OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA334780
SNAPC3 Rabbit Polyclonal Antibody Product data:
Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-SNAPC3 antibody: synthetic peptide directed towards the N terminal of human SNAPC3. Synthetic peptide located within the following region: CSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGD Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 45 kDa Gene Name: small nuclear RNA activating complex polypeptide 3 Database Link: NP_001034786 Entrez Gene 6619 Human Q92966 Background: SNAPC3 is part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. SNAPC3 binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. SNAPC3 recruits TBP and BRF2 to the U6 snRNA TATA box. Synonyms: PTFbeta; SNAP50
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 SNAPC3 Rabbit Polyclonal Antibody – TA334780
Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 86%; Mouse: 86%; Rabbit: 86%
Protein Families: Transcription Factors
Product images:
WB Suggested Anti-SNAPC3 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human Small Intestine
This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2