carcinogen, 4-(Methylnitrosamino)-1-(3-pyridyl)-1-butanone1 Ting Su, Ziping Bao, Qing-Yu Zhang, Theresa J. Smith, Jun-Yan Hong,2 and Xinxin Ding2 Wadsworth Center, New York State Department of Health, Albany, New York 12201 [T. S., Q-Y. Z., X. D.]; School of Public Health, State University of New York at Albany, Albany, New York [T. S., X. D.]; and Environmental and Occupational Health Sciences Institute, University of Medicine and Dentistry of New Jersey, Piscataway, New Jersey 08854 [Z. B., T. J. S., J-Y. H.] ABSTRACT However, heterologously expressed CYP2A7 showed no catalytic activity (17, 18). CYP2A13 cDNA has not been isolated previously; The human CYP2A subfamily comprises three genes, CYP2A6, the reported protein sequence was deduced from the predicted coding CYP2A7, and CYP2A13. CYP2A6 is active toward many carcinogens and region of a CYP2A13 genomic clone (1). On the basis of its sequence is the major coumarin 7-hydroxylase and nicotine C-oxidase in the liver, whereas CYP2A7 is not functional. The function of CYP2A13 has not been features that resemble the nonfunctional CYP2A7 and CYP2A6v1 (a characterized. In this study, a CYP2A13 cDNA was prepared by RNA- genetic variant of CYP2A6) proteins, the CYP2A13 protein was PCR from human nasal mucosa and was translated using a baculovirus predicted to be nonfunctional in coumarin 7-hydroxylation (1). Be- expression system. In a reconstituted system, the expressed CYP2A13 was cause the deduced amino acid sequence of CYP2A13 shares a 95.4% more active than CYP2A6 in the metabolic activation of hexamethylphos- identity with that of CYP2A6 (1), antibodies and chemical probes for phoramide, N,N-dimethylaniline, 2؅-methoxyacetophenone, and N-nitro- CYP2A6 may interact with CYP2A13.
    [Show full text]
  • © Copyright 2017 Yichen
    © Copyright 2017 Yichen Jia Prediction of CYP3A4 metabolic activity from whole genome RNA-seq data with feature selection machine learning methods Yichen Jia A thesis submitted in partial fulfillment of the requirements for the degree of Master of Science University of Washington 2017 Reading Committee: Timothy A. Thornton, PhD; Chair Michael C. Wu, PhD Program Authorized to Offer Degree: Biostatistics University of Washington Abstract Prediction of CYP3A4 metabolic activity from whole genome RNA-seq data with feature selection machine learning methods Yichen Jia Chair of the Supervisory Committee: Timothy A. Thornton, Robert W. Day Endowed Professor of Public Health, Associate Professor Department of Biostatistics CYP3A4, one of the isozyme of the cytochromes P450 (CYPs), contributes significantly to drug clearance and drug-drug interactions. The goals of this project are to identify hepatically- expressed genes that are associated with CYP3A4 metabolic activity in human liver tissue and to predict CYP3A4 activity using gene expression data from whole genome RNA sequences. Due to the high-dimensionality of the dataset, we applied lasso and elastic net, two feature selection machine learning methods, for prediction and graphical lasso was used for constructing gene network graphs. A simulation study was performed to assess the performance of the prediction algorithms and to evaluate the efficiency of gene selection using the machine learning methods. We assessed prediction performance based on correlations, and the correlation between measured CYP3A4 activity and predicted activity was approximately 0.4 and 0.5 when reductase was excluded and included, respectively, for both lasso and elastic net. In addition to the CYP3A4 gene, we also identified the GZMA gene as a strong candidate for prediction of CYP3A4 activity that should be investigated in future studies.
    [Show full text]
  • Caffeine Metabolism and Cytochrome P450 Enzyme Mrna Expression
    Caffeine metabolism and Cytochrome P450 enzyme mRNA expression levels of genetically diverse inbred mouse strains Neal Addicott - CSU East Bay, Michael Malfatti - Lawrence Livermore National Laboratory, Gabriela G. Loots - Lawrence Livermore National Laboratory Metabolic pathways for caffeine 4. Results 1. Introduction (in mice - human overlaps underlined) Metabolites 30 minutes after dose Caffeine is broken down in humans by several enzymes from the Cytochrome Caffeine (1,3,7 - trimethylxanthine) O CH3 (n=6 per strain) CH3 6 N Paraxanthine/Caffeine N 7 Theophylline/Caffeine *Theobromine/Caffeine P450 (CYP) superclass of enzymes. These CYP enzymes are important in Theophylline 1 5 0.06 0.06 0.06 8 (7-N-demethylization) (1,3 - dimethylxanthine) 2 4 9 3 O N 0.05 0.05 0.05 activating or eliminating many medications. The evaluation of caffeine O H N 1,3,7 - trimethyluricacid CH 3 O CH3 N CH eine Peak Area Peak eine eine Peak Area eine Cyp1a2 3 CH 0.04 Area Peak eine 0.04 0.04 f f N f metabolites in a patient has been proposed as a means of estimating the activity 1 7 3 (3-N-demethylization) N Cyp3a4 N1 7 (8-hydrolyzation) 8 OH 0.03 0.03 0.03 of some CYP enzymes, contributing to genetics-based personalized medicine. O 3 N N Cyp1a2 3 O N Paraxanthine (1-N-demethylization) N 0.02 0.02 0.02 CH3 (1,7 - dimethylxanthine) CH3 O CH3 0.01 0.01 0.01 CH3 Theophylline Peak Area / Ca Peak Theophylline Paraxanthine Peak Area / Ca The frequency and distribution of polymorphisms in inbred strains of mice N Area / Ca Peak Theobromine 7 paraxanthine peak area /caffeine peak area /caffeine paraxanthine peak area theophylline peak area /caffeine peak area /caffeine theophylline peak area N1 Theobromine 0 0 peak area /caffeine peak area theobromine 0 0 C57BL/6JC57BL BALB/cJBALB CBA/JCBA/J DBA/2JDBA/2J .
    [Show full text]
  • Enzyme DHRS7
    Toward the identification of a function of the “orphan” enzyme DHRS7 Inauguraldissertation zur Erlangung der Würde eines Doktors der Philosophie vorgelegt der Philosophisch-Naturwissenschaftlichen Fakultät der Universität Basel von Selene Araya, aus Lugano, Tessin Basel, 2018 Originaldokument gespeichert auf dem Dokumentenserver der Universität Basel edoc.unibas.ch Genehmigt von der Philosophisch-Naturwissenschaftlichen Fakultät auf Antrag von Prof. Dr. Alex Odermatt (Fakultätsverantwortlicher) und Prof. Dr. Michael Arand (Korreferent) Basel, den 26.6.2018 ________________________ Dekan Prof. Dr. Martin Spiess I. List of Abbreviations 3α/βAdiol 3α/β-Androstanediol (5α-Androstane-3α/β,17β-diol) 3α/βHSD 3α/β-hydroxysteroid dehydrogenase 17β-HSD 17β-Hydroxysteroid Dehydrogenase 17αOHProg 17α-Hydroxyprogesterone 20α/βOHProg 20α/β-Hydroxyprogesterone 17α,20α/βdiOHProg 20α/βdihydroxyprogesterone ADT Androgen deprivation therapy ANOVA Analysis of variance AR Androgen Receptor AKR Aldo-Keto Reductase ATCC American Type Culture Collection CAM Cell Adhesion Molecule CYP Cytochrome P450 CBR1 Carbonyl reductase 1 CRPC Castration resistant prostate cancer Ct-value Cycle threshold-value DHRS7 (B/C) Dehydrogenase/Reductase Short Chain Dehydrogenase Family Member 7 (B/C) DHEA Dehydroepiandrosterone DHP Dehydroprogesterone DHT 5α-Dihydrotestosterone DMEM Dulbecco's Modified Eagle's Medium DMSO Dimethyl Sulfoxide DTT Dithiothreitol E1 Estrone E2 Estradiol ECM Extracellular Membrane EDTA Ethylenediaminetetraacetic acid EMT Epithelial-mesenchymal transition ER Endoplasmic Reticulum ERα/β Estrogen Receptor α/β FBS Fetal Bovine Serum 3 FDR False discovery rate FGF Fibroblast growth factor HEPES 4-(2-Hydroxyethyl)-1-Piperazineethanesulfonic Acid HMDB Human Metabolome Database HPLC High Performance Liquid Chromatography HSD Hydroxysteroid Dehydrogenase IC50 Half-Maximal Inhibitory Concentration LNCaP Lymph node carcinoma of the prostate mRNA Messenger Ribonucleic Acid n.d.
    [Show full text]
  • Noelia Díaz Blanco
    Effects of environmental factors on the gonadal transcriptome of European sea bass (Dicentrarchus labrax), juvenile growth and sex ratios Noelia Díaz Blanco Ph.D. thesis 2014 Submitted in partial fulfillment of the requirements for the Ph.D. degree from the Universitat Pompeu Fabra (UPF). This work has been carried out at the Group of Biology of Reproduction (GBR), at the Department of Renewable Marine Resources of the Institute of Marine Sciences (ICM-CSIC). Thesis supervisor: Dr. Francesc Piferrer Professor d’Investigació Institut de Ciències del Mar (ICM-CSIC) i ii A mis padres A Xavi iii iv Acknowledgements This thesis has been made possible by the support of many people who in one way or another, many times unknowingly, gave me the strength to overcome this "long and winding road". First of all, I would like to thank my supervisor, Dr. Francesc Piferrer, for his patience, guidance and wise advice throughout all this Ph.D. experience. But above all, for the trust he placed on me almost seven years ago when he offered me the opportunity to be part of his team. Thanks also for teaching me how to question always everything, for sharing with me your enthusiasm for science and for giving me the opportunity of learning from you by participating in many projects, collaborations and scientific meetings. I am also thankful to my colleagues (former and present Group of Biology of Reproduction members) for your support and encouragement throughout this journey. To the “exGBRs”, thanks for helping me with my first steps into this world. Working as an undergrad with you Dr.
    [Show full text]