CATPHY_2015_US_Cover_2014 10/23/14 11:43 AM Page 1

Premium Science, Technology, and Medical eBook Collections

Ask about Free Trials

✦ More than 12,000 references in over 350 subject areas ✦ Comprehensive, customizable, and cost-effective ✦ Up-to-date information with new titles added monthly

Take a Video Tour at www.CRCnetBASE.com

Catalog no. CATPHY

[email protected] 1-888-318-2367 US VERSION The following subject catalogs are also available from CRC Press. Visit www.crcpress.com/catalogs or contact your local sales representative for copies.

www.crcpress.com/catalogs Science, Technology, and Medical

4 Agriculture & Life Sciences 4 Environmental Science & Engineering Knowledge for the Next Generation

4 Biomedical Sciences 4 Ergonomics & Human Factors, Industrial Engineering & Manufacturing 4 Business, Management, & Public Administration 4 Food Science & Nutrition

4 Chemistry & Chemical Engineering 4 Forensic Science, Law Enforcement, & Homeland Security 4 Civil & Mechanical Engineering 4 Mathematics & Statistics 4 Computer Science, Information Technology, & Game Development 4 Medicine & Veterinary Medicine

4 Electrical Engineering 4 Physics & Materials Science

Discover More at www.crcpress.com

• Related titles, tables of contents, and new and With more than a century of publishing excellence, forthcoming publications as science evolves, so do we.

• Book reviews by industry influencers and thought leaders • Authoritative STM references that cover the latest developments • Our Featured Authors community with detailed author bios, and emerging trends news about their work, and the latest research • Textbooks with ancillary materials that make teaching easier

• Digital content delivery that provides anywhere, anytime access in multiple formats

CRC Press Go to www.crcpress.com to find out more. CRC Press Go to www.crcpress.com for detailed information on every book. Taylor & Francis Group Taylor & Francis Group Physics Materials Science General Reference...... Statistical Physics&Thermodynamics Quantum Physics...... Plasma Physics...... Particle/High EnergyPhysics...... Nuclear Physics...... Nonlinear Physics...... Nanotechnology &MesoscalePhysics...... Nanoscience &Nanotechnology...... Medical Physics...... Mathematics forPhysics...... Lasers, Optics,&Optoelectronics...... Geophysics...... Physics...... General &Introductory Energy &EnvironmentalPhysics...... Electronic Materials&Devices...... Condensed Matter&MaterialsScience...... Computational Physics...... Chemical Physics...... Biophysics...... Atomic &MolecularPhysics...... Astronomy &Astrophysics...... Applied Mechanics&FluidDynamics...... Applied &IndustrialPhysics...... Corrosion...... Composite Materials...... Coatings &ThinFilms...... Ceramics &Glasses...... Biomaterials &RegenerativeMedicine...... Table ofContents ...... 67 63 60 59 58 57 57 55 51 45 41 27 26 22 22 21 17 16 15 78 75 75 74 68 9 8 6 5 3

Physics & Materials Science Table of Contents continued...

Materials Science continued...

Electronic, Magnetic, & Optical Materials...... 79

Fire Science...... 84

Industrial Textiles...... 85

Materials Characterization & Testing...... 86

Materials Chemistry...... 87

Materials Processing...... 90

Materials Properties...... 92

Materials Strength & Mechanics...... 93

Metals & Alloys...... 96

Nanomaterials...... 97

Polymer Chemistry...... 103

Polymeric Materials & Plastics...... 106

Surface Engineering...... 110

General Reference...... 113

Title Index...... 117

Author Index...... 122

Sales Agents...... 127 Suggested Price: 2015,6x 9, 285pp. February Print ISBN:978-1-77188-084-8 analyses formechanicalsystem. by computertechnology, usingparametric modelingtechniquesandmultiple The authorsdevelopanewmethodfor thecalculationofmathematicalmodels which includeacombinationofphysical, mechanical,andthermaltechniques. technologies applicabletobothfluidmechanicsandheattransferproblems, mathematical methodsfortheanalysisofnonlineardynamicprocesses.Itcovers mathematical modelsandalsousesmoderncomputertechnology and The bookincludestheresearch oftheauthorsondevelopmentoptimal mechanics andheattransferinmechanicalengineering. This bookfocusesonnewmethodsandtechniquesinfluid National AcademyofScienceAzerbaijan(AMEA),Baku Kaveh HaririAsliandSoltanAliOgliAliyev Dynamics Modeling Advances inNonlinear and HeatTransfer Fluid Mechanics Suggested Price: December 2013,6-1/8x9-1/4,370pp. eBook ISBN:978-1-4665-1816-2 Print ISBN:978-1-4665-1815-5 topracticalexperiencesfacedbypractitioners. theory for engineers.With manyworkedexamplesandproblemsets,itrelatesthe industrial settings,thisbookcoversthefundamentalsofelectromagnetictheory effects ofinterconnected electric devices.Basedontheauthor’s coursestaughtin versed inelectromagneticcompatibility, whichminimizesandcontrolstheside of devicesandcircuits. In particular, theymustbewell- andtheelectromagneticbehavior electromagnetic theory devices andcircuits need to haveasolidunderstandingof Engineers andscientistswhodevelopinstallelectronic Lexington, Kentucky, USA Tze-Chuen Toh Engineers Electromagnetic Compatibility for Electromagnetic Theory Suggested Price: December 2014,7x10,425pp. Print ISBN:978-1-4822-3281-3 highly sophisticatedandsystematicallydrawnprocessmethodology. of SiwafersinVLSIandULSIprocessingtechnologybeforeimplementingthe useful wafersfordevicefabrication.Thebookshowshowtoevaluatethesuitability one ofthefirstbookstocovercompleteevaluationSiwafers,fromsand techniques withadd-onlayersforspecificapplications.Itis usingstandard the systematic growth of Si singlecrystals semiconductor fabricationindustries,thisbookdiscusses Written forengineersandresearchers workingin Pilani, India Central ElectronicsEngineeringResearch Institute(CEERI), Golla Eranna of SiliconforVLSIandULSI GrowthandEvaluation Crystal $129.95 /£82.00 $104.95 /£65.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

and Measurements Introduction toInstrumentation Textbook Suggested Price: March 2015,6x9,500pp. Print ISBN:978-981-4613-08-8 imaging. communications, industrialuses, remote sensing, chemical analysis, and2D/3D technologies byintroducingseveralsuccessfuldemonstrations,suchaswireless it. Inaddition,itisshownwhatcanactuallybedonewiththeterahertz-wave of the technology described, but alsosomeissuesandchallengesrelatedto technologies. Itdiscussesnotonlythetheoreticaldetailsandtypicalfeatures The bookcoverssomeofthetechnicalbreakthroughsintermsdevice Osaka University, Japan Tadao Nagatsuma Kanagawa, Japan NTT MicrosystemIntegrationLaboratories, Ho-Jin Song Edited by Devices andApplications Terahertz Technologies Handbook of Suggested Price: 2014,6x9, 234pp. January eBook ISBN:978-1-4665-8566-9 Print ISBN:978-981-4411-25-7 versatility ofthebasiceffectsinitiallydiscovered formicroscale. it coversthefirststepsofmovementto“nano”rangeasanexample the microwires. Whilethefocusremainsonglass-coveredwiresofmicrometerscale, idea ofmovingtonanoscale,maintainingtheachievedoptimalparameters of wires, takingintoaccountthetechnologicalapplication.Thebookpresents the magnetic, electrical,andmechanicalpropertiesofthe take placeinmagneticwiresandoptimizationofthe ofneweffectsthat two directionsofstudy:discovery A comprehensiveoverview, thisbookfocuseson Universidad delPaisVasco, SanSebastian,Spain Alexander ChizhikandJulianGonzalez Edited by A Magneto-OpticalStudy Magnetic Microwires Suggested Price: June 2014,7x10,927pp. eBook ISBN:978-1-4665-9682-5 Print ISBN:978-1-4665-9677-1 manual andfigureslidesareavailableuponqualifyingcourseadoption. (MEMS) sensors,andextensivebiomedicalexamplesproblems.Asolutions and microsensors,newmaterialonthedesignofmicro-electro-mechanical instrumentation, thebookfeaturestwo new chaptersonwirelessinstrumentation of examples. Idealforupperdivisionandgraduatestudentsrequiringanoverview the latestdevelopmentsininstrumentationandincludenewproblems biophysics, andappliedphysics,thisthirdeditionisfullyupdatedtoincorporate in manydepartmentsofelectricalengineeringaswellbioengineering, instrumentation andmeasurementscoursetaught A substantialrevisionofatextforstandard University ofConnecticut,Storrs,USA Robert B.Northrop Third Edition $179.95 /£114.00 $149.95 /£95.00 $129.95 /£82.00

3 Applied & Industrial Physics MEMS Cost Analysis Resistive, Capacitive, Inductive, From Laboratory to Industry and Magnetic Sensor Edited by Technologies Ron Lawes Winncy Y. Du Imperial College, London, UK Department of Mechanical Engineering, San Jose State University This volume demonstrates show cost analysis can be Series in Sensors adapted to MEMS, taking into account the wide range of processes and equipment, the major differences with This book examines existing, new, and novel sensor the established semiconductor industry, and the presence technologies and—through real-world examples, sample of both large-scale, product-orientated manufacturers and small- and medium- problems, and practical exercises—illustrates how the related science and

Applied & Industrial Physics scale foundries. The content examines the processes and equipment sufficiently engineering principles can be applied across multiple disciplines, offering greater for the reader to appreciate how costs arise. It examines representative costs insight into various sensors’ operating mechanisms and practical functions. are examined in sufficient detail and accuracy for specific equipment, processes, Assisting readers in understanding RCIM sensors, as well as sensors with similar products, or foundries to show how financial models can be introduced to design concepts, characteristics, and circuitry, the text not only covers silicon and estimate the cost and price for a MEMS product. metallic sensors but also those made of modern and specialized materials such as ceramics, polymers, and organic substances. Print ISBN: 978-981-4411-06-6 eBook ISBN: 978-981-4411-07-3 Print ISBN: 978-1-4398-1244-0 June 2014, 6 x 9, 306 pp. November 2014, 6-1/8 x 9-1/4, 408 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $129.95 / £82.00

Portable Biosensing of Food Toxicants and Semiconductor X-Ray Detectors Environmental Pollutants B. G. Lowe and R. A. Sareen Edited by Series in Sensors Dimitrios P. Nikolelis, Theodoros Varzakas, This book focuses on the history and development of Si(Li) Arzum Erdem, and Georgia-Paraskevi Nikoleli X-Ray Detectors, while providing an up-to-date review Series in Sensors of the principles, practical applications, and state of the art of semiconductor x-ray detectors. It describes many Biosensors are poised to make a large impact in of the facets of x-ray detection and measurement using environmental, food, and biomedical applications, as they clearly offer advantages semiconductors, from manufacture to implementation. over standard analytical methods, including minimal sample preparation and The initial chapters summarize relevant background physics, materials science, handling, real-time detection, rapid detection of analytes, and the ability to be and engineering aspects. Later chapters compare and contrast the manufacture used by unskilled personnel. Covering numerous applications of biosensors used and physical properties of systems and materials currently employed, enabling in food and the environment, this book presents basic knowledge on biosensor readers to fully understand the materials and scope for applications. technology at a postgraduate level and explores the latest advances in chemical sensor technology for researchers. Print ISBN: 978-1-4665-5400-9 eBook ISBN: 978-1-4665-5401-6 Print ISBN: 978-1-4665-7632-2 December 2013, 6-1/8 x 9-1/4, 624 pp. eBook ISBN: 978-1-4665-7633-9 4 Suggested Price: $177.95 / £113.00 October 2013, 6-1/8 x 9-1/4, 830 pp. Suggested Price: $209.95 / £134.00

Textbook Sensors for Process Control Research Methods in and Safety in Hydrogen Science and Engineering Technologies Scott A. Gold Thomas Hübert, Lois Brett-Boon, University of Dayton, Ohio, USA William Buttner, Ulrich Schmidtchen, Suitable as a text for first-year graduate students or and Bernd Fellmuth senior undergraduates in any science or engineering Series in Sensors discipline, this book focuses on the process of As interest in clean, renewable energy is increasing, conducting research rather than on discipline-specific hydrogen-based systems are being developed more and more. Hydrogen is also methods. The first half of the text focuses on the scientific method in practice. a key reagent in many industrial processes and a safety factor in the nuclear The second half of the text deals with skills and knowledge important to the industry. In all of these areas, specialist sensors and control systems are required. research process, including statistical measures in research, ethics, and safety. This clear, self-contained book provides a single source of information on Exercises and examples are provided throughout the text to guide both students the current state of sensors in order to support process control and safety in and instructors. Figure slides are available upon qualifying course adoption. hydrogen technologies and expected mass market applications. Print ISBN: 978-1-4822-0829-0 Print ISBN: 978-1-4665-9654-2 July 2015, 6-1/8 x 9-1/4, 232 pp., Soft Cover August 2015, 6-1/8 x 9-1/4, 320 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $149.95 / £95.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,326 pp.,SoftCover Print ISBN:978-1-4665-8839-4 slides areavailableuponqualifyingcourse adoption. tensors, dimensionalanalysis,andconic sections.Asolutionsmanualandfigure a guideforfurtherreading,andmathematicalappendicesonvectorcalculus, ofnotationsandconventions,alist importantconstants, includes afullglossary Mindful oftopicsthatareoftendauntingorconfusingtobeginners,thebook of each,providingnumerousexamplesandexercises toaidincomprehension. mechanics andrelativity. Itexplainsthecoreelements the mostessentialphysicalprinciplesbehindclassical text offers a combined presentation of only introductory Ideal forundergraduatephysicsandmathstudents,this University ofCambridgeFellowSt.Edmund’s College,UK Department ofAppliedMathematicsandTheoreticalPhysics, Peter J.O’Donnell Essential DynamicsandRelativity Textbook Suggested Price: October 2014,6-1/8x9-1/4,261pp.,SoftCover Print ISBN:978-1-4665-7183-9 available uponqualifyingcourseadoption. allow readerstointeractdirectlywithauthorsandotherexperts.Figureslidesare matter interactions,andoxidation/reduction.ATwitter accountandablog thermochemistry, solutionchemistry, masstransport,polymerization,light/ in relation to cars. Topicschemistry include the ideal gas law, materials chemistry, project andprovidesathorough,althoughnotexhaustive,presentationof course or capstone This book is suitable as anintroductory untapped pedagogicalresource forthestudyofchemistry. from achemicalperspective,therebymakingcarsan There isalmostnothinginacarthatcannotbedescribed Alfred University, NewYork, USA Geoffrey M.BowersandRuthA. through Cars Understanding Chemistry Textbook Suggested Price: April 2013,6x9,380pp. eBook ISBN:978-981-4316-69-9 Print ISBN:978-981-4316-31-6 constitutes amilestoneintheemergingfieldofbeyond-CMOStechnology. provides acomprehensivepictureofthestateartatcuttingedgeand also fromthepointofviewlarge-scaleindustrialproduction.Thepublication alternative approachesrelatedtobothsilicon-andcarbon-basedtechnologies, single-atom andsingle-electroneffectsinquantumdevices.Italsocoversthe equipment andtheintriguingnewphenomenarelatedto and relatedtechnology, aswelltherelevantelectronic This bookcoversthefabricationofsingle-atomdevices Waseda University, Tokyo, Japan Takahiro Shinada Laboratorio MDM-IMMCNR,Milan,Italy Enrico Prati Edited by Single-Atom Nanoelectronics $69.95 /£39.99 $39.95 /£25.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Nanoelectronics Suggested Price: December 2014,6-1/8x9-1/4,254pp.,SoftCover Print ISBN:978-1-4398-8882-7 upon qualifyingcourseadoption. author’s websiteoffersadditionalexampleproblems.Figureslidesareavailable references for further reading, and solution strategies/completesolutions. The formostproblems, involved. Thetextalsoprovidestherelevanttheory a rangeofareas,helpingstudentsthoroughlyunderstandthemathematics examples andproblemsthathighlightapplicationsin approach tofluiddynamics.Itincludesmanyworked this self-containedtexttakesahands-on,problem-based Designed forundergraduatestudentsinmathematics, University ofWarwick, UK Sergey Nazarenko and Solutions Fluid DynamicsviaExamples Textbook Suggested Price: March 2013,6-1/8x9-1/4,260pp.,SoftCover eBook ISBN:978-1-4665-1765-3 Print ISBN:978-1-4665-1763-9 course adoption. and originaljournalpublications.Figure slidesareavailableuponqualifying throughout, includingLandauandLifshitz’s famouscourseoftheoretical physics and tackletheproblemsthatfollow. Thetext alsoprovidesnumerousreferences tounderstand ofthedefinitionsandequationsthatarenecessary with asummary as well as additional problems and more detailed solutions. Each chapter begins revised andexpandededitionincludesanewchapteronmagnetohydrodynamics tested texttakesaproblems-basedapproachtoteachingcontinuousmedia. This Suitable foranycorephysicsprogram,thisclassroom- University ofManchester, UK VeksteinGrigory and MHD,SecondEdition Electromagnetism, FluidMechanics Problems andSolutionsin Physics ofContinuousMedia Textbook Suggested Price: 2015,6-1/8x9-1/4,432pp.,Pack-BookandEbook February Print ISBN:978-1-4987-0575-2 on high-fieldchargetransportaswelladiscussionassociateddevices. quantum wellsformingthecruxofnanoelectronics.Itincludesexclusivechapters module follows the bottom-up approach in moving from atomic structure to graphene, andcarbonnanotubes.Written fortheundergraduatelevel,this materials andisapplicabletonanolayers,nanowires, nanoelectronic anddevicepropertiesoflowdemensional devices andothermicro-circuits, thisbookfocuseson effects thathaveimpactonthedesignofoptoelectronic Based on the quantum-mechanicaland high-field Vijay KumarArora Low-Dimensional Nanoensembles Quantum Engineeringof $59.95 /£38.99 $62.95 /£39.99 $139.95 /£89.00

5 Applied & Industrial Physics / Applied Mechanics & Fluid Dynamics Applied Mechanics & Fluid Dynamics / Astronomy Astrophysics Simulations of Wavelet Analysis Oscillatory Systems in Civil Engineering with award-winning software Pranesh Chatterjee PHYSICS OF OSCILLATIONS TNO DIANA BV, Netherlands Eugene I. Butikov The principles of wavelets can be applied to a range of problems in civil engineering structures, such as This book provides exceptional insight into the theory of earthquake induced vibration analysis, bridge vibrations, oscillations, via a highly interactive computer simulation. and damage identification. This book is particularly Suitable for students studying a wide range of physics useful for graduate students and researchers in vibration courses from classical mechanics to electromagnetics, dynamics and oscillations. analysis, especially those dealing with random vibrations. The book explains The book also contains a simulation programme which readers can use to explore the importance of wavelets in terms of ground motion models with non- the subject at their own pace. This enables readers to learn, understand and stationarities. It includes the example of a tank to develop the problem and the explore fundamental concepts and laws of physics in application to oscillatory model, and explores several case studies. phenomena. A solutions manual is available upon qualifying course adoption. Print ISBN: 978-1-4822-1055-2 Print ISBN: 978-1-4987-0768-8 January 2015, 6-1/8 x 9-1/4, 213 pp. March 2015, 6-1/8 x 9-1/4, 360 pp., Pack - Book and Ebook Suggested Price: $129.95 / £82.00 Suggested Price: $89.95 / £57.99

Textbook Synthetic Jets Astrobiology Fundamentals and Applications An Introduction Edited by Alan Longstaff Kamran Mohseni Associate Lecturer in Astronomy and Earth Sciences, University of Colorado, Boulder, USA Open University, UK Rajat Mittal Series in Astronomy and Astrophysics The Johns Hopkins University, Baltimore, Maryland, USA Combining elements from physics, chemistry, astronomy, This book focuses on fundamental concepts and biology, molecular biology, ecology, planetary science, applications of synthetic jets, in particular their uses in flow geography, and geology, astrobiology is the study of the origin, evolution, control and thermal management in electronic devices. It provides a detailed distribution, and future of life in the universe. Assuming a minimal amount of and comprehensive understanding of the mechanisms underlying synthetic jet science knowledge, this text provides a full introduction to astrobiology suitable behavior, as well as surveys the state of the art and offers a pathway to future for undergraduate students. With an emphasis on bioscience, the text covers advances in the field. It discusses efforts to improve and accelerate the design such topics as stellar evolution, cosmic chemistry, planet formation, habitable and optimization processes involved in the wide breadth of applications from zones, terrestrial biochemistry, and exoplanetary systems. It also includes worked flow control to electronic cooling and propulsion. examples and problems. A solutions manual and figure slides are available upon qualifying course adoption. Print ISBN: 978-1-4398-6810-2 eBook ISBN: 978-1-4398-6811-9 Print ISBN: 978-1-4398-7576-6 September 2014, 6-1/8 x 9-1/4, 382 pp. December 2014, 6-1/8 x 9-1/4, 472 pp. 6 Suggested Price: $149.95 / £95.00 Suggested Price: $89.95 / £57.99

Textbook Textbook Transport Phenomena Astrobiology Fundamentals An Evolutionary Approach Third Edition Edited by Joel L. Plawsky Vera M. Kolb Rensselaer Polytechnic Institute, Troy, New York, USA University of Wisconsin-Parkside, Kenosha, USA Series: Chemical Industries This interdisciplinary text presents astrobiology as a This text is designed for a streamlined two-term dynamic, developing science of the utmost importance transport phenomena course. The first part of the book takes students through for the future of humanity. Featuring contributions from leaders in physics, the balance equation in the context of diffusive transport. Each chapter adds a chemistry, astronomy, biology, molecular biology, ecology, planetary science, term to the balance equation, highlighting the effects of that addition on the geography, and geology, the book discusses the evolution of abiotic matter to physical behavior of the system and the underlying mathematical description. biotic matter and emphasizes new discoveries in prebiotic chemistry, such as The second half of the book builds on the balance equation description of solid-state (solventless), in/on-water, and multicomponent reactions. It describes diffusive transport by introducing convective transport terms, focusing on partial the most challenging problems involved in the field of astrobiology and invites rather than ordinary differential equations. A solutions manual and figure slides the reader to become actively involved in their solution. An instructor’s manual are available upon qualifying course adoption. and figure slides are available upon qualifying course adoption. Print ISBN: 978-1-4665-5533-4 Print ISBN: 978-1-4665-8461-7 eBook ISBN: 978-1-4665-5534-1 eBook ISBN: 978-1-4665-8463-1 January 2014, 7 x 10, 838 pp. August 2014, 7 x 10, 504 pp., Soft Cover Suggested Price: $139.95 / £44.99 Suggested Price: $89.95 / £49.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2014,6-1/8x9-1/4,294 pp. Print ISBN:978-1-4822-3727-6 dark matter. and stellarevolution;theprocessesthat shapegalaxies;anddarkenergy planets, moons,and other bodiesthatconstituteour Solar System;starformation wavelengths. Readerswilldiscoverwhatinfraredastronomyrevealsabout the provides insightsintotheworkingsofuniversethatareunavailableatother with infrared astronomy. With color figures, itshows how infraredastronomy ofthescienceandtechnologyassociated an overview Accessible to amateur astronomers, this book presents Imperial CollegeLondon,UK David L.Clements Herschel SpaceObservatory from William Herscheltothe – SeeingtheHeat Infrared Astronomy Suggested Price: August 2014,6-1/8x9-1/4,269pp. eBook ISBN:978-1-4665-7212-6 Print ISBN:978-1-4665-7211-9 scattering, annihilation,andthelatestdarkmatterexperimentstechniques. calculation of relic density of a dark matter species; and reviews dark matter particle candidates for cold dark matter beyond the standard model;explains andextradimensions;explores introduces theoriessuchassupersymmetry matter, and the possible nature of dark matter distribution; of galaxiesandgalaxyclusters,evidencegalacticdark measurements. Itconsiderstheastrophysicalbehavior laws, relativity, andcosmologicalparameters astrophysics, thisbookdiscussessymmetries,conservation Encompassing cosmology, particlephysics,and Debasish Majumdar An Introduction Dark Matter Suggested Price: November 2013,7x10,554pp. eBook ISBN:978-1-4665-1120-0 Print ISBN:978-1-4665-1115-6 slides areavailableuponqualifyingcourseadoption. exoplanet searches, addsmoreproblems,andincludescolorimages.Figure in hardwareanddevices.Italsocoversnewertopicssuchasdarkmatter This editionreplacescoverageofoldertechnologieswithnewdevelopments in thiseditionhavebeenupdatedtoreflecttheneedsofmodernastronomers. employed in astronomy and astrophysics. All chapters account oftheinstruments,detectors,andtechniques courses, thispopulartextprovidesacomprehensive graduate Long usedinundergraduateandintroductory University ofHertfordshire,UK C.R. Kitchin Sixth Edition Astrophysical Techniques Textbook $49.95 /£31.99 $89.95 /£57.99 $83.95 /£40.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Planetary Science Planetary Textbook Suggested Price: 2015,6-1/8x9-1/4,346pp. January Print ISBN:978-1-4398-8590-1 and figureslidesareavailableuponqualifyingcourseadoption. properties.Asolutionsmanual to classifythestarsonbasisoftheirsurface the propertiesofstars.Theauthoralsoexploreshowstellarspectrumisused well ashowtheradiationreceivedischaracterizedandinterpretedtodetermine as properties. The text describes instruments used for astronomical observations photometry, continuousanddiscretespectrum,spectrallinestheir suchasradiation,electromagneticspectrum, observations, It then discussesbasic physics conceptsrelevantto stellar of stars, their basic properties, and observations. overview This textstartswithanintroductiontothenightskyand Indian InstituteofTechnology, Kanpur, India Pankaj Jain Astronomy andAstrophysics An Introductionto Textbook Suggested Price: April 2015,6-1/8x9-1/4,525pp. Print ISBN:978-1-4398-5306-1 website. and additionalmaterialareavailableon asupplementary includes examples,problems,andsolutions. Downloadableimages,animations, review ofthelatestdiscoveriesinnucleosynthesis andcosmochemistry. Italso advanced students, the book is the only one of its kind to provide an up-to-date as experimentalandtheoreticalnuclearphysics.Suitableforresearchers and astronomy, aswell computationalphysics,fluiddynamics,andcosmochemistry and influencesintheoreticalastrophysics,observational book examinesnuclearastrophysicsanditsimplications natureofthefield,this Highlighting themultidisciplinary Series inAstronomyandAstrophysics Technical University of Catalonia,Barcelona, Spain Jordi Jose Edited by Nucleosynthesis andCosmochemistry Stellar Explosions Suggested Price: June 2013,7x10,607pp.,SoftCover eBook ISBN:978-1-4665-6317-9 Print ISBN:978-1-4665-6315-5 upon qualifyingcourseadoption. provided onthebook’s CRCPresswebpage.Asolutionsmanualisavailable analytical treatments.To helpwithsolvingtheproblems,Fortranprogramsare them. Alongwithmoreproblems,thiseditionaddsnewmaterialandimproves associated withtheplanets,starstheyorbit,andinteractionsbetween Covering allofthesenewdiscoveries,thissecondeditionexplainsthescience planet. including the“demotion”ofourformerninthplanetPlutoasadwarf theories,andinterpretations, have producednumerousnewobservations, scientists Since thepublicationofpopularfirstedition,stellarandplanetary University ofYork, UK Michael M.Woolfson University ofHull,UK George H.A.Cole Second Edition The ScienceofPlanetsaroundStars, $79.95 /£49.99 $79.95 /£49.99 $94.95 /£59.99

7 Astronomy & Astrophysics Terahertz Astronomy Textbook Christopher K. Walker Modern Atomic Physics

Astronomy & Astrophysics / Atomic Molecular Physics This book reflects the power of today’s radio Vasant Natarajan technology, which allows for probing of the emission Indian Institute of Science, Bangalore, India and absorption of light by atoms and molecules in the This book provides a state-of-the-art account of atomic terahertz range. It covers the principles and practical physics within a basic quantum mechanical framework. techniques related to THz observations of interstellar It covers a range of topics—from the elementary to atoms, molecules, and dust, and shows how they the advanced—including the spontaneous emission of elucidate conditions within the interstellar medium radiation, stimulated transitions and the properties of that permeates our Galaxy and provide insights into the origins of stars, planets, gas, the physics and applications of resonance fluorescence, optical pumping, galaxies, and the Universe itself. cooling and trapping of charged and neutral particles, and atomic beam Print ISBN: 978-1-4665-7042-9 magnetic resonance experiments. Written by a practicing experimental physicist, April 2015, 7 x 10, 352 pp. the text reflects the latest advances in the field, supplying a contemporary Suggested Price: $129.95 / £82.00 understanding of the subject. A solutions manual and figure slides are available upon qualifying course adoption. Print ISBN: 978-1-4822-4203-4 March 2015, 6-1/8 x 9-1/4, 625 pp. Suggested Price: $89.95 / £57.99

Atomic and Molecular Beams Quantum-Chemical Calculation Production and Collimation of Unique Molecular Systems C.B. Lucas Visiting Fellow, Department of Physical Sciences, Two-Volume Set The Open University Edited by This comprehensive text explores the latest techniques Vladimir A. Babkin, Gennady E. Zaikov, for producing a beam from any substance as well as and A.K. Haghi from the dissociation of hydrogen, oxygen, nitrogen, Series: AAP Research Notes on Chemical Engineering and the halogens. Focusing on practical application in the laboratory, the author critically reviews over 800 references to compare the The major goals of quantum chemistry include increasing atomic and molecular beam formation theories with actual experiments. The the accuracy of the results for small molecular systems and increasing the size of book not only provides the basic expressions essential to beam design but also large molecules that can be processed, which is limited by scaling considerations— covers the construction of ovens, furnaces, and collimating arrays in metals, the computation time increases as a power of the number of atoms. This book plastics, glass, and other materials. Figure slides are available upon qualifying offers scope for academics, researchers, and engineering professionals to present course adoption. their research and development works that have potential for applications in several disciplines of computational chemistry. Contributions range from new Print ISBN: 978-1-4665-6103-8 methods to novel applications of existing methods to gain an understanding of eBook ISBN: 978-1-4665-6106-9 the concepts. December 2013, 6-1/8 x 9-1/4, 392 pp. Suggested Price: $209.95 / £134.00 Print ISBN: 978-1-926895-75-8 eBook ISBN: 978-1-4822-2433-7 8 February 2014, 6 x 9, 674 pp. Suggested Price: $249.95 / £159.00

Textbook Single Molecule Science A Laboratory Manual Physical Principles and Models in Biophotonics Dmitrii E. Makarov Vadim Backman, Adam Wax, and Hao Zhang University of Texas, Austin, USA The observation and manipulation of individual The increasing use of optical techniques for biomedical molecules is one of the most exciting developments applications has led to significant interest in in modern molecular science, and the utility of single- biophotonics as a growing field. From its basic concepts molecule methods has proven invaluable in such fields as to more advanced topics and applications, this book nanoscience and molecular biology. This book provides provides a complete guide to biophotonics. The author a general framework necessary for understanding single-molecule phenomena. offers both descriptive and quantitative perspectives as well as a comprehensive It introduces the relevant basic mathematical and physical concepts, and then overview of major areas of research in the field. The text includes coverage of discusses various approaches to the problem of interpreting single-molecule topics such as light tissue interaction, optical instrumentation, microscopic and data. It thoroughly explains the physical principles underlying the major classes macroscopic tissue imaging, tissue spectroscopy, therapeutic applications of of single-molecule experiments, such as fluorescence measurements, force-probe optics, and molecular imaging. A solutions manual and figure slides are available spectroscopy, and nanopore experiments. upon qualifying course adoption. Print ISBN: 978-1-4665-5951-6 Print ISBN: 978-1-4398-1051-4 March 2015, 6-1/8 x 9-1/4, 214 pp. May 2015, 7 x 10, 500 pp. Suggested Price: $119.95 / £76.99 Suggested Price: $89.95 / £57.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2014,7x10 eBook ISBN:978-1-4398-6319-0 Print ISBN:978-1-4398-0444-5 photonics. Extensivereferencesareprovided toenhancefurtherstudy. and methodsaswellclinicalapplications inimportantareasofbiomedical about themostrecentadvancesandpredictedtrendsininstrumentation engineers, manufacturers,teachers,students,andclinicalproviderstolearn researchinterdisciplinary anddevelopmentcriticallyneededforscientists, and instrumentationforbiomedicalphotonictechnologies.Itintegrates material andcoversthestate-of-the-artmethods photonics. Thissecondeditioncontainsintroductory advances andapplicationsintheareasofbiomedical This handbookpresentsthemostrecenttechnological Duke University, Durham,NorthCarolina,USA Tuan Vo-Dinh Edited by Three-Volume Set,SecondEdition Biomedical PhotonicsHandbook Suggested Price: May 2014,6x9,458pp. eBook ISBN:978-981-4411-59-2 Print ISBN:978-981-4411-58-5 that gap. few ofthemaredirectedtowardbasicbiologicalsciences.Thisbookbridges materials, instruments,andapplicationsinengineeringmedicine,butonly in biologicalsciences.Therearemanynanotechnologybooksthatfocuson newly developedtechnologies,andrecentapplicationsofAFMtechnologies (AFM) technologies.It covers basicAFMprotocols, ofmodernatomicforcean overview microscopy scientists inthefieldofnanobiology, thisbookprovides Edited byDr. Takeyasu, withcontributionsfromleading Kyoto University, Japan Kunio Takeyasu Edited by in Nanobiology Atomic Force Microscopy Suggested Price: March 2013,7x10,487pp. eBook ISBN:978-1-4665-1014-2 Print ISBN:978-1-4665-1013-5 asanexcellentresourcewill serve forotherresearchers. and theoreticians,thisbookpresentsthelatestresearch methodsandresults the fieldandwithcontributionsfromtopresearchers, includingexperimentalists are spreadingtobiologyandmaterialsscience.Editedbyarecognizedleaderin spectroscopy isdevelopingrapidlyanditsapplications spectroscopy. Thetechnologyofmultidimensional multidimensional methodsintoinfraredandoptical The pasttenyearsorsohaveseentheintroductionof Stanford University, California,USA Michael D.Fayer Edited by Vibrational Spectroscopy Ultrafast Infrared

$299.95 /£191.00 $149.95 /£95.00 $132.95 /£85.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Handbook, SecondEdition Biomedical Photonics Suggested Price: July 2014,7x10,850pp. eBook ISBN:978-1-4200-8513-6 Print ISBN:978-1-4200-8512-9 teaching, learning,andpracticeofmedicaltechnologies. devices. Itisanauthoritativereferencesource forthoseinvolvedintheresearch, first volumefocusesonthefundamentalsandadvancedopticaltechniques effectiveness ofphotonicmodalitiesinmedicaldiagnosticsandtherapy. The explosive growth due tothe non-invasiveor minimally invasivenatureandcost- to addressproblemsinmedicineandbiology. Thefieldhasexperienced harnessing lightandotherformsofradiantenergy Biomedical photonicsisdefinedasthescienceof Duke University, Durham,NorthCarolina,USA Tuan Vo-Dinh Edited by Fundamentals, Devices,andTechniques Handbook, SecondEdition Biomedical Photonics Suggested Price: July 2014,7x10,767pp. eBook ISBN:978-1-4200-8517-4 Print ISBN:978-1-4200-8516-7 the thirdvolumefocusesontherapeutic andfuturetrends. an authoritativeresource thatexaminesthepotentialofphotonicsinmedicine; of photonicmodalitiesinmedicaldiagnosticsandtherapy. Thissecondedition is growth duetothenon-invasiveorminimallyinvasivenatureandcosteffectiveness address problemsinmedicineandbiology. Thefieldhasexperiencedexplosive harnessing lightandotherformsofradiantenergyto Biomedical photonicsisdefinedasthescienceof Duke University, Durham,NorthCarolina,USA Tuan Vo-Dinh Edited by Therapeutics andAdvancedBiophotonics Handbook, SecondEdition Biomedical Photonics Suggested Price: July 2014,7x10,889pp. eBook ISBN:978-1-4200-8515-0 Print ISBN:978-1-4200-8514-3 research, teaching,learning, andpracticeofmedicaltechnologies. to thebedside.Itisanauthoritativereferencesource forthoseinvolvedinthe focuses on biomedical diagnostic technologies and applications from the bench of photonicmodalitiesinmedicaldiagnosticsandtherapy. Thesecondvolume growth duetothenon-invasiveorminimallyinvasivenatureandcost-effectiveness address problemsinmedicineandbiology. Thefieldhasexperiencedexplosive harnessing lightandotherformsofradiantenergyto Biomedical photonicsisdefinedasthescienceof Duke University, Durham,NorthCarolina,USA Tuan Vo-Dinh Edited by Biomedical Diagnostics $189.95 /£121.00 $189.95 /£121.00 $189.95 /£121.00

9 Atomic & Molecular Physics / Biophysics Biophysics for Beginners Cellular Potts Models A Journey through the Cell Nucleus Multiscale Extensions and Biological Helmut Schiessel Applications Leiden University, the Netherlands Marco Scianna and Luigi Preziosi This textbook gives compact introductions to the basics of Politecnico di Torino, Italy the field (areas such as molecular cell biology and statistical Series: Chapman & Hall/CRC Mathematical and Computational Biology physics) and then presents in-depth discussions of more advanced biophysics subjects, progressing to state-of-the- This work shows how the cellular Potts model can art experiments and their theoretical interpretations. The be used as a framework for model building and how book is unique by offering a general introduction to biophysics, yet at the same extended models can achieve even better biological practicality, accuracy, and time restricting itself to processes that occur inside the cell nucleus and that predictive power. It focuses on ways to integrate and interface the basic cellular involve biopolymers (DNA, RNA, and proteins). This allows for an accessible read Potts model at the mesoscopic scale with approaches that accurately model for beginners and an springboard for specialists who wish to continue their study microscopic dynamics. These extensions are designed to create a nested and in more detail. hybrid environment, where the evolution of a biological system is realistically driven by the constant interplay and flux of information between the different Print ISBN: 978-981-4241-65-6 levels of description. Biophysics eBook ISBN: 978-1-4665-1718-9 December 2013, 6 x 9, 420 pp. Print ISBN: 978-1-4665-1478-2 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4665-1479-9 March 2013, 6-1/8 x 9-1/4, 301 pp. Suggested Price: $104.95 / £65.99

Cell Membrane Nanodomains From Biochemistry to Nanoscopy Computational and Visualization Edited by Alessandra Cambi Techniques for Structural Radboud University Nijmegen Medical Centre, the Netherlands Bioinformatics Using Chimera Diane S. Lidke Forbes J. Burkowski University of New Mexico, Albuquerque, USA University of Waterloo, Ontario, Canada This book furthers the readers’ understanding of the Series: Chapman & Hall/CRC Mathematical fundamental molecular mechanisms that govern and Computational Biology nanostructures and protein function relationships at the cell membrane and This book shows how to perform computations with explains the ins and outs of this rapidly developing high- or super-resolution Python scripts in the Chimera environment. It covers microscopy field. Contributing writers include experts from the optical nanoscopy topics that deal primarily with protein structure and encourages mathematical and microscopy fields, biophysicists, biochemists, and cell biologists. Since analysis by providing a firm foundation for computations. Through more than 60 superresolution optical techniques helped advance the understanding of cellular exercises that involve the development of Python scripts, the book gives readers structure and protein behavior, there is a special emphasis on technologies that concrete guidance on using the scripting capabilities of Chimera. Python scripts are enabling the visualization of lipids, proteins, and other molecular components and other material are available on a supplementary website. at unprecedented spatiotemporal resolution. Print ISBN: 978-1-4398-3661-3 Print ISBN: 978-1-4822-0989-1 eBook ISBN: 978-1-4822-6234-6 10 October 2014, 6-1/8 x 9-1/4, 510 pp. July 2014, 6-1/8 x 9-1/4, 461 pp., Pack - Book and Ebook Suggested Price: $139.95 / £89.00 Suggested Price: $79.95 / £49.99

Cells, Forces, and the Computational Approaches Microenvironment to Protein Dynamics Edited by From Quantum to Coarse-Grained Charles M. Cuerrier and Andrew E. Pelling Methods University of Ottawa, Canada Edited by This book provides a broad overview of how Monika Fuxreiter mechanical forces and properties govern diverse University of Debrecen, Hungary aspects of physiological and pathological processes. Series in Computational Biophysics It also covers new emerging techniques developed to study complex biosystems such as microfluidics, traction force microscopy, This groundbreaking work addresses a crucial paradigm shift in structural and the development of novel biomaterials for tissue engineering. Importantly, molecular biology, illustrating how protein dynamics plays a central role in various chapters in this book are not limited to applications in animal cell biology, but functions, including enzymatic catalysis, protein–protein interactions, and the also cover important dimensions in other kingdoms such as plants and bacteria. organization of complex assemblies. The book presents modern computational techniques for the characterization of proteins and their dynamic properties. The Print ISBN: 978-981-4613-36-1 computational methods specifically address the dynamical aspects of protein May 2015, 6 x 9, 450 pp. functionalities, with special emphasis on the analysis of complex assemblies and Suggested Price: $149.95 / £95.00 intrinsically disordered proteins. Print ISBN: 978-1-4665-6157-1 January 2015, 6-1/8 x 9-1/4, 488 pp. Suggested Price: $129.95 / £82.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,366 pp.,SoftCover Print ISBN:978-1-4200-8410-8 slides areavailableuponqualifyingcourse adoption. the foundationandfrontierofsystems biology. Asolutionsmanualandfigure textbook introducesreaderstothefield, walkingthemthroughstudiesthatare of computationalmodelingandhigh-throughput molecularbiology. This this complexity?Systemsbiologyaddressesneed,standingattheintersection hundreds, oreventhousands,ofgeneproducts.Howdowebegintounderstand diseases suchascancerandheartdiseasearerelatedtotheinteraction of processes onegeneatatime,butmanyofthemostpressingquestions and For decadesbiologyhasfocusedondecodingcellular Stanford University, California,USA Markus W. Covert to Whole-cellModels From SyntheticCircuits Systems Biology Fundamentals of Textbook Suggested Price: 2013,6-1/8x9-1/4,400pp. February eBook ISBN:978-1-4398-9923-6 Print ISBN:978-1-4398-9922-9 understanding awidearrayofsolutionproperties. and biophysics. The text elucidates this rigorous and useful approach for range ofapplicationsdescribedbyexpertsinchemistry, chemicalengineering, book outlinesthegeneralconceptsandtheoreticalbasisofFSTprovidesa theoretically understandingsolutionmixturethermodynamicproperties.This and theirsizes.Itisthemostcompleteaccurateapproachavailablefor number ofcomponentsandtheirconcentrations,thetypesmolecules can beappliedtoanystablesolutionregardlessofthe that (FST)isanexacttheory Fluctuation SolutionTheory and JohnP. O’Connell Paul E.Smith,EnricoMatteoli, Edited by Engineering, andBiophysics Applications inChemistry, Chemical ofSolutions Fluctuation Theory Suggested Price: 2015,7x10,472pp. February Print ISBN:978-1-4822-3081-9 therapy. aspectsofthistechnology. Thisbookemphasizesthemultidisciplinary and imaging,allofwhicharebeingappliedtomedicalresearch, diagnostics,and lasers, opticaldevices,fiberoptics,physicalandchemicalsensors,spectroscopy been explosive.Newapplicationsaremadepossiblebyemergingtechnologiesin technology for biomedical research and health care has Recent growthintheuseofcomputationaloptical Prairie View A&MUniversity, Houston,Texas, USA Sarhan M.Musa Edited by and Imaging Biomedical Spectroscopy Computational Optical $79.95 /£49.99 $132.95 /£85.00 $199.95 /£127.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Handbook ofIonChannels Suggested Price: October 2014,8-1/2x11,579pp.,Pack-BookandOnline Print ISBN:978-1-4665-8813-4 of tissues,cells,andproteins. of imagingtechnologiestostudydeformation,stress,andconstitutivebehavior organs toindividualmacromolecules.Itdiscussestheselectionandapplication visualization ofthemorphologyandmechanicslargesmall—from handbook presentsthespectrumofimagingtechniquesusedfornoninvasive and examinebiologicalspecimensatthenanoscale.This of cancer, dissecttheoriginsofcellularforce regulation, and othermethodsnowallowustostudythemechanics resolution microscopy, fluorescencefluctuationanalysis, Transformative technologiessuchasmicroCTscans,super- Corey P. NeuandGuyM.Genin Edited by Biological Mechanics Handbook ofImagingin Suggested Price: 2013,8-1/2 x11,1174pp. February eBook ISBN:978-1-4200-8833-5 Print ISBN:978-1-4200-8832-8 understanding thedata. sections thatexplainimportantconcepts andprovideabroaderframeworkfor expanded informationonglycolipidsandincludesmoredetailedintroductory andcubicphases.It alsopresentsmuch isotherms, spontaneouscurvature, edition containsnewsectionsonphasediagramswithcholesterol,hydration with basic thermodynamic data. With more than twice as much data, thissecond structural properties of phospholipid bilayers, along bilayers. Coverageincludesbothdynamicand physicochemicaldatarelatingtophospholipid primary This handbookprovidestheonlyone-stopresource for Göttingen, Germany Max-Planck-Institut fürbiophysikalischeChemie, Derek Marsh Second Edition Handbook ofLipidBilayers Suggested Price: 2015,8-1/2x11,699pp. February Print ISBN:978-1-4665-5140-4 mental illness,heartdisease,anesthesia,andotherclinicalapplications. The bookalsohighlightshowionchannelsarekeytargetsforpharmaceuticalsin and regulatingresponsestophysicalstimuli,suchastemperaturepressure. stimuli,suchaslight,sound,odor,cells; mediatingresponsestosensory andtaste; disease. Itillustratestheirvitalimportanceincontrollingthepropertiesofvarious membrane proteinsthatimpact human healthand and up-to-date reference for the field, covering all This handbookprovidesthemostcomprehensive Baltimore,USA University ofMaryland, Matthew C.Trudeau University ofCaliforniaatDavis,USA Jie Zheng Edited by $199.95 /£127.00 $262.00 /£167.00 $199.95 /£127.00

11 Biophysics Inside the Photon Introduction to A Journey to Health Quantum Biology Tony Fleming Victor Anisimov and James J.P. Stewart Biophotonics Research Institute, Highett, Australia This book introduces the reader to the theory and This book describes the newly discovered layer of methodology of quantum-mechanical modeling of biophotonics underlying all atomic chemistry and chemical and biological systems. Given the immense biochemistry. As with the variety of snowflakes, the range complexity of such systems, there is a constant search in biological species within flora for instance is dependent for new methods. The goal of this text is to derive on this biophotonic layer of interaction within atomic approximate (semi-empirical) methods to address and biomolecular structures. The book examines the phonon, the quantum of this class of problems and to provide insight for their continued development. acoustic, or vibrational, energy and alongside the photon. Hence the ‘biophonon’ The authors cover such important topics as molecular dynamics, high sits aside the biophoton as an element within biological structures. Sounds can performance computing, free energy calculations, statistical mechanics, long- create structure in the same way biophotons can use structure to communicate. range electrostatics, and many-electron systems. They also discuss applications for water salvation, chemical reactions, conformational sampling, and structure Print ISBN: 978-981-4241-40-3 relaxation. eBook ISBN: 978-981-4241-88-5

Biophysics March 2014, 6 x 9, 312 pp. Print ISBN: 978-1-4398-3905-8 Suggested Price: $149.95 / £95.00 April 2015, 6-1/8 x 9-1/4, 432 pp. Suggested Price: $99.95 / £63.99

Introduction to Enzymology Liposomes, Lipid Bilayers Edited by and Model Membranes Haruo Suzuki From Basic Research to Application Kitasato University, Kanagawa-ken, Japan Edited by This book starts with an introduction to various enzymes Georg Pabst, Norbert Kucˇerka, Mu-Ping Nieh, to show how interesting enzymes are. It is followed by and John Katsaras historical kinetic studies on enzymes and the overall With contributions from leading researchers in their fields, rapid-reaction kinetics. The subsequent topics describe this book describes state-of-the-art lipid/model membrane the basics of protein structure, the control of enzyme research, and industrial and medical applications, all in one volume. The book is activity, and the purification of enzymes. A case on the kinetic and structural divided into two sections. The first section covers a range of basic research topics, studies of L-phenylalanine oxidase is also presented. There are many good books from theory and computational simulations to current experimental research. The on enzyme kinetics, but only a few books describe their kinetic and structural second part describes applications of lipid systems used in the pharmaceutical, aspects. This book deals with both and contains many references that can be textile, and food industries. Covering basic and applied research, this book serves good sources for further readings. The book is handy and is especially helpful as a useful reference for both the novice and the expert. for beginners. Print ISBN: 978-1-4665-0709-8 Print ISBN: 978-981-4463-92-8 eBook ISBN: 978-1-4665-0711-1 March 2015, 6 x 9, 250 pp. March 2014, 7 x 10, 478 pp. Suggested Price: $149.95 / £95.00 12 Suggested Price: $149.95 / £95.00

Textbook Mass Spectrometry Introduction to Fluorescence for the Novice David M. Jameson John Greaves University of Hawaii, Manoa, USA University of California, Irvine, USA In color throughout, this text helps readers acquire a John Roboz sound understanding of basic fluorescence theory and Mount Sinai School of Medicine, New York, New York, USA practice. It takes them through the history of important Using simple language, newly drawn color figures, clever discoveries to the most current advances. The author cartoons, and assuming no prior knowledge, this book introduces the fundamentals of the fluorescence provides an understandable entrée to mass spectrometry. phenomenon and gives detailed examples of fluorescence applications in the It presents novice users with detailed descriptions of principles of instrument molecular life sciences, including biochemistry, biophysics, clinical chemistry and operations and analytical strategies. The book focuses on commonly used diagnostics, pharmaceutical science, and cell and molecular biology. The text instrument systems and analytical strategies covering chemical, environmental, includes references in each chapter, more than 250 figures, and the chemical biological, and medical research, helping novices make informed choices. A structures of the most widely used fluorescent molecules. unique and brief chapter summarizes the absolute essentials (a set of take-home Print ISBN: 978-1-4398-0604-3 messages). A series of diverse examples from the literature are provided. eBook ISBN: 978-1-4398-0605-0 Print ISBN: 978-1-4200-9418-3 January 2014, 6-1/8 x 9-1/4, 313 pp. eBook ISBN: 978-1-4200-9420-6 Suggested Price: $79.95 / £49.99 October 2013, 6-1/8 x 9-1/4, 309 pp., Soft Cover Suggested Price: $74.95 / £44.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2013,6x9,452pp. January eBook ISBN:978-981-4303-62-0 Print ISBN:978-981-4303-61-3 techniques assensorsifcombinedwith functionalization. in thebiologicalandmedicalfieldare presentedtoshowthepotentialofsuch nanoparticles, plasmonresonance,field enhancement,etc.).Someapplications field optics,andtherelatedphysical processes(opticalpropertiesofmetallic focuses ontheenhancedspectroscopy, including SERS,SEIRA/SEIRS,andnear- nanobiosensor andpresentsthelatestinformationfromrenownedexperts. It a This bookconcentratesonthevariousfieldsrelatedtodevelopment of Kirchhoff-Institut fürPhysik, Heidelberg,Germany Annemarie Pucci Université Paris13,Bobigny, France Marc LamydelaChapelle Edited by for BiotechnologicalApplications Plasmon-Enhanced Spectroscopies Nanoantenna Suggested Price: August 2014,6-1/8x9-1/4,388pp. eBook ISBN:978-1-4665-6296-7 Print ISBN:978-1-4665-6295-0 critical questionsinmodernquantitativebiology. of theartexampleshowmolecularmodelingapproachesarebeingappliedto leading expertsonthistransformationinmolecularbiology, illustratingwithstate such asfoldingdynamicsofkeyproteins.Itencompassestheperspectives computingwithcharacterizationofimportantbiologicalprocesses, performance reflectstherecentadvancesinbridgingnovelalgorithmsandhigh summary techniques haveenabledawiderangeofbiologicalapplications.Thistimely Developments inmolecularmodelingfromexperimentalandcomputational Series inComputationalBiophysics Yorktown Heights,NewYork, USA IBM T.J. Watson Research Center, Ruhong Zhou Edited by in QuantitativeBiology Methods andApplications at theAtomicScale Molecular Modeling Suggested Price: May 2015,6x9,350pp. Print ISBN:978-981-4316-83-5 of biomechanics. chapters writtenbyprominentengineersandphysicistsworkinginvariousfields larger-scale tissues.Itdiscussesvarioustissuesorcellularsystemsthroughthe smallscaleuptothe biomechanics, andthengraduallymovesfromthevery to thescalesandtermsthatareusedinfieldofcellularmolecular fundamental level.Itbeginswithageneralintroduction of cellularandmolecularmechanicsonamore physical sciencesandprovidesanunderstanding The book bridges the gaps between life sciences and University ofMontana,Missoula,USA Bradley Layton Edited by Cellular Biomechanics Molecular and $149.95 /£95.00 $99.95 /£63.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: September 2014,7x10,408pp. eBook ISBN:978-1-4665-0999-3 Print ISBN:978-1-4665-0998-6 and medicine. methods. Thelasttwosectionsexploreapplicationsinbiochemistry, cellbiology, of quantitative,noninvasive,autofluorescencemicroscopyand spectroscopy functions. Thesecondsectionoutlinesthetheoreticalandtechnicalbackground pathways aswellnaturalbiomarkerswithinthecontextoftheirbiological book’s firstsectionintroducesthefundamentalsofcellularenergymetabolic mapping andclinicaldiagnosisofhealthydiseasedcellstissues.The biomarkers andhighlightsadvancesinusingtheseforthemetabolic This guide covers the current state of knowledge on intrinsic fluorescent Series inCellularandClinicalImaging University ofMinnesota,Duluth,USA Ahmed A.Heikal University ofNorthCarolina,ChapelHill,USA Vladimir V. Ghukasyan Edited by Biology, Techniques, andApplications Cellular Metabolism Natural Biomarkersfor Suggested Price: June 2015,7x10, 392pp. Print ISBN:978-1-4665-1027-2 are availableuponqualifyingcourseadoption. applications ofultrasoundtherapyinclinics. Asolutionsmanualandfigureslides structures ofcommercially availabletherapeuticultrasoundsystems, andvarious physical principlesofbiomedicalacoustics, ultrasoundcalibrationmethods, application oftherapeuticultrasound devices.Itdiscussesthefundamental this textsystemicallyintroducesthe concepts,principles,construction,and for medicaldeviceengineers,research scientists,andhealthcareprofessionals, Suitable asatextbookorquickreference anddenervation. as drugdelivery kidney stones and tumors and newer applications, such Therapeutic uses of ultrasound include ablation of Nanyang Technological University, Singapore Yufeng Zhou in Healthcare Therapeutic Ultrasound Principles andApplicationsof Textbook Suggested Price: 2015,6-1/8x9-1/4,376pp. January Print ISBN:978-1-4665-1011-1 methods thatinvolvemodelingoroptogenetics. applications, includinguseinhighthroughputdrugscreeningandintegrated events invariouslivingsystems.Thefinalsectionaddressesseveraladditional in vivo,eitherfortrackingcertainbiomoleculesorvisualizingcellular core chaptersfocusonthedesignandapplicationofspecificopticalbiosensors development offluorescentimagingapproaches.The moving ontofoundationsofengineeringbiosensorsand It beginswithanhistoricalperspectiveonthefield, and applicationofopticalbiosensorsindiversecontexts. This bookhighlightsthekeyconceptsunderlyingdesign Series inCellularandClinicalImaging,6 Jin Zhang,SohumMehta,andCarstenSchultz Edited by Optical ProbesinBiology $149.95 /£95.00 $149.95 /£89.00 $129.95 /£82.00

13 Biophysics Redox Proteins in Skin Bioscience Supercomplexes A Molecular Approach and Signalosomes Edited by Edited by Toyoko Imae National Taiwan University of Science & Technology, Taipei Ricardo Saraiva Loureiro de Oliveira Louro and Irene Diaz-Moreno This book introduces skin bioscience with a specific focus on the molecular approach. Following the description of Redox supercomplexes and signalosomes are large the fundamental structure and unique functionality of and often transient associations of multiple redox the skin, it examines the response of the skin to exterior proteins which play a vital role in numerous cellular processes. Supercomplexes stimulation. It also focuses on the beautification and regeneration of the skin. This and signalosomes provide the link between reductive- and systems- biology book provides readers with the molecular knowledge of the skin and stimulates in understanding how the molecular properties of individual macromolecular their interest in further investigation and development of skin bioscience. components bring about cellular function. This book provides a coherent view of the key role played by redox proteins and their interaction network in a wide Print ISBN: 978-981-4364-95-9 range of essential cellular processes in all domains of life. eBook ISBN: 978-981-4364-96-6 February 2014, 6 x 9, 240 pp. Print ISBN: 978-1-4822-5110-4 Biophysics Suggested Price: $149.95 / £95.00 June 2015, 6-1/8 x 9-1/4, 400 pp. Suggested Price: $149.95 / £95.00

Spike Timing Mechanisms and Function Rule-Based Modeling Edited by in Systems Biology Patricia M. DiLorenzo James Faeder Binghamton University, New York, USA University of Pittsburgh, Pennsylvania, USA Jonathan D. Victor William S. Hlavacek Weill Medical College of Cornell University, New York, USA Los Alamos National Laboratory, New Mexico, USA Series: Frontiers in Neuroscience Series: Chapman & Hall/CRC Mathematical and Computational Biology Neuronal communication forms the basis for all behavior, from movement to thought processes. Among the many mechanisms that This book covers computational modeling of support these functions, spike timing is among the most powerful. This volume “biomolecular site dynamics”. It also describes the use of rule-based modeling, examines the function of spike timing in sensory, motor, and integrative in coordination with quantitative experimental approaches, to gain insights into processes. The first section of the book describes the foundation for quantitative site dynamics and to introduce the basic concepts and techniques of rule-based analysis and theory. It examines the information contained in spike timing, how modeling. The book is divided into three parts. The first part covers the biological it can be quantified, and how neural systems can extract it. The second section significance and physical chemistry of site dynamics. The second part provides an explores how input-output relationships are reflected in spike timing across a introduction to the essential methodology of rule-based modeling. The third part range of sensory systems. consists of examples of rule-based modeling capabilities. Print ISBN: 978-1-4398-3815-0 Print ISBN: 978-1-4822-3631-6 eBook ISBN: 978-1-4398-3816-7 14 June 2015, 6-1/8 x 9-1/4, 350 pp., Pack - Book and Ebook May 2013, 6-1/8 x 9-1/4, 442 pp. Suggested Price: $79.95 / £49.99 Suggested Price: $157.95 / £99.00

Second Harmonic Textbook Generation Imaging Systems Biology Edited by Mathematical Modeling Francesco S. Pavone and Model Analysis Universita degli Studi di Firenze, Sesto Fiorentino, Italy Andreas Kremling Paul J. Campagnola Technical University Munich, Germany University of Wisconsin-Madison, USA Series: Chapman & Hall/CRC Mathematical Series in Cellular and Clinical Imaging and Computational Biology

Second-harmonic generation (SHG) serves as the basis for Drawing on the latest research in the field, this text a microscope imaging contrast mechanism that visualizes cell and tissue structure presents many methods for modeling and analyzing biological systems, in and function. This book gives a complete overview of the principles underlying particular cellular systems. It shows how to use predictive mathematical models this technique and its current applications, including use in molecular sensing. to acquire and analyze knowledge about cellular systems. It also explores how Covering practical issues related to instrumentation and methods, the text offers the models are systematically applied in biotechnology. The book includes many detailed reviews of the capabilities and use of SHG in biomedical research, from analytical and numerical examples as well as exercises and a bibliography at the imaging of cancer and skin disorders to self-assembled gels, holographic SHG end of each chapter. MATLAB® code is available on the book’s CRC Press web imaging, and tissue engineering applications. page. A solutions manual and figure slides are available upon qualifying course Print ISBN: 978-1-4398-4914-9 adoption. eBook ISBN: 978-1-4398-4915-6 Print ISBN: 978-1-4665-6789-4 June 2013, 7 x 10, 476 pp. eBook ISBN: 978-1-4665-6807-5 Suggested Price: $157.95 / £99.00 November 2013, 6-1/8 x 9-1/4, 379 pp. Suggested Price: $83.95 / £52.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2001,8x 10,2814pp. eBook ISBN:978-1-4200-5072-1 Print ISBN:978-0-7503-0313-2 methods, andapplications. or physicist.Theencyclopedia’s threemajorsectionsdiscuss fundamentals, been takentoensurethatthereading levelissuitableforthetrainedchemist symbols and abbreviations to make this a user-friendlyencyclopedia. Care has a morecompleteanddetailedexplanation. Particularattentionhasbeenpaidto the basics,definesscopeofeachsubdiscipline,andindicateswheretogo for techniques, and describesmodern endeavors. The encyclopedia quicklyprovides possibly unfamiliarareas,explainsimportantexperimentalandcomputational The Swiss FederalInstituteofTechnology, Switzerland Nicholas D.Spencer USA University ofMaryland, John H.Moore Edited by Three-Volume Set Physics andPhysicalChemistry Encyclopedia ofChemical Suggested Price: April 2013,6-1/8x9-1/4,294pp. eBook ISBN:978-1-4665-8410-5 Print ISBN:978-1-926895-36-9 complete understandingofsuchcomplexphenomena. capable ofanswermanyimportantbiologicalquestionsandtoachieveamore detailed biochemicalandbiophysicaldata,mathematicalmodelingare cells anddescribeshowacombinationofquantitativelivecellobservations, tumor development.Itpresents recent advances in biophysical studiesof living cell behavior, multicellularstructures,morphogenesis,and such biologicalphenomenaascelldivision,motility, collective This bookcoversawidescopeofbiologicalapproachesto Pavel Kraikivski Edited by Growth Phenomena From CellDynamicsToward Multicellular Trends inBiophysics Suggested Price: April 2014,6-1/8x9-1/4,347pp. eBook ISBN:978-1-4398-7509-4 Print ISBN:978-1-4398-7508-7 microscopies formolecularimaging. assessing protein dynamics, FRET microscopy of living cells, and superresolution also coverscutting-edgeimagingapplications,includingvariationsofFRAPfor discusses fluorescentproteinswithnovelphotophysicalproperties.Thebook fluorescent proteins and the revolution they enabled in cellular imaging. It then of techniques thatexploitfluorescentproteins.Thebookfirsttracesthehistory latest advancesinthefield,includingassociateddevelopmentofimaging This bookpresentsthefundamentalprinciplesand Series: SeriesinCellularandClinicalImaging Florida StateUniversity, Tallahassee, USA Michael W. Davidson Indiana University, Indianapolis,USA Richard N.Day Edited by Revolution The FluorescentProtein introduces andChemicalPhysics introduces Encyclopedia ofPhysicalChemistry $1528.00 /£973.00 $139.95 /£89.00 $129.95 /£82.00

For more informationand acompletelistof titles,visitusat www.crcpress.com in ChemicalPhysics Quantum MechanicalTunneling Suggested Price: November 2014,6-1/8x9-1/4,346pp. Print ISBN:978-1-4398-8330-3 techniques essentialtomeasuringthequalityofgrowncrystals. solid–solid, liquid–solid,andvapor–solidequilibriadescribescharacterization growth.Hediscussesthemajortechniquescategorizedby techniques ofcrystal growth,andphasediagrams.Healsopresentstheexperimental ofcrystal theory screwdislocation growth mechanism,defectsincrystals, The authorcoversnucleation,two-dimensionallayer and includesbackgroundinformationwheneverpossible. their origins.Itoffersahistoricalperspectiveofthesubject and bookteachesreadersaboutcrystals This introductory Indian InstituteofScience,Bangalore H.L. Bhat Principles andPractice Growth Introduction toCrystal Suggested Price: August 2014,6x9,306pp. eBook ISBN:978-1-4822-4097-9 Print ISBN:978-1-77188-011-4 domains. and industry, providingthelatestdevelopmentsinadvancedmaterials chemical research contributionsfromeminentexpertsinthefieldbothacademic inmicroandnanoscalematerials. Itbringstogether in physicsandchemistry This book covers a selection of recent research studies and new developments Madrid, Spain Institute ofPolymerScienceandTechnology (ICTP), Nekane Guarrotxena Edited by Nanoscale Materials inMicroand Chemistry ofPhysicsand Interfaces Research Methodologyon Suggested Price: April 2013,6-1/8x9-1/4,226pp. eBook ISBN:978-1-4665-0732-6 Print ISBN:978-1-4665-0731-9 chemical reactions. of reactionrateconstantsforbothelectronicallyadiabaticandnonadiabatic discusses tunnelinginchemicalreactions,includingtheoriesfordirectevaluation and chemicaldynamicsproblems.Itexplainsnonadiabaticphenomena.also phenomena andusethedescribedmethodsforvariousmolecularspectroscopy concepts anddynamicsofmultidimensionaltunneling offers informationsoreaderscanunderstandthebasic applications torealmultidimensionalsystems.Thetext tunneling. Itpresentspracticalmethodsandnumerical theories developedbytheauthorsinquantummechanical This bookpresentsbasictheoriesaswelloriginal Hiroki NakamuraandGennadyMil’nikov $129.95 /£82.00 $139.95 /£89.00 $132.95 /£85.00

15 Biophysics / Chemical Physics Water at Interfaces Textbook A Molecular Approach Introduction to Jordi Fraxedas Numerical Programming ICN2 & CSIC, Bellaterra (Barcelona), Spain A Practical Guide for Scientists and This book provides a broad, multidisciplinary introduction Engineers Using Python and C/C++ to water at interfaces, focusing on its molecular nature. It is

Chemical Physics / Computational Titus A. Beu written for practicing scientists and engineers who want a University Babe-Bolyai, Cluj-Napoca, Romania fundamental understanding of what water does at surfaces Series in Computational Physics and interfaces. It covers a host of examples to convey general principles, including the hydrophobicity and hydrophilicity of materials, This book introduces numerical programming using Python and C/C++, the special structure of interfacial water for biological and electrochemical emphasizing methods used in physics and engineering. It helps readers develop processes, the role of water at biosurfaces (DNA, proteins, and membranes), the ability to navigate relevant algorithms, knowledge of coding design, and friction and adhesion, marine aerosols, ice formation, wetting-dewetting, and efficient scientific programming skills. It requires minimal background in filtration. mathematics, leading readers from elementary methods to complex algorithms useful in modern programming. It incorporates examples and real code Print ISBN: 978-1-4398-6104-2 throughout, as well as problem sets, to facilitate a hands-on learning experience. eBook ISBN: 978-1-4398-6105-9 Figure slides are available upon qualifying course adoption. April 2014, 6-1/8 x 9-1/4 Suggested Price: $139.95 / £89.00 Print ISBN: 978-1-4665-6967-6 eBook ISBN: 978-1-4665-6969-0 September 2014, 7 x 10, 674 pp., Soft Cover Suggested Price: $89.95 / £57.99 Textbook Metal-Organic Frameworks Advanced Linear Algebra Materials Modeling towards Nicholas Loehr Engineering Applications Virginia Polytechnic Institute and State University, Blacksburg, USA Edited by Series: Textbooks in Mathematics Jianwen Jiang National University of Singapore Designed for a second theoretical course in linear algebra, this text explores a variety of advanced topics in linear Metal-organic frameworks (MOFs) have emerged algebra that highlight the rich interconnections of the as a new family of nanoporous materials. With an subject to geometry, algebra, analysis, combinatorics, numerical computation, enormous choice of inorganic/organic building blocks, and many other areas of mathematics. The author covers algebraic structures, MOFs possess a wide range of surface area, pore size, and functionality and, matrices, structured matrices, geometric aspects of linear algebra, modules, and thus, have been considered versatile materials for many potential applications. multilinear algebra. He gives complete proofs of all results and supplements the This book presents a broad collection of recent modeling studies in the field of general theory with many specific examples and concrete computations. MOFs toward potential engineering applications, such as gas storage/separation, carbon capture, catalysis, water purification, and drug delivery. The subject of Print ISBN: 978-1-4665-5901-1 this book renders it unique, for while the various topics on MOFs boast vast eBook ISBN: 978-1-4665-5902-8 literature, there is not yet a single coherent collection for modeling endeavors. April 2014, 7 x 10, 632 pp. The book will appeal to scientists, engineers, and students in the multidisciplinary 16 Suggested Price: $99.95 / £63.99 intersections of materials science, chemistry, and engineering. Print ISBN: 978-981-4613-45-3 May 2015, 6 x 9, 550 pp. Suggested Price: $179.95 / £114.00

Computational Electromagnetics Parallel Science and Domain Decomposition Methods Engineering Applications and Practical Applications The Charm++ Approach Jin-Fa Lee Edited by Ohio State University, Columbus, USA Laxmikant V. Kale Zhen Peng University of Illinois, Urbana-Champaign, USA This book deals with the applied aspects of domain Abhinav Bhatele decomposition methods for computational Livermore, USA electromagnetics. It provides a valuable bridge between Series in Computational Physics rigorous mathematical treatments and practical software implementation of This book highlights the use of Charm++ in a wide variety of scientific and domain decomposition methods, including the finite domain decomposition engineering fields. It emphasizes the adaptivity, asynchrony, and message-driven method, domain decomposition for integral equation methods, and the execution of Charm++ and explains design choices in application development. multisolver domain decomposition method. The book shows how these methods With illustrative examples throughout, the text describes associated tools, can help solve multiscale time harmonic electromagnetic problems in areas parallelization strategies, and parallel performance. It discusses the various design such as large finite antenna arrays, metamaterials, antenna systems conformally considerations when writing a parallel application in Charm++ and presents the mounted on large platforms, complex integrated circuits and packaging, and application of these design principles to applications ranging from molecular more. dynamics, quantum chemistry, cosmological simulations to visualizations, and Print ISBN: 978-1-4665-1049-4 weather simulations August 2015, 6-1/8 x 9-1/4, 512 pp. Print ISBN: 978-1-4665-0412-7 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4665-0413-4 October 2013, 6-1/8 x 9-1/4, 314 pp. Suggested Price: $94.95 / £59.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4822-4759-6 broadly involvedinthisbook. viewpointsare breaking,chemistry phases, particularlywithchiralsymmetry isoftenrelevanttotheemergenceofnew restricted geometries.Aschemistry properties suchaselasticity, opticsand non-linearoptics,andbehaviorin formed by bent-coremolecules.A majority of this book is devoted to physical authors discussdifferentkinds of mesophase structures mesogens. Afterashorthistoricalintroduction,the in theresearch formedbybent-core onliquidcrystals This bookprovidesinsightintothelatestdevelopments Alexey Eremin Tokyo InstituteofTechnology, Japan Hideo Takezoe Edited by Bent-core LiquidCrystals Suggested Price: July 2015,6x9,350pp.,SoftCover Print ISBN:978-981-4613-57-6 textbook. are learningabout.Thesolutionstoexercises areprovidedattheendof structuresthey a waytoencouragestudentsexplorethedifferentcrystal and muchmore.Eachchapterisaccompaniedbyexercises designedinsuch space-group symmetry, compounds, structure of elements and binary the crystal the 14Bravaislatticesandreciprocaltothem,basicconceptsofpoint- introduction tothefieldofcrystallography. Itincludesanextensivediscussionon This book is intendedtobeacompleteandclear Universidad deLosAndes,Merida,Venezuela Teresa Szwacka University ofWarsaw, Poland Nevill GonzalezSzwacki Second Edition Basic ElementsofCrystallography Textbook Suggested Price: April 2014,6x9,523pp. eBook ISBN:978-1-4822-5776-2 Print ISBN:978-981-4267-32-8 With thesetools,transportpropertiesofvariousnanosystemsarethenexplored. (NEGF), masterequation,andtime-dependentwave-packetdiffusion(TD-WPD). methods based on scattering approaches, non-equilibrium Green’s function with ashortreviewofquantumtransport,followedbyvariouscalculation shows applicationsfortransportpropertiesofnanometer-scalesystems.It starts in detail.Thisbookprovidesvariousquantumtransportsimulationmethodsand quantum transport,butfewpresentcalculationmethods There aremanytextbooksonthebasicconceptsof University ofTsukuba, Ibaraki,Japan Nobuhiko Kobayashi NEC Corporation,Ibaraki,Japan Kenji Hirose for Nanosystems Quantum Transport Calculations Textbook $159.95 /£99.00 $79.95 /£49.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com Suggested Price: March 2015,6x9,300pp. Print ISBN:978-981-4463-60-7 help researchers todeveloptheinnovativedesignofnovelmaterials. withuniquewettability.realize thebioinspiredfunctionalsurfaces Thebookwill Italsooffersapproachesonhowtomimicthebiologicalfeatures interfaces. such aswatercollection/repellencyonbiologicalmicro-/nanostructuregradient and antifogging.Thisbookpresentsthemechanismofsmartwettingcontrol, fluidic devices,functionaltextiles,corrosionresistance,liquidtransportation, with uniquewettability, generating promisingapplications such asmicro- materials design and fabrication of functional interface provideendlessinspirationforthe Biological surfaces and Yuan Chen Zheng Yongmei, ChengQunfeng,HouYongping, Edited by Micro- andNanostructures Developments in Bio-inspired Wettability Surfaces Suggested Price: May 2015,6-1/8x9-1/4,600pp. Print ISBN:978-1-4665-7704-6 soft materials. book alsointroducesbiomaterialsas well asthinfilmsandtubesmadeoutof theoretical toolsrequiredtostudytheir structure,bonding,andproperties.The behave.Itenables thereadertounderstandexperimentaland crystals Membranes describeshowsoftmaterialslikeliquids, polymers,andliquid of softmaterials.ComplexLiquids,Polymersand purposes. Evenourbodiesaremostlycomposed adhesives, lubricants,sportsgoods,andmanyother They areusedforclothing,medicines,dyes,paints, Soft materialsplayanessentialroleinourdailylife. Saha InstituteofNuclearPhysics,Kolkata,India Alokmay Datta and Membranes Complex Liquids,Polymers Suggested Price: March 2015,6x9,250 pp. Print ISBN:978-981-4463-94-2 scientific community. of researchers andtoincrease theacceptabilityofbookamongwider and advancedinstrumentationtechniqueshavebeendiscussedforthebenefit provided foreaseofunderstandingthestudentcommunity. Sufficientdetails structures soimportantinmaterialsscienceandphysics.Essentialschematicsare description providedinthebookhelpsreadersunderstandwhyandhowthese other availablebooksofsimilarnaturethataremoregeneral.Thetheoretical nanostructures and, therefore,is different from the This bookfocusesonplasmaprocessingofbiomimetic National Yang MingUniversity, Taipei, Taiwan Surojit Chattopadhyay Edited by Fabrication andApplications by PlasmaProcessing Biomimetic Architectures $149.95 /£95.00 $99.95 /£63.99 $149.95 /£95.00

17 Computational Physics / Condensed Matter & Materials Science Computational Modeling of Concepts and Methods in Inorganic Nanomaterials Modern Theoretical Chemistry Edited by Two-Volume Set Stefan T. Bromley and Martijn Zwijnenburg Edited by Offering a detailed summary of available modeling Swapan Kumar Ghosh methods, both “top-down” and “bottom-up”, this Bhabha Atomic Research Centre, Theoretical Chemistry book offers systematic coverage of the use of modeling Section, Mumbai, India Condensed Matter & Materials Science in the development and application of inorganic Pratim Kumar Chattaraj nano-materials in industry including sensors, optics, Indian Institute of Technology, Kharagpur biotechnology, and solar cells. It provides readers with the necessary information Series: Atoms, Molecules, and Clusters to choose the right models and methods for describing particular physical and Offering chapters written by experts in their fields, this two-volume set covers chemical properties of inorganic materials at varying length scales. Sections the major areas of research in theoretical chemistry. The books enable readers include Structure and Dimensionality; Thermodynamics and Nucleation; to learn how concepts from ab initio quantum chemistry, density functional Magnetic, Optical, and Electronic and Transport Properties; and Case Studies. theory (DFT), and molecular simulation can be used to describe, understand, Print ISBN: 978-1-4665-7641-4 and predict electronic structure, chemical reactivity, and dynamics. The first book May 2015, 6-1/8 x 9-1/4, 352 pp. focuses on the electronic structure and reactivity of many-electron systems, and Suggested Price: $129.95 / £82.00 the second book deals with the statistical mechanical treatment of collections of such systems. Print ISBN: 978-1-4665-0623-7 eBook ISBN: 978-1-4822-6068-7 Concepts and Methods in February 2013, 6-1/8 x 9-1/4, 856 pp. Modern Theoretical Chemistry Suggested Price: $209.95 / £134.00 Electronic Structure and Reactivity Textbook Edited by Swapan Kumar Ghosh Condensed Matter Optical Bhabha Atomic Research Centre, Theoretical Chemistry Section, Mumbai, India Spectroscopy Pratim Kumar Chattaraj An Illustrated Introduction Indian Institute of Technology, Kharagpur Iulian Ionita Series: Atoms, Molecules, and Clusters University of Bucharest, Faculty of Physics, Romania

Offering chapters written by experts in their fields, this book focuses on the This text shows how optical absorption spectroscopy electronic structures and reactivities of atoms and molecules. It enables readers and Raman spectroscopy are powerful techniques for to learn how concepts from ab initio quantum chemistry and density functional studying condensed matter, particularly new properties that appear when many theory (DFT) can be used to describe, understand, and predict electronic atoms come together and interact in systems at the atomic, molecular, and nano structure and chemical reactivity. Paying particular attention to current trends in scales. With simple, illustrative examples throughout, the book emphasizes the the field, this book introduces modern electronic structure theory to the readers visual nature of the field. It helps students understand the spatial arrangements and describes various reactivity-related concepts like isomorphic local hardness, of atoms, which determine properties of the matter and resulting spectra. It also molecular electrostatic potentials, and spin vorticity. presents the application of molecular symmetry on optical spectra using group Print ISBN: 978-1-4665-0528-5 theory. Figure slides are available upon qualifying course adoption. 18 eBook ISBN: 978-1-4665-0531-5 Print ISBN: 978-1-4665-6956-0 February 2013, 6-1/8 x 9-1/4, 498 pp. eBook ISBN: 978-1-4665-6960-7 Suggested Price: $125.95 / £79.99 August 2014, 7 x 10, 414 pp., Pack - Book and Ebook Suggested Price: $79.95 / £49.99

Concepts and Methods in Detonation Nanodiamonds Modern Theoretical Chemistry Science and Applications Statistical Mechanics Edited by Edited by Alexander Vul’ Ioffe Physico-Technical Institute, St. Petersburg, Russia Swapan Kumar Ghosh Bhabha Atomic Research Centre, Theoretical Chemistry Olga Shenderova Section, Mumbai, India International Technology Center, Raleigh, North Carolina, USA Pratim Kumar Chattaraj A comprehensive overview of detonation nanodiamond Indian Institute of Technology, Kharagpur particles produced by detonation of carbon-containing Series: Atoms, Molecules, and Clusters explosives, this book discusses the technology of synthesis and the effect Offering chapters written by experts in their fields, this book focuses on the of various technological parameters on the structure and physicochemical statistical treatment of assemblies of atoms and molecules, including computer properties of nanodiamonds. It explores the possibilities of targeted chemical simulation methods (both ab initio and classical molecular dynamics) as well as modification of the surface, describes methods of structural modification of various aspects of chemical dynamics. Itenables readers to learn how concepts nanodiamonds aimed at obtaining nanographite, analyzes the various methods from ab initio quantum chemistry and density functional theory (DFT) can be employed in studies of nanodiamonds as a carbon nanostructure, and suggests used to describe, understand, and predict chemical dynamics. Paying particular and explores at length the potential of nanodiamond application in technology attention to current trends in the field, this book covers both theory and and medicine. applications. Print ISBN: 978-981-4411-27-1 Print ISBN: 978-1-4665-0620-6 eBook ISBN: 978-981-4411-28-8 eBook ISBN: 978-1-4665-0621-3 February 2014, 6 x 9, 346 pp. February 2013, 6-1/8 x 9-1/4, 350 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $125.95 / £79.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,6x 9, 400pp. February Print ISBN:978-981-4613-47-7 post-doctoral fellows,researchers, andindustrialengineers. junctions. Thisbookistargetedatawideaudience,includinggraduatestudents, equilibrium states,scatteringanddissipation,coherenttransportingraphene phenomena, quantum dots,non- transport inthegatedgraphene,interface graphene’s unique properties. It covers themechanisms of electric andthermal book focusesonthepracticalapplicationsenabledby the basisfornewnanoelectronicapplications.This researchimportant growthareaincontemporary and remarkable physical properties have made it an Graphene is the first two-dimensional material. Its Northwestern University, Evanston,Illinois,USA Serhii Shafraniuk Fundamentals, DevicesandApplications Graphene Suggested Price: August 2014,6x9,180pp. eBook ISBN:978-981-4463-33-1 Print ISBN:978-981-4463-32-4 and nanostructureeffect. topics, such as thermoelectric power, superconductivity, solid oxide fuel cells, electron correlationsystemstage.Italsoprovidesup-to-dateinformationon with thebasicsofcondensedmatterphysicsandadvancestowardstrong valence andspinstateofcobaltions.Thebookstarts properties partiallyoriginatingfromarichvarietyofthe as functionalmaterialsduetotheirpeculiarphysical This bookexploreswhycobaltoxideshavedrawninterest Osaka University, Japan Tsuyoshi Takami Edited by Fundamentals, PropertiesandApplications Functional CobaltOxides Suggested Price: December 2014,6-1/8x9-1/4,274pp. Print ISBN:978-1-4665-9394-7 perspective. chemical behaviors,andpotentialapplications,endingwithafarsighted generation, extraction,isolation,structuralissues,theories,intrinsicproperties, book presentsthemostadvancedreviewonallaspectsofEMFs,including obtained. Thisareaisnowreadyforasystematicandup-to-datesummary. This during thelast10-15yearsandnumeroushigh-impactresultshavebeen materials. Research onEMFshasflourisheddramatically occupy animportantpositioninthefamilyofnanocarbon of newlyemergedmetal-carbonhybridmoleculesand Endohedral metallofullerenes(EMFs)standasanoveltype Shigeru Nagase,andTakeshi Akasaka Xing Lu,LuisEchegoyen,AlanL.Balch, Edited by Basics andApplications Endohedral Metallofullerenes $99.95 /£63.99 $129.95 /£82.00 $129.95 /£82.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

in Semiconductors Light-Induced Defects Suggested Price: April 2015,7x10,416pp. Print ISBN:978-1-4665-0996-2 and then discussthestrengthslimitationsofvariousapproaches. covered. Chaptersprovideabroad-baseddescriptionoftheoverallquestion packing, granulargases,multiphaseflows,andfluid/particleinteractions,are basic conceptsandstate-of-the-artresearch areas,suchasshearflow, jamming, given thematicconsistencythroughtheuseofinterpretiveframeworks.Both as energy, agriculture,pharmaceuticals,andengineering.Thecontentsare of thefieldgranularmaterials,whichisimportantforapplicationsasdiverse computational approaches,andexperimentalfindings This bookaddressesthefundamentaltheory, Levich InstituteandPhysicsDept,NewYork, USA Mark Shattuck Rochester InstituteofTechnology, NewYork, USA Scott Franklin Edited by Granular Materials Handbook of Suggested Price: March 2015,6-1/8x9-1/4,450pp. Print ISBN:978-1-4398-3834-1 emerging displaytechnologies,andpolymerlithography. andpolymersin theuseofliquidcrystals that enhancedisplayperformance, principles underlyingthemajorapplications,displaycomponents,components displays. Thetextcoversthestructureandphysicalpropertyrelationships,basic andpolymersusedin different typesofliquidcrystals presents thechemistry, physics,andelectro-opticsof in flatpaneldisplaysandactiveopticdevices.Thisbook an exciting fieldof research withpracticalapplications andpolymershasbecome The subjectofliquidcrystals BookSeries Liquid Crystals Chain-Shu HsuandLiang-ChyChien in DisplayApplications andPolymers Liquid Crystals Suggested Price: September 2014,6x9,212pp. eBook ISBN:978-981-4411-49-3 Print ISBN:978-981-4411-48-6 book areimportantissuesfromtheviewpointsofphysicsandapplications. including its mechanism and experimental results. The subjects treated by the creation in hydrogenatedamorphous silicon (a-Si:H) is described in more detail, discusses experimentalevidenceforthisphenomenon.Light-induceddefect semiconductors,particularlyGaAsandrelatedmaterials.Italso in crystalline provides atheoreticaltreatmentofrecombination-enhanceddefectreaction semiconductors.It amorphous, andmicrocrystalline processes, andrelatedphenomenaincrystalline, of light-induceddefects,defectcreation This bookcoverselectronicandstructuralproperties and ChisatoOgihara Kazuo Morigaki,HarumiHikita, Edited by $149.95 /£95.00 $159.95 /£99.00 $149.95 /£95.00

19 Condensed Matter & Materials Science The Materials Physics Needleless Electrospinning Companion of Nanofibers 2nd Edition Technology and Applications A.C. Fischer-Cripps Xungai Wang and Tong Lin Fischer-Cripps Laboratories Pty Ltd, Sydney, Australia Deakin University, Geelong, Australia

Updated and expanded with new topics, this second The book covers the basic electrospinning theory,

Condensed Matter & Materials Science edition puts the physics of the solid state within the reach electrospinning technologies that have potential for of students by offering an easy-to-navigate pathway from large scale production of nanofibers, and the functional basic knowledge through to advanced concepts. Using the unique signature applications of electrospun nanofibers in different fields. An important needleless style of the author’s other companion books, this edition illustrates how electrical electrospinning technique using a rotary fiber generator such as ball, cylinder, and magnetic properties of matter arise from the basic principles of quantum disc and wire coil, and the effects of the fiber generator, its shape and dimension, mechanics in a way that is accessible to science and engineering students. as well as operating parameters on electrospinning performance, fiber morphology and productivity are described. A method to calculate the electric Print ISBN: 978-1-4665-1782-0 field and analyze electric field profiles in an electrospinning zone is provided. The eBook ISBN: 978-1-4665-1783-7 influence of the fiber collector on fiber quality is also discussed. August 2014, 6 x 9, 238 pp., Soft Cover Suggested Price: $39.95 / £25.99 Print ISBN: 978-981-4316-35-4 eBook ISBN: 978-981-4316-84-2 November 2013, 6 x 9, 204 pp. Suggested Price: $149.95 / £95.00

Nanotechnology in Advanced Electrochemical Power Sources Oxide Nanostructures Edited by Growth, Microstructures, and Properties S. R. S. Prabaharan Edited by Manipal International University, Selangor Darul Ehsan, Malaysia Avanish Kumar Srivastava M. Siluvai Michael CSIR - National Physical Laboratory, New Delhi, India Chemical sciences Research Centre, Chennai, India Metal oxides have been one of the well documented This book reflects a state-of-the-art understanding of and hottest branches of nanomaterials revolution with electrochemical power sources employing positive and oxides such as TiO2, ZnO, CuO, Fe3O4, Cr2O3, Co3O4, negative electrode materials at nanoscale, including Lithium-ion batteries, MnO2 and many more being an integral part to a variety microbatteries, and electrochemical supercapacitors. Featuring contributions of technological advancements and industrial applications. From green power based on the recent research outcomes of leading experts in the field, the text issues like photovoltaic cells to rechargeable batteries, from drug delivery agents focuses on the fundamental apects of energy storage device performance, to antimicrobial and cosmetic products, from superconductor materials to with a special emphasis on nanoscale advantages. The editors include current semiconductors and insulators, metal oxides have been omnipresent in terms processing techniques as well as the synthesis, characterization, physical and of both commercial prerogatives and research highlights. This book is solely electrochemical properties, and applications of nanoscale materials related to devoted towards this special section of nanomaterials with an aim to partially advanced electrochemical power sources. access the science pertaining to the oxides of metals. Print ISBN: 978-981-4241-43-4 Print ISBN: 978-981-4411-35-6 October 2014, 6 x 9, 380 pp. 20 eBook ISBN: 978-981-4411-36-3 Suggested Price: $149.95 / £95.00 April 2014, 6 x 9, 424 pp. Suggested Price: $149.95 / £95.00

Nanotubes and Nanosheets Phase Transitions in Solids Functionalization and Applications of Under High Pressure Boron Nitride and Other Nanomaterials V.D. Blank Director of the Technological Institute for Superhard Edited by and Novel Carbon Materials, Troitsk, Moscow, Russia Ying (Ian) Chen E.I. Estrin Nanotubes and nanosheets are low-dimensional G.V. Kurdyumov Institute for Metal Physics, I.P. Bardin Central Scientific Research Institute for Ferrous Metallurgy, Moscow, nanomaterials with unique properties that can be exploited Russia for numerous applications. This book offers a complete overview of their structure, properties, development, modeling approaches, and High-pressure research has become increasingly important, practical use. It focuses attention on boron nitride (BN) nanotubes, which have and high-pressure techniques are an invaluable tool for synthesizing new had major interest given their special high-temperature properties, as well as materials and discovering novel physical phenomena that are not accessible graphene nanosheets, BN nanosheets, and metal oxide nanosheets. Key topics at ambient pressure. This text deals with the problem of phase transitions in include surface functionalization of nanotubes for composite applications, solids at high pressure. It covers phase equilibria at high pressures in various wetting property changes for biocompatible environments, and graphene for materials, the deformation impact on phase transformations at high pressures, energy storage applications. high-temperature and low-temperature transformation kinetics and hysteresis at high pressures, and the requirements for obtaining and maintaining high- Print ISBN: 978-1-4665-9809-6 pressure phases. February 2015, 7 x 10, 632 pp. Suggested Price: $159.95 / £99.00 Print ISBN: 978-1-4665-9424-1 eBook ISBN: 978-1-4665-9425-8 October 2013, 6-1/8 x 9-1/4, 450 pp. Suggested Price: $167.95 / £107.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,7x 10, 528pp. February Print ISBN:978-1-4398-0275-5 explained bytheappearanceofanew constantofmotion. emergent topologicalorderandshowthatallsuperpropertiesofthesystem are of realistic systems. The authors present superfluidity asa phenomenon of principles behindthesuperfluidphenomenonasaframeworkfordiscussion and heliumsupersolids.Thetextbeginsbyexplainingthegeneralphysical superconductors, ultra-coldatomicbosonsandfermions, covers new superfluidmaterials such ashigh-temperature complete andup-to-datetreatmentofsuperfluidity. It and potentialapplications,thisbookrepresentsthemost the expanded number of available experimentalsystems Discussing changesoverthelasttwodecades,including and NikolayV. Prokof’ev Boris V. Svistunov, EgorS.Babaev, Superfluid StatesofMatter Suggested Price: July 2013,6x9,398pp. eBook ISBN:978-981-4364-86-7 Print ISBN:978-981-4364-85-0 nanomaterials, publicacceptance,andriskcommunicationmanagement. as wellsocietalandeconomiccontexts, such asmedicalapplications of responses andtoxicology. Thebookalsoaddressesoccupationalsafetymeasures from production,transport,anddistributionintheenvironmenttobiological on healthandtheenvironment.Itcoverswholenanomateriallifecycle— the safetyofengineerednanomaterialsandtheirimpact of nanomaterials,thisbookgivesanup-to-datereviewon government expertsinvolvedwiththesafetyassessment With contributions from leading researchers and VDI Technologiezentrum Germany GmbH,Düsseldorf, Wolfgang LutherandAxelZweck Edited by Engineered Nanomaterials Safety Aspectsof Suggested Price: 2013,6x9,230pp. January eBook ISBN:978-981-4364-61-4 Print ISBN:978-981-4316-00-2 dot-based probes. and energytransfermechanismscanbeusedtogeneratearangeofquantum their electrochemicalpropertiesandpotentialtoxicity, andexplainshowelectron for thepreparationandpassivationofcore/core-shellquantumdots,discusses electromagnetic spectrum. The book details the range of methods currently used and CdTe-type quantumdotsduetotheiremissioninthevisibleregionof in the early 1980s. It focuses on CdS-,CdSe-, sensors since their discovery quantum dotsasthesignalingcomponentinoptical This volumechartstheprogressmadeinuseof University ofMiami,CoralGables,Florida,USA Françisco M.Raymo The RobertGordonUniversity, Aberdeen,UK John Callan Edited by Technology andCommercial Applications Quantum DotSensors $99.95 /£63.99 $149.95 /£95.00 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com Characterization, andApplications Fundamental Properties,Synthesis, Two-Dimensional Carbon Suggested Price: November 2014,6x9,300pp. Print ISBN:978-981-4463-52-2 recent research. at thenanoscale.Exercises withsolutionscanbeusedascontroltestsandreflect conducting polymersaswellrecentadvancesinthermoelectricphenomena materials. It also considers novel materials based on organic semiconductors and ofdifferent played by the electronic structurein the thermoelectricperformance and structuralcomplexity. Itthendescribestherole introducing variousbulkmaterialsofincreasingchemical basic conceptsandfundamentalquestionsbefore This up-to-dateanddetailedintroductionfirstpresents Universidad ComplutensedeMadrid,Spain Enrique Maciá Edited by Advances andApplications Thermoelectric Materials Suggested Price: 2015,6-1/8 x9-1/4,424pp. February Print ISBN:978-1-4822-2983-7 photovoltaic technologies. the importanceofharnessingreliable alternativesolarenergyusingefficient Lastly, thebookexploressolarcelldevice physics andcharacterization,conveying organic/inorganic hybridsolarcellsas well assingle-andmulti-junctiondevices. describes novelsolarcellmaterialsanddevices,includingorganic,inorganic, and current economicandecologicconcernsoverdifferentenergysources. Itthen background ofsolarenergyutilizationdevicesandsystems,considering the devices, andsystems.Dividedintothreesections,thetextfirstprovidesanoverall This bookdiscussescutting-edgephotovoltaicmaterials, Series: Devices,Circuits, andSystems,38 South DakotaStateUniversity, Brookings,USA Qiquan Qiao Edited by and Modeling Materials, Devices,Interfaces, Organic SolarCells Suggested Price: April 2014,6x9,346pp. eBook ISBN:978-981-4411-95-0 Print ISBN:978-981-4411-94-3 supercapacitor, andfuelcells. lithiumionbattery extensive coverageforapplicationsof2Dcarboninenergystorageincluding to characterizationof2DnanocarbonusingRamanspectroscopy. Itprovides of vertically aligned carbon nanosheets or nanowalls. One chapter is dedicated SiC, chemicalsynthesisofgrapheneonmetal,andvapordeposition Three majorsynthesistechniquesarecovered:epitaxialgrowthofgrapheneon from single/few layer graphene to carbon nanowalls and graphene oxides. and applicationofvarioustypestwo-dimensional(2D)nanocarbonsranging graphene, thisbookfocusesonsynthesis,characterization After abriefintroductiontothefundamentalpropertiesof Pan StanfordSeriesonCarbon-BasedNanomaterials Wu Yihong, ShenZexiang,andYu Ting Edited by $179.95 /£114.00 $159.95 /£99.00 $149.95 /£95.00

21 Electronic Materials & Devices Energy & Environmental Physics / General & Introductory Physics Energy & Environmental Physics / General Introductory Nanomaterials in Energy and Textbook Environmental Applications Analytical Mechanics Edited by Solutions to Problems in Classical Physics Junhui He Ioan Merches Chinese Academy of Sciences, Beijing Al.I.Cuza University, Iasi, Romania Nanoscience and nanotechnology are interdisciplinary Daniel Radu fields that bring together physicists, chemists, materials The principles and methods of analytical mechanics are scientists, and engineers to meet the potential future very efficient for investigating not only mechanics but also challenges that humankind will face, including the search in areas such as field theory, plasma physics, and quantum mechanics. This text for renewable energies for sustainable development and new technologies presents a short theoretical description of these subjects, followed by solved for carbon capture and environmental protection. To summarize the past problems. The authors thoroughly discuss solutions to the problems by taking a developments and encourage future efforts, this book presents contributions comprehensive approach to explore the methods of investigation. They carefully from world-renowned specialists in the fields of nanomaterials, energy, and perform the calculations step by step, graphically displaying some solutions via environmental science. It discusses the design and fabrication of nanostructured Mathematica® 4.0. Figure slides are available upon qualifying course adoption. materials and their energy and environmental applications. Print ISBN: 978-1-4822-3939-3 Print ISBN: 978-981-4463-78-2 eBook ISBN: 978-1-4822-3941-6 October 2014, 6 x 9, 350 pp. August 2014, 6-1/8 x 9-1/4, 456 pp. Suggested Price: $179.95 / £114.00 Suggested Price: $59.95 / £38.99

Organic Solar Cells Fundamentals, Devices, and Upscaling Black Holes, Wormholes, Edited by and Time Machines Barry P. Rand Princeton University, New Jersey, USA Second Edition Henning Richter Jim Al-Khalili Nano-C, Inc, Westwood, Massachusetts, USA University of Surrey, UK

This book explores the required characteristics of the While retaining the popular format and style of its components present in an organic photovoltaic device, bestselling predecessor, this second edition explores the such as transparent electrodes, electron- and hole-conducting layers, and electron latest developments in high-energy astroparticle physics donor and electron acceptor materials. It discusses the design, preparation, and Big Bang cosmology. It continues to make the ideas and theories of modern and evaluation of these materials targeting the highest performance. Taking physics easily understood by anyone. Complex concepts, such as quantum into account the necessity to optimize many interdependent parameters, the mechanics, are explained simply without the use of scientific jargon. The book text describes the integration of various components using existing as well as takes readers on a journey through space and time, covering space warps, time innovative device architectures suitable for mass production. Finally, it assesses travel, parallel universes, and other fascinating topics in physics. the technical feasibility and economic viability of the large-scale manufacture of Print ISBN: 978-1-4398-8559-8 materials and resulting devices. eBook ISBN: 978-1-4398-8560-4 Print ISBN: 978-981-4463-65-2 December 2011, 6-1/8 x 9-1/4, 206 pp., Soft Cover 22 eBook ISBN: 978-981-4463-66-9 Suggested Price: $43.95 / £27.99 August 2014, 6 x 9, 810 pp. Suggested Price: $249.95 / £159.00

A Unified Grand Tour Textbook of Theoretical Physics Classical Mechanics Third Edition Second Edition Ian D. Lawrie Tai L. Chow University of Leeds, UK California State University, Stanislaus, Turlock, USA

The third edition of this best-selling text continues to Emphasizing a modern perspective, this book presents a provide an accessible overview of the fundamental ideas complete account of the classical mechanics of particles underpinning our understanding of theoretical physics. and systems for physics students at the advanced The basic structure of each theory is explained in explicit mathematical detail undergraduate level. This edition has been updated with with emphasis on conceptual understanding rather than on the technical details two new sections and three new chapters as well as four new appendices. The of specialized applications. Suitable for undergraduate and graduate courses, this text assumes readers have been exposed to courses in calculus and calculus-based new edition includes updates and advancements in string theory and quantum general physics, while no prior knowledge of differential equations is required. gravity. A supplementary website provides ancillary material and side issues to Each chapter contains homework problems of varying degrees of difficulty to create a platform for further research and classroom discussion. enhance understanding of the material in the text. A solutions manual is available upon qualifying course adoption. Print ISBN: 978-1-4398-8446-1 eBook ISBN: 978-1-4398-8447-8 Print ISBN: 978-1-4665-6998-0 November 2012, 6-1/8 x 9-1/4, 711 pp., Soft Cover eBook ISBN: 978-1-4665-7004-7 Suggested Price: $87.95 / £55.99 May 2013, 7 x 10, 639 pp. Suggested Price: $104.95 / £66.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,7x10,420pp. Print ISBN:978-1-4822-0635-7 manual andfigureslidesareavailableuponqualifyingcourseadoption. teaches thoughalargenumberofexamplesandreallifeapplications.Asolutions the principlesitincludesfundamentalsandsomemoreadvancedtopics and the author’s institution.Ensuring asolidappreciationof course in E&M based on the lecture course offered at physics majorsandprovidingacompleteintroductory magnetism isaimedatintermediateundergraduate This lecturenotestyletextbookonelectricityand Ave MariaUniversity, Florida,USA P.F. Kelly Electricity andMagnetism Textbook Suggested Price: October 2014,6x9,220pp. Print ISBN:978-981-4463-69-0 to unleashforces againstthe useofprobabilityasabasisforthelawsnature. takes adifferentviewandshowsthatEinsteincreated“Trojan horse”ready mechanics areoftenportrayedasoutdated.Thisbook the lawsofnatureandparticularlyinquantum However, Einstein’s opposition to the use of probability in and extensionsoftheancientspace-timeconcept. andthecorrespondingcorrections his relativitytheory Most modernbooksonEinsteinemphasizethegeniusof University ofIllinois,Urbana,USA Karl Hess Einstein Was Right! Suggested Price: 2014,6-1/8x9-1/4,256pp.,SoftCover February eBook ISBN:978-1-4665-6018-5 Print ISBN:978-1-4665-6017-8 fundamental particles,andrelativity. modern physics,coveringquantummechanics,atomicandnuclear mechanics, electromagnetism,optics,andthermodynamics.Italsofocuseson of physics that predate the twentieth century, including twenty-first century. Thebookhighlightsthecoreareas to theageofNewtonnewideasjustformulatedin scope ofsubjects,fromclassicalphysicsthatgoesback Suitable forawideaudience,thisbookcoversbroad University ofPugetSound,Tacoma, Washington, USA Andrew Rex in Physics Commonly AskedQuestions $79.95 /£49.99 $34.95 /£22.99 $29.95 /£18.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Textbook Suggested Price: September 2014,6x9,326pp.,SoftCover eBook ISBN:978-1-4665-5267-8 Print ISBN:978-1-4665-5266-1 experimentsrequiringconventionalcomponentsandtestequipment. laboratory power supplies. The book includes tutorial problems and a comprehensive set of operational amplifiers,digitalelectronics,transformers,instrumentation,and circuits involvingdiodesandtransistors,transistorsamplifiers,filtering, electrical principles(DCandACcircuits), thephysicsofelectronicscomponents, This conciseyetdetailedbookcoversintroductory using auniqueandeducationalpresentationtechnique. electronics edition presentsafullcourseinintroductory Updated andexpandedwithnewtopics,thissecond Fischer-Cripps LaboratoriesPtyLtd,Sydney, Australia A.C. Fischer-Cripps and Engineers,2ndEdition Devices andCircuits forPhysicists The ElectronicsCompanion Suggested Price: December 2013,7x10,472pp. eBook ISBN:978-1-4665-7525-7 Print ISBN:978-1-4665-7521-9 course adoption. and chemistry. Asolutions manualandfigureslidesareavailableuponqualifying as necessary, withanemphasis onapplicationsinfieldsincludingsomebiology physical principles.Eachtopicincludesworkedexamples.Mathisintroduced text focusesonprovidingasolidunderstandingoffundamentalphysics and a yearlongcourseandisnotneededfornon-physicsmajors.Instead, this It omits material often found inmuch larger texts that cannot be covered in understanding ofthefundamentalsessentialphysics. physics fornon-physicsmajorsandprovidesathorough This book is designed for an algebra-based course in Indiana UniversityofPennsylvania,USA Ajawad Haija Emeritus Professor, IndianaUniversityofPennsylvania,USA John Matolyak Essential Physics Textbook Suggested Price: May 2014,7x10,444pp. eBook ISBN:978-1-4822-0658-6 Print ISBN:978-1-4822-0654-8 manual andfigureslidesareavailableuponqualifyingcourseadoption. problems andwillbeaccompaniedbyadetailedsolutionmanual.Asolutions number ofexamplesandreallifeapplications.Thebookincludesarange the fundamentalsandsomemoreadvancedtopicsteachesthoughalarge appreciation oftheprinciplesmechanics,itincludes course offeredattheauthor’s institution.Ensuringasolid courseinmechanicsbasedonthelecture introductory undergraduate physics majors and providing a complete This lecture note style textbook on mechanics is aimedat Ave MariaUniversity, Florida,USA P.F. Kelly Elements ofMechanics $39.95 /£25.99 $104.95 /£66.99 $79.95 /£49.99

23 General & Introductory Physics Textbook Textbook Essentials of Modern Physics Measured Tones Jagdish Rai The Interplay of Physics and Music, Indian Institute of Technology Roorkee, Uttarakhand Third Edition Kanhaiya Lal Yadav Ian Johnston This book deals with the theoretical aspects of the University of Sydney, New South Wales, Australia subject matter, leading to important results. It further Ian Johnston offers an informal historical approach that describes the experiments to observe the important shows the evolution of both theory and application at results obtained. It cites examples from nature, the the intersection of physics and music. Exceptionally accessible, insightful, and General & Introductory Physics General & Introductory laboratory, and day-to-day life. Each chapter contains some solved examples now updated to consider modern technology, the new edition of this critically and problems at the end. After completing the book and solving the problems, acclaimed bestseller features a greater examination of psycho-acoustics and students will gain sufficient knowledge of modern physics, preparing them for its role in the design of MP3s. It also includes expanded information on the higher-level courses in science and technology. A solutions manual and figure gamelan and other Asian percussion instruments, and discusses binary notation, slides are available upon qualifying course adoption. digitization, and electronic manipulation of music. A complementary website Print ISBN: 978-1-4665-7093-1 provides sound files, further reading, and instructional support. April 2015, 6-1/8 x 9-1/4, 300 pp. Print ISBN: 978-1-4200-9347-6 Suggested Price: $89.95 / £57.99 eBook ISBN: 978-1-4398-8957-2 June 2009, 6-1/8 x 9-1/4, 454 pp. Suggested Price: $74.95 / £47.99

Fischer-Cripps Student Methods of Experimental Physics Companion Set (5 Volumes) M. I. Pergament A.C. Fischer-Cripps State Research Center of Russian Federation “Troitsk Institute Fischer-Cripps Laboratories Pty Ltd, Sydney, Australia for Innovation & Fusion Research” (TRINITI), Moscow, Russia Graduate Student Series in Physics Taking the same signature approach, these books use clear writing and a visual presentation to make Based on the modern approach of information theory, this the material suitable for students in any country, book presents novel experimental techniques, tools, and including those with English as a second language. data processing methods for physics applications. It shows The author has now extended the coverage of The readers how to plan and conduct experiments, design and Physics Companion, The Electronics Companion, The Mathematics Companion, and certify measuring equipment, and process and interpret The Materials Physics Companion and updated them where necessary, building on the experimental data. Bringing together approaches that have previously been the outstanding success of the first editions. Along with these volumes, the set scattered in the literature, the book covers high-speed photography, Fourier contains The Chemistry Companion. optics, spectroscopy, interferometry, holography, electromagnetic waves, X-rays, and corpuscular investigation. Print ISBN: 978-1-4987-0967-5 September 2014, 5-1/2 x 8-1/2, Soft Cover Print ISBN: 978-0-7503-0608-9 Suggested Price: $159.95 / £99.00 October 2014, 6-1/8 x 9-1/4, 362 pp. 24 Suggested Price: $129.95 / £82.00

General Relativity The New Cosmic Onion Basics and Beyond Quarks and the Nature of the Universe Ghanashyam Date Frank Close The Institute of Mathematical Sciences, Chennai, India University of Oxford, UK

This work familiarizes students and beginning researchers Not since Newton’s apple has there been a physics with both basic and advanced aspects of the theory of phenomenon as deliciously appealing to the masses general relativity. It includes essential ideas and just enough as Frank Close’s Cosmic Onion. Widely embraced by background material needed for readers to appreciate the scientists and laypersons alike, the book quickly became issues and current research. The first five chapters form the an international bestseller, has been translated into seven core of an introductory course on general relativity. The remainder of the book languages, and propelled the author to become a recognized popular science covers causal and deterministic space-times, black holes, gravitational waves, celebrity around the world. Much has changed since the original publication cosmological space-times, numerical relativity, an emergent gravity viewpoint, in 1983, and The New Cosmic Onion was extensively revised and updated to quantum theory of gravity, and other research-level topics. reflect our new view of the universe. Keeping the best contents from the previous work, this new edition includes extensive new material explaining the scientific Print ISBN: 978-1-4665-5271-5 challenges at the start of this century. November 2014, 6-1/8 x 9-1/4, 263 pp. Suggested Price: $79.95 / £49.99 Print ISBN: 978-1-58488-798-0 eBook ISBN: 978-1-58488-799-7 December 2006, 6-1/8 x 9-1/4, 232 pp., Soft Cover Suggested Price: $49.95 / £31.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2015,8x9,300pp.,Pack-BookandEbook Print ISBN:978-1-4398-6783-9 upon qualifyingcourseadoption. ultimate fateoftheUniverse.Asolutions manualandfigureslidesareavailable energy, andangularmomentumaswelldarkmatter, darkenergy, andthe astronomy, laws ofmomentum, andengineering.Theydiscusstheconservation extensive experienceteachingthesubjecttostudentsinphysics,chemistry, by stepfromsimpletomorecomplexmathematics.Theauthorsdrawontheir covers thecorephysicsconcepts,progressingstep modern applicationsinastrophysicsandbeyond.It mechanics, thiseasy-to-followtextpresentsreal, A livelyandengagingintroductiontoclassical Joseph C.AmatoandEnriqueJ.Galvez An IntroductiontoClassicalMechanics Physics fromPlanetEarth Textbook Suggested Price: August 2014,6x9,568pp.,SoftCover eBook ISBN:978-1-4665-1780-6 Print ISBN:978-1-4665-1779-0 companion books. in a one-page-per-topic format that is the signature style of the author’s clear explanationsofdifficultconcepts,andannotatedmathematicaltreatments quantum physics,andnuclearphysics.Itprovidesdetailedgraphics,simple to includeseniortopics,suchasstatisticalmechanics, students. Thisneweditionexpandsthepresentation learning physicsatalevelsuitableforfirst-yearscience edition offersauniqueandeducationalapproachto Updated andexpandedwithnewtopics,thissecond Fischer-Cripps LaboratoriesPtyLtd,Sydney, Australia A.C. Fischer-Cripps Second Edition The PhysicsCompanion Suggested Price: 2013,6-1/8x9-1/4,295pp.,SoftCover January eBook ISBN:978-1-4665-6610-1 Print ISBN:978-1-4665-6608-8 available uponqualifyingcourseadoption. propagation throughtheionosphere.Asolutionsmanualandfigureslidesare complete coverageofadvancedtopicsinwaves,suchaselectromagneticwave elastic solids;electroniccircuits; andelectromagneticwaves.Healsoprovides optical, andquantummechanicalsystems;continuousgases,fluids, mathematics, theauthorincludesmanyexamplesfromdiscretemechanical, a soundphysicalunderstandingofwavephenomena.Emphasizingphysicsover and waves in physical systems. It helps students acquire ofoscillations develops aunifiedmathematicaltheory upper-division physicscourses,thisclassroom-testedtext courseswith Bridging lower-divisionphysicssurvey The UniversityofTexas, Austin,USA Richard Fitzpatrick An Introduction Oscillations andWaves Textbook $89.95 /£49.99 $39.95 /£25.99 $71.95 /£39.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Properties ofMaterials Textbook Suggested Price: June 2015,6-1/8x9-1/4,352pp.,SoftCover Print ISBN:978-1-4665-7635-3 inyourcar.on golfballs,3Dmovies,refrigerators,andthebattery minimal scientificjargon.Forexample,readerslearnthephysicsbehinddimples This bookalsogivesinsightintophysicsthrough classical physicstoquantummechanicsandrelativity. the bookexploresahistoricalprogression,from daily lives.Filledwithintriguingandunusualexamples, interesting physicsconceptsthathavemeaninginour In aneasilyaccessiblestyle,thisbookpresentsthemost John Kimball and Novelties Physics Curiosities,Oddities, Suggested Price: May 2013,6-1/8x9-1/4,453pp.,Soft Cover eBook ISBN:978-1-4398-9674-7 Print ISBN:978-1-4398-9673-0 infamous cat—isattheheartofitall. to runthealgorithm.Schrödinger’s notionofquantumentanglement—and his communications oftheentireInternet ifaquantumcomputercouldbebuilt to Shor’s quantumfactoring algorithm,whichwouldunveiltheencrypted codesusedtosecuretheInternet.The “killerapp”refers public-key encryption computer capableofsolvingcomplexmathematicalproblemsandhacking the inside lookatthegovernment’s questtobuildaquantum quantum informationscience,thisbookpresentsan involved intheU.S.government’s developmentof Written byarenownedquantumphysicistclosely Louisiana StateUniversity, BatonRouge,USA Jonathan P. Dowling Quantum Computer Race toBuildtheWorld’s First Schrödinger’s KillerApp Suggested Price: November 2014,7x10,427pp. Print ISBN:978-1-4822-0622-7 course adoption. constituents. Asolutionsmanualandfigureslidesareavailableuponqualifying author emphasizesthemodelingofcompositesystemsassembledfromsimple thermodynamics. Throughouttheinvestigationsofparticularphenomena, review. Itfocusesonelasticity, fluids,oscillation,waves,acoustics,optics,and text,supplement,orexam can beusedasaprimary of matter. With morethan300problems, thebook qualitatively andquantitativelymodelspecificfeatures applies theprinciplesofclassicalmechanicsto This secondvolumeintheauthor’s three-partseries Ave MariaUniversity, Florida,USA P.F. Kelly $34.95 /£22.99 $41.95 /£26.99 $79.95 /£49.99

25 General & Introductory Physics Textbook Ground-Based Microwave Superstrings and Other Things Radiometry and Remote Sensing A Guide to Physics Methods and Applications Carlos I. Calle Pranab Kumar Karmakar Kennedy Space Center, Florida, USA University of Calcutta, West Bengal, India General & Introductory Physics / Geophysics General & Introductory Superstrings and Other Things: A Guide to Physics takes Ground-based radiometers are currently operated in readers on a fascinating journey through physics. Written research labs around the globe and are also used as routine in an accessible style, this comprehensive guide explains the measurement tools for water vapor and temperature basic concepts of motion, energy, and gravity, through to profiling. This reference provides a comprehensive picture of ground-based the latest theories about the structure of matter, the origin of the universe, and radiometry, starting with the basic principles. It provides information on ground- the beginning of time. Fully illustrated throughout, we learn about the major based instrumentation, retrieval techniques, and temperature structure. It also discoveries and the scientists behind them; from Galileo and Newton, Einstein covers temperature profiling and water vapor radiometry. In addition, it provides and Bohr, to Feynman and Hawking. Numerous examples of physics in everyday retrieval algorithms using MATLAB®, worked examples of derived products, and situations are provided and explained in an easy to understand way. Its coverage polar atmosphere cases. is appealing to the general reader and is essential for those in fields other than Print ISBN: 978-1-4665-1631-1 physics. A solutions manual is available upon qualifying course adoption. eBook ISBN: 978-1-4665-1632-8 Print ISBN: 978-0-7503-0707-9 November 2013, 6-1/8 x 9-1/4, 214 pp. October 2001, 6-1/8 x 9-1/4, 647 pp., Soft Cover Suggested Price: $157.95 / £99.00 Suggested Price: $37.95 / £23.99

Radiophysical and Geomagnetic Effects of Rocket Burn and The Mathematics Companion Launch in the Near-the-Earth Mathematical Methods for Physicists Environment and Engineers, 2nd Edition Leonid F. Chernogor A.C. Fischer-Cripps Kharkiv V.N. Karazin National University, Ukraine Fischer-Cripps Laboratories Pty Ltd, Sydney, Australia Nathan Blaunstein Updated and expanded with new topics, this second Ben-Gurion University of the Negev, Beer Sheva, Israel edition presents the essential core of mathematical This book analyzes experimental and theoretical studies on the effects of rocket principles needed by scientists and engineers. It uses a burns and launchings on the near-Earth environment and geomagnetic fields unique and educational approach that is the signature from 1,000 to 10,000 kilometers. It examines the disturbances of plasma and style of the author’s companion books. Starting from the basic concepts of the ambient magnetic and electric fields in the near-Earth environment caused trigonometry, the book covers calculus, differential equations, and vector calculus. by rocket burns and launchings from Russia, the United States, China, France, A new chapter on applications discusses how we see objects “mathematically” and other worldwide space centers. Measurements were carried out using with the eye, how quantum mechanics works, and more. Figure slides are numerous radiophysical methods, including HF Doppler radar, incoherent and available upon qualifying course adoption. coherent scatter radar systems, microwave radar, magnetometer, and optical Print ISBN: 978-1-4665-1587-1 instrumentation and spectroscopy. eBook ISBN: 978-1-4665-1588-8 26 Print ISBN: 978-1-4665-5113-8 August 2014, 6 x 9, 302 pp., Soft Cover eBook ISBN: 978-1-4665-5114-5 Suggested Price: $39.95 / £25.99 November 2013, 6 x 9, 568 pp. Suggested Price: $157.95 / £99.00

Waves and Oscillations Remote Sensing Image Fusion in Nature Luciano Alparone, Bruno Aiazzi, Stefano Baronti, and Andrea Garzelli An Introduction A Satya Narayanan and Swapan K Saha A synthesis of more than ten years of research by the authors, this book presents image fusion methods of This book explores the physics behind the waves and remote sensing imagery. It provides a comprehensive oscillations encountered in nature. The book, which is classification and rigorous mathematical description written from a theoretical point of view, begins with a of advanced and state-of-the-art methods for pan- brief description of a wave. This is followed by basic sharpening of multispectral images and fusion equations, conservation laws, the concept of phase velocity, group velocity, of hyperspectral and panchromatic images. It details fusion of data from and dispersion relation. The book also discusses waves in different areas such heterogeneous sensors such as optical and synthetic aperture radar (SAR) as optics, electromagnetism, hydrodynamics, magnetohydrodynamics, shock images and integration of thermal and visible/near-infrared images. It also waves, and plasma physics. The book also provides a brief description of different addresses fusion methods exploiting new trends of signal/image processing, instabilities. This book is aimed at graduate students and researchers working in like sparse signal representations, compressive sensing, and convex/nonconvex various areas including fluid dynamics, plasma physics, optics, geophysics, solar optimization. physics, and space physics. Print ISBN: 978-1-4665-8749-6 Print ISBN: 978-1-4665-9093-9 February 2015, 6-1/8 x 9-1/4, 312 pp. April 2015, 6-1/8 x 9-1/4, 400 pp. Suggested Price: $139.95 / £89.00 Suggested Price: $99.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6x9,400pp. Print ISBN:978-981-4613-00-2 in thefieldofplasmonicnanomaterials. book putstogethercontributionsfrom outstandinginternationalresearch groups and flexible materials, and exploitationof renewablesolar energy.crystalline The as therealizationofgain-assistedmeans, utilizationofNPsembeddedinliquid concept thatindicatesthoseapplicationsinwhichNPsplayan“active”role,such framework, aparticularinterestisdevotedto“activeplasmonics,”quitebroad in manyresearch fields,suchasphotonics,optics,andplasmonics.Inthis resonance.” Thisbookreviewsrecenteffortsdevotedtotheutilizationof NPs exploiting aphenomenoncalled“localizedplasmon capability tolocalizelightatthenanoscaleby outstanding classofnanomaterialsthathavethe Plasmonic nanoparticles(NPs)representan University ofCalabria,Arcavacata diRende,Italy Luciano DeSio Edited by Nanomaterials Active Plasmonic Suggested Price: November 2013,6-1/8x9-1/4,306pp. eBook ISBN:978-1-4665-5360-6 Print ISBN:978-1-4665-5359-0 conventional signalprocessingtechniques. uses examplestoexplainthedifferencesbetweenwaveletmethodandother earth sciences.Itfocusesonthecontinuouswavelettransformtechniqueand fractals, multifractals,andwaveletsthataddresschallengingproblemsinthe techniques incurrentearthsystemscienceresearch. Itcoversapplicationsof book highlightstheroleofadvanceddataprocessing to theuseofthesetechniquesingeosciences.This the earthsciences,thereareonlyafewbooksdevoted increased inscientificandtechnologicalfields,including Although theapplicationsofwaveletsandfractalshave E. Chandrasekhar, V. P. Dimri,andV. M.Gadre Edited by in EarthSystemSciences Wavelets andFractals Suggested Price: June 2015,6x9,200pp. Print ISBN:978-1-4822-4525-7 analysis, goingmoretowardatime-frequencyanalysis. although unusual,itis included toillustratethe contrast totraditionalspectral of stochasticconstraints in inverse theory. Italsobrieflyoutlineswaveletanalysis, which are important for many estimation problems that are based on some kind sphere. Itincludesapplicationstostochasticprocessesontheplaneandsphere, spatial -frequency analysis for data on the plane and deal withglobalandregionalspatialdata.Itemphasizes geosciences, specificallygeodesyandgeophysicsthat analysis usingFourier-basedtechniquesinthe This bookprovidesarigoroustreatmentofspectral Ohio StateUniversity, Columbus,USA Christopher Jekeli Geodesy andGeophysics Spectral Methodsin $149.95 /£95.00 $104.95 /£65.99 $119.95 /£76.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Tissue OpticalSectioning Advanced Biophotonics Suggested Price: April 2013,7x10,388pp. eBook ISBN:978-1-4398-5019-0 Print ISBN:978-1-4398-5018-3 applications inthisrapidlyexpandingfield. systems usedinadaptiveoptics.Italsocoversopticsaswellnewer a backgroundinoptics,thebookdescribesfundamentals,components,and caused bylightpropagationinbiologicalsamples.Accessibletoreaderswithout imaging. Itemphasizestheuseofadaptiveopticstocorrectwavefrontaberrations emerging applicationsofadaptiveopticsinbiological of thecoreprinciples,state-of-the-artmethods,and comprehensive referencepresentsacompleteoverview Written byinternationalleadersinthefield,this University ofCalifornia-SantaCruz,USA Joel A.Kubby Edited by for BiologicalImaging Adaptive Optics Suggested Price: March 2015,7x10,896pp. Print ISBN:978-1-4822-2652-2 upon qualifyingcourseadoption. effectiveness inhigh/ultra-highcapacity networks.Asolutionsmanualisavailable focuses onenhancementstodigital technologies thatareleadingtogreater Featuring theoretical foundations as well as practical case studies, the text optical transmissionsystems,aswell newhomeworkproblemsandexamples. systems andnetworks,Nyquistpulse shapingandhighspectralefficiencyof superchannel opticaltransmissionsystems,metropolitanandlong-haul mathematical analysis, the communication technologies.Emphasizingoperationprinciplesversus of digital communication applications in optical This bookprovidesafundamentalunderstanding Series: OpticsandPhotonics Munich, Germany European Research Center, HuaweiTechnologies, Le NguyenBinh Second Edition Communications Advanced DigitalOptical Suggested Price: July 2013,7x10,733pp. eBook ISBN:978-1-4398-9582-5 Print ISBN:978-1-4398-9581-8 underlying biophotonicsscience. and medicaldoctorsunderstandmajorrecentbioimagingtechnologiesthe biophysical, andbiomedicaljournals,thebookhelpsresearchers, bioengineers, Gathering research scatteredinnumerousphysical,chemical, otherwise methodsandapplicationsofbiophotonicsimaging. presents contemporary developed inrecentyears.Addressingthisshortfall,AdvancedBiophotonics book thatdescribesstate-of-the-artbiophotonicsimagingapproachesintensively medical diagnosticsandtherapy, thefieldstilllacksacomprehensiveimaging Despite anumberofbooksonbiophotonicsimagingfor Series inOpticsandOptoelectronics Saratov StateUniversity, Russia Valery V. Tuchin University ofWashington, Seattle,USA Ruikang K.Wang Edited by $104.95 /£65.99 $149.95 /£95.00 $209.95 /£134.00

includes new coverage of Second Edition includes new coverageof

27 Geophysics / Lasers, Optics, & Optoelectronics Textbook Causal Physics Bioinspired Photonic Systems Photons by Non-Interactions of Waves Optical Structures and Chandrasekhar Roychoudhuri Systems Inspired by Nature University of Connecticut, Storrs, USA Viktoria Greanya This work explains how the non interaction of waves DARPA, Arlington, Virginia, USA principle applies to both classical and quantum optics. Focusing on waves in the linear domain, it explores A fascinating, rapidly emerging field, bioinspired ambiguous, contradictory, and paradoxical concepts photonics incorporates aspects of nanoscience, optics, that exist in spite of apparently correct mathematical Lasers, Optics, & Optoelectronics structural color, and biomimicry. This book showcases a myriad examples, formulations. The author reformulates classical and quantum optics mathematics from the intense coloration and iridescence in certain plants and insects, to by clearly defining the methodology used for gathering information from these adaptable coloration in animals and vision systems in insects. It begins with measurements. The book provides the tools to properly validate a model of these a broadly accessible introduction to the brilliant array of optical systems seen measurements, offering a more coherent and simpler understanding of classical in nature, and ways that scientists use those systems as inspiration for novel and quantum optics. photonic materials and devices. Its coverage includes characterization of active and passive biophotonic systems in ultraviolet, visible, and infrared wavelengths, Print ISBN: 978-1-4665-1531-4 as well as nanofabrication and modeling approaches. Figure slides are available eBook ISBN: 978-1-4665-1532-1 upon qualifying course adoption. May 2014, 6-1/8 x 9-1/4, 296 pp. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4665-0402-8 June 2015, 7 x 10, 250 pp., Soft Cover Suggested Price: $69.95 / £44.99

Textbook Charged Particle Optics Theory Bionanophotonics An Introduction An Introductory Textbook Timothy R. Groves Shuichi Kinoshita SUNY Polytechnic Institute, State University of New York, USA Osaka University, Japan Series: Optical Sciences and Applications of Light

Structural colors in living beings are one of the most This book provides an introduction to theoretical optics of marvelous arts that nature has ever created during the charged particle beams. It identifies the most important long history of the evolution. These colors originate from ideas of charged particle optics and derives them surprisingly sophisticated microstructures which gave rise mathematically from the first principles of physics for the to a new field of research—bionanophotonics. This book occupies a special non-expert comfortable with calculus. It conveys an intuitive understanding of position among similar books in the field of photonics, because it places a the basics and follows a logical step-by-step approach. After the introduction special emphasis on the detailed physical basis for the optical processes that describing a number of practical systems, the book moves into geometrical are deeply connected with the structural colors, and also on the biological and optics, wave optics, diffraction and interference, two body scattering problems, physiological bases concerning what a variety of animals are living and how they and electron emission. A solutions manual and figure slides are available upon are seen by human vision. In addition, it contains ample examples for the recent qualifying course adoption. technological advances in photonics that are rooted in the nature. A solutions manual is available upon qualifying course adoption. Print ISBN: 978-1-4822-2994-3 December 2014, 6-1/8 x 9-1/4, 369 pp. 28 Print ISBN: 978-981-4364-71-3 Suggested Price: $139.95 / £89.00 eBook ISBN: 978-981-4364-72-0 July 2013, 6 x 9, 400 pp. Suggested Price: $149.95 / £95.00

Building Earth Observation Computational Nanophotonics Cameras Modeling and Applications George Joseph Edited by Observing the earth from the vantage point of space Sarhan M. Musa Prairie View A&M University, Houston, Texas, USA has emerged as an important means to plan our natural resources in a sustainable manner. This book helps readers This reference offers tools for engineers, scientists, understand the tradeoffs in selecting various sensor biologists, and others working with the computational parameters for electro-optical sensors and how each techniques of nanophotonics. It introduces the key hardware is optimally selected. It provides a detailed concepts of computational methods in a manner that account of the activities to be taken to make a camera system space-worthy and is easily digestible for newcomers to the field. The book also examines future various review, test and evaluation plans. The book incldues ‘case studies’ based applications of nanophotonics in the technical industry and covers new on the IRS sensors and will be a good companion for a system designer. developments and interdisciplinary research in engineering, science, and Print ISBN: 978-1-4665-6647-7 medicine. It provides an overview of the key computational nanophotonics and January 2015, 6-1/8 x 9-1/4, 376 pp. describes the technologies with an emphasis on how they work and their key Suggested Price: $169.95 / £108.00 benefits. Print ISBN: 978-1-4665-5876-2 eBook ISBN: 978-1-4665-5878-6 July 2013, 7 x 10, 541 pp. Suggested Price: $177.95 / £113.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2013,6-1/8x9-1/4,507pp. eBook ISBN:978-1-4665-0671-8 Print ISBN:978-1-4665-0670-1 as noisemodels,analysis,andtransmission systemperformance. and basicalgorithmstocompensateforimpairmentscarrierrecovery, aswell carried by light waves. In addition, the book covers digital processing techniques descriptions ofmodulationtechniquesforsuchdigitaltransmissionsystems optical communicationsinthemostbasiclines.Thebookincludessimplified for opticaltransmissionandaspectsofmoderndigital This bookdescribesmoderncoherentreceivingtechniques Series: OpticsandPhotonics Munich, Germany European Research Center, HuaweiTechnologies, Le NguyenBinh Receiving Techniques Optical Transmission andCoherent Digital Processing Suggested Price: June 2014,6-1/8x9-1/4,704pp. eBook ISBN:978-1-4665-9070-0 Print ISBN:978-1-4665-9069-4 given inthebook. readers canreproducethecalculationsandcomparetheirownresultswiththose laser light.Itoffersavarietyofnumericalexampleswithdetailedparametersso manipulation basedonlaservortexbeams,andtightsubwavelengthfocusingof It alsotreatsissuesofopticaltrapping,micro-andnano- simulation of light diffraction by nanophotonics devices. well asawidevarietyofadvancedmethodsfortherigorous cutting-edge problems in the fieldof nanophotonics as objects withnanoscalefeatures.Thisbookaddresses Nanophotonics dealswiththediffractionoflightfrom Victor ASoifer Edited by Diffractive Nanophotonics Suggested Price: December 2013,6-1/8x9-1/4,402pp. eBook ISBN:978-1-4665-8362-7 Print ISBN:978-1-4665-8361-0 asavaluablereferenceforbothacademiaandindustry.serves text deliversapracticalintroductiontotheuseofFDTDinnanotechnologyand supportive appendices,andFDTDcodesaccessibleviaacompanionwebsite,the research fromworld-renownedexperts.Completewithcasestudies,examples, FDTD method,andpredictsfutureapplicationsbyexamininginterdisciplinary the newestandmostpopularcomputationalnanotechnologiesusing the computationalFiniteDifferenceTime Domain(FDTD)method,discusses professionals, thisbookdescribesthekeyconceptsof Easily digestibleforbeginnersandusefultoseasoned Prairie View A&MUniversity, Houston,Texas, USA Sarhan M.Musa Edited by Time Domain Using FiniteDifference Computational Nanotechnology $157.95 /£99.00 $149.95 /£95.00 $188.95 /£120.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

of ImageSensors Essential Principles Suggested Price: June 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4665-8495-2 parameters. select lasermanufacturingprocessestoanalyzetheandoptimal ultrashort pulsedlasers.Itdevelopsfirstordermathematicaldescriptionsfor and bending.Thebookthendetailslasermicromachiningprocessesusing alloying,cladding,texturing such ascutting,welding,hardening,lasersurface efficiency. Itpresentsthefundamentalsoflasermaterialsprocessingtechniques, wavelength, beamquality, portabilityandwallplug their comparativeanalysisbasedonoutputpower, different kindofindustrial/research lasersavailableand book coversthebasicprinciplesoflasers,including graduate studentsandpracticingengineersalike,this Written asareferenceforseniorundergraduates, Ramesh K.SinghandAtulSrivastava of Lasers Engineering Applications Suggested Price: July 2014,7x10,570pp. eBook ISBN:978-1-4398-6168-4 Print ISBN:978-1-4398-6167-7 imaging microscopy, andsingle-multi-photon excitation. of methods,including single channel (point) spectroscopy, fluorescence lifetime instrumentation, analytical methods, and applications. It covers the wide range The bookoffersacomprehensivetreatmentoffundamentalprinciples, measurements, enablingcharacterizationofintacttissueanddiseasediagnostics. of maximize contrastbetweendifferentfluorophoresforimprovedspecificity range ofbiologicalandclinicalapplications.Fluorescencelifetimeapproaches resolved fluorescence techniquesandtheir rolein awide This bookreflectstheremarkableadvancesintime- Laura Marcu, PaulM.W. French,andDanielS.Elson Edited by in BiomedicalDiagnostics Principles andApplications Spectroscopy andImaging Fluorescence Lifetime Suggested Price: August 2014,7x10,192pp. eBook ISBN:978-1-4822-2006-3 Print ISBN:978-1-4822-2005-6 decline ofimageinformationquality. andexplorescausesforthe and CMOSsensors.Italsodescribessamplingtheory details theoperationalprinciples,pixeltechnology, andevolutionofCCD,MOS, image sensorsconvertopticalinformationintosignals,aswell and time.Insightfullyillustrated,thetextexplainshow and itsfourfactors:space,lightintensity, wavelength, image sensortechnology, discussingimageinformation the systemization,noisesources, andsignalprocessesof This must-havebookprovidesasuccinctintroductionto Consultant, Osaka,Japan Takao Kuroda $119.95 /£76.99 $179.95 /£114.00 $129.95 /£82.00

29 Lasers, Optics, & Optoelectronics Fundamentals of Handbook of Enhanced Solid-State Lighting Spectroscopy LEDs, OLEDs, and Their Applications Edited by in Illumination and Displays Marc Lamy de la Chapelle, Pietro Giuseppe Gucciardi, and Nathalie Lidgi-Guigui Vinod Kumar Khanna CSIR-CEERI, Pilani, India Techniques such as Raman, Infra-Red, fluorescence and even non-linear spectroscopies have recently grown This book presents an up-to-date, comprehensive survey in resolution and possibilities thanks to the use of of the principles, technology, and applications of solid-

Lasers, Optics, & Optoelectronics nanostructured surfaces. This book provides a detailed state devices for lighting and displays. Compared to traditional electrical filaments, overview of enhanced spectroscopies. It introduces plasmon and electromagnetic arc lamps, and fluorescent lamps, solid-state lighting offers higher efficiency, effects arising in metallic nanostructures, then reviews the above spectroscopies reliability, and environmentally friendly technology. The book covers a range of enhanced either by the presence of a nanostructure or a tip. The book covers solid-state devices, technologies, and materials used for lighting and displays. It the theory underpinning each technique followed by the description of the also examines auxiliary but critical requirements of efficient applications, such as experimental procedures and some applications. modeling, thermal management, reliability, and smart lighting. Print ISBN: 978-981-4613-32-3 Print ISBN: 978-1-4665-6109-0 May 2015, 6 x 9, 500 pp. eBook ISBN: 978-1-4665-6112-0 Suggested Price: $179.95 / £114.00 June 2014, 7 x 10, 604 pp., Soft Cover Suggested Price: $149.95 / £95.00

Guided Wave Optics and Handbook of Molecular Photonic Devices Plasmonics Edited by Edited by Shyamal Bhadra Fabio Della Sala and Stefania D’Agostino CSRI - CentralGlass and Ceramic Research Institute, Kolkata, India National Nanotechnology Laboratory, Lecce, Italy

Ajoy Ghatak While several reviews and books on surface nanophotonics Indian Institute of Technology Delhi (IIT Delhi), New Delhi, India and fluorescence spectroscopy are available, an updated Series: Optics and Photonics focus on molecular plasmonics, including both theoretical This compilation introduces readers to a broad cross- methods and experimental aspects, is still lacking. This section of topics, from the basics of guided wave optics and nonlinear optics to handbook is a comprehensive overview on the physics of the plasmon–emitter biophotonics. Written by leading experts in optics and photonics, it combines interaction, ranging from electromagnetism to quantum mechanics, from metal- fundamental principles and recent advances in one volume, including coverage enhanced fluorescence to surface-enhanced Raman scattering, from optical of soliton dynamics, supercontinuum generation, fiber-Bragg-grating writing microscopy to synthesis of metal nanoparticles, filling the gap in the literature of techniques, plasmonics, nonlinearity in stratified media, and more. The book this merging field. It allows experimentalists to have a solid theoretical reference offers a valuable overview of the field for students and researchers alike and at a different level of accuracy, and theoreticians to find new stimuli for novel identifies directions for future research in guided wave and photonic device computational methods and emerging applications. technology. Print ISBN: 978-981-4303-20-0 Print ISBN: 978-1-4665-0613-8 eBook ISBN: 978-981-4303-21-7 30 eBook ISBN: 978-1-4665-0614-5 August 2013, 6 x 9, 498 pp. May 2013, 6-1/8 x 9-1/4, 564 pp. Suggested Price: $179.95 / £114.00 Suggested Price: $145.95 / £93.00

Handbook of 3D Machine Vision Handbook of Optical Optical Metrology and Imaging Dimensional Metrology Edited by Edited by Song Zhang Kevin Harding Iowa State University, Ames, USA GE Global Research, Niskayuna, New York, USA Series in Optics and Optoelectronics Series in Optics and Optoelectronics

Choosing from the numerous 3D vision methods Requiring no prior expertise in optical dimensional available can be frustrating for scientists and engineers, metrology, this handbook helps readers understand the especially without a comprehensive resource to consult. capabilities and limitations of optical metrology methods. Filling this gap, this handbook gives an in-depth look at the most popular It shows them how to successfully apply optical metrology to a vast array of 3D imaging techniques. Written by key players in the field and inventors of current engineering and scientific problems. After building a foundation for important imaging technologies, it helps you understand the core of 3D imaging evaluating optical measurement methods, the book focuses on each application technology and choose the proper 3D imaging technique for your needs. For area of measurement, working down from large area to medium-sized to each technique, the book provides its mathematical foundations, summarizes its submicron measurements. Best practices and practical examples aid readers in successful applications, and discusses its limitations. effectively using the methods. Print ISBN: 978-1-4398-7219-2 Print ISBN: 978-1-4398-5481-5 eBook ISBN: 978-1-4398-7220-8 eBook ISBN: 978-1-4398-5482-2 March 2013, 6-1/8 x 9-1/4, 414 pp. February 2013, 7 x 10, 506 pp. Suggested Price: $167.95 / £107.00 Suggested Price: $167.95 / £107.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,7x10,718pp. Print ISBN:978-1-4398-6685-6 for thefuture,suchasmetamaterialsand entangledquantumstatesoflight. and microstructured optical fibers to fiber Bragg grating. It also identifies trends plasmonic waves.Itcoversopticalfibersensing, from lightguidinginstandard sensor technologiesbasedonintensityandphasemodulation,fluorescence, and a brief history. It explores the role of optical waveguides in sensing and discusses sensors andtheprinciplesofopticalmetrology, presenting optical sensors.Itexplains the basicaspectsofoptical This book provides a comprehensive, integrated view of University ofNorthCarolinaatCharlotte,USA Faramarz Farahi University ofPorto,Portugal Jose LuisSantos Edited by Handbook ofOpticalSensors Suggested Price: September 2014,6x9,526pp. eBook ISBN:978-981-4463-25-6 Print ISBN:978-981-4463-24-9 GaAs. on prominent III-V material systems including Al, In, and Ga nitrides, ZnO, and discuss opticalcavitiesthatresonatefromUVtoIRwavelengthsandarebased whispering gallery, photonicbandgap,andplasmonicmodes.Thechapters that supportcavityresonanceviavariousmechanismssuchasFabry-Pérot, micrometer andnanometerscalestructuresdevices design, simulation,fabrication,andcharacterizationof resonance inopticalcavities.Thetopicsincludetheory, The bookcoversawiderangeoftopicspertainingto University ofHongKong Anthony H.W. Choi Edited by Optical Microcavities Handbook of Suggested Price: April 2015,7x10,744pp. Print ISBN:978-1-4665-7359-8 and carindustries,opticalmethodsofmechatronics. endoscopes andbore-scopes,measurementinspectioninthesemiconductor with opticalandvideoprobes,CT(computedtomography),industrial fiber sensorsandapplications,microscopy, coordinate-measuringmachines roughnessandmicro-profiles,high-speedphotography,200 pages—onsurface coming researchers, theSecondEditionofferstennewchapters—morethan practical applications.Featuringcontributionsfromveteranandup-and- handbook discussesfundamentalprinciplesandtechniquesbeforeexploring to optical metrologywithout sacrificing academicrigor, this comprehensive Designed toprovidebeginnerswithanintroduction NPO 3DAssociates,Yokohama, Japan Toru Yoshizawa Edited by Second Edition Principles andApplications, Optical Metrology Handbook of $179.95 /£114.00 $249.95 /£159.00 $169.95 /£108.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: April 2013,7x10,851pp. eBook ISBN:978-1-4398-3611-8 Print ISBN:978-1-4398-3610-1 various photonics-relatedindustries. contained chapters are written by international experts from academia and integration, and the convergence with CMOS technology. The book’s self- and applications,emphasizingpassiveactivephotonicdevices,fabrication, both specialistsandnewcomers,thebookcoversabroadspectrumofmaterials Suitablefor innovative technologicalapplicationsarepushingthefieldforward. and rapidlychangingareaofsiliconphotonics.Itshowshowbasicscience handbook providesanup-to-datereferencetothebroad With manyillustrations,includingsomeincolor, this Series inOpticsandOptoelectronics University ofTrento, PovodiTrento, Italy Lorenzo Pavesi CNRS, UniversitéParis-Sud,Orsay, France Laurent Vivien Edited by Handbook ofSiliconPhotonics Suggested Price: December 2014,6-1/8x9-1/4,600 pp. Print ISBN:978-1-4822-5012-1 available towesternscientists. by highlyregardedscientists,andmuchofthecontenthasnotbeenpreviously scale commercial problemssuchasisotopeselection.Thematerialispresented purely fundamentalscientificresearch problemstopracticalapplicationinlarge- existing lasertypes.Thishasresultedinnumerousapplicationsrangingfrom inthevisiblespectral rangeamongall lasers areconsideredthemostpowerful on self-containedtransitionsinmetalatoms.Highbrightnessvapour This work presents the physics and applications of high-power laser radiation A. M.Boichenko,I.Klimovskii,andE.Molodykh V.M. I.Kazaryan, M.Batenin, V. V. Buchanov, Physics andApplications High BrightnessMetalVapor Lasers Suggested Price: December 2014,6-1/8x9-1/4,600pp. Print ISBN:978-1-4822-5004-6 physics andthetechniqueofhigh-brightnessmetalvaporlasers. on self-containedtransitionsinmetalatoms.Itisthefirstfundamentalreview and mathematicalmodelsforpracticalrealizationofahigh-powerlaserradiation full seriesoffundamentalproblemsonthedevelopmentphysicalfundamentals large-scale commercial problems suchasisotopeselection.Thisbookpresentsa applications rangingfrompurelyfundamentalresearch topracticalapplicationin in thevisiblespectralrangeamongallexistinglasertypes,resultingnumerous High brightnessmetalvaporlasershavebecomethemostbrightandpowerful I. Klimovskii,andE.Molodykh V.M. I.Kazaryan, M.Batenin,V. V. Buchanov, A.M.Boichenko, Physical FundamentalsandMathematicalModels High BrightnessMetalVapor Lasers $177.95 /£113.00 $179.95 /£114.00 $179.95 /£114.00

31 Lasers, Optics, & Optoelectronics High-Speed Photonics Laser and Photonic Systems Interconnects Design and Integration Edited by Edited by Lukas Chrostowski Shimon Y. Nof, Andrew M. Weiner, University of British Columbia, Vancouver, Canada and Gary J. Cheng Krzysztof Iniewski Industrial and Systems Engineering Series CMOS Emerging Technologies Research, Inc., Vancouver, British Columbia, Canada Laser and photonic technologies and solutions influenced Series: Devices, Circuits, and Systems many aspects of everyday life. With new and significant

Lasers, Optics, & Optoelectronics recent scientific discoveries in their fields, systems This comprehensive book assembles the latest research in the field of photonics perspectives and integrated design approaches can improve even further the interconnects technology and exposes readers to the myriad applications that impact in critical areas of challenge. Yet this knowledge is dispersed across several this technology has enabled. Experts from academia and industry delve into a disciplines and research arenas. This book brings together a multidisciplinary wide range of topics—from the historical evolution of high-speed I/O circuits group of experts in many of these areas to foster increased understanding of the to recent trends—and examine the underlying technology of photonics ways in which systems perspectives may influence laser and photonic innovations interconnects. The book details how these optical interchip communication links and application integration. have the potential to fully leverage increased data rates provided through CMOS technology scaling at suitable power-efficiency levels. Print ISBN: 978-1-4665-6950-8 eBook ISBN: 978-1-4665-6952-2 Print ISBN: 978-1-4665-1603-8 May 2014, 6-1/8 x 9-1/4, 427 pp. eBook ISBN: 978-1-4665-1604-5 Suggested Price: $139.95 / £89.00 April 2013, 6-1/8 x 9-1/4, 223 pp. Suggested Price: $157.95 / £99.00 Laser Beam Propagation Information Photonics Generation and Propagation of Customized Light Fundamentals, Technologies, Edited by and Applications Andrew Forbes Asit Kumar Datta CSIR National Laser Centre, Pretoria, South Africa University of Calcutta, Kolkata, India This book provides a comprehensive account of laser Soumika Munshi beam propagation, reflecting the major impact of new Jadavpur University, Kolkata, India characterization methods, computational approaches, This book gives the reader a comprehensive idea and fabrication techniques. It highlights new discoveries on laser beams and about how photons work in an information era for their propagation properties, including orbital angular momentum of light, the communication and computation in day-to-day and strategic applications. It non-diffracting nature of light, and light that propagates along curved paths introduces post-graduate students, researchers, engineers, and scientists, to and reconstructs after obstacles. Chapters by expert researchers demonstrate photonic information processing technologies as applied in various fields. It gets how laser beams propagate, explain the generation of custom laser beams with into the insight of the concepts of photonic information processing as a system, modern techniques, describe beam properties, and showcase their application the photonic devices required, and applications in the fields of communication, across various disciplines. computation, and intelligent pattern recognition. Print ISBN: 978-1-4665-5439-9 32 Print ISBN: 978-1-4822-3641-5 eBook ISBN: 978-1-4665-5440-5 April 2015, 6-1/8 x 9-1/4, 550 pp. February 2014, 6-1/8 x 9-1/4, 364 pp. Suggested Price: $139.95 / £89.00 Suggested Price: $129.95 / £82.00

Introduction to Imaging Laser Beam Propagation in from Scattered Fields Nonlinear Optical Media Michael A Fiddy Shekhar Guha and Leonel P. Gonzalez University of North Carolina at Charlotte Air Force Research Laboratory, R. Shane Ritter Wright-Patterson Air Force Base, Ohio, USA Perigon Engineering, Charlotte, North Carolina, USA This book provides a collection of expressions, equations, This self-contained book provides the necessary details formulas, and derivations used in calculating laser beam for readers to design improved experiments and process propagation through linear and nonlinear media which measured data more effectively. It shows how to obtain are useful for predicting experimental results. The authors the best estimate of a strongly scattering object from limited scattered field data. address light propagation in anisotropic media, oscillation directions of the The book covers widely used and novel approaches to recover information about electric field and displacement vectors, the walk-off angles between the Poynting diverse objects from their scattered field data, including Fourier-based signal and and propagation vectors, and effective values of the d coefficient for biaxial, ® image processing techniques and the authors’ inverse algorithm approach. The uniaxial, and isotropic crystals. The book also includes MATLAB and FORTRAN provided MATLAB® code helps readers understand the imaging process in a computer programs for numerical evaluations. hands-on way. Print ISBN: 978-1-4398-6638-2 Print ISBN: 978-1-4665-6958-4 eBook ISBN: 978-1-4398-6639-9 November 2014, 7 x 10, 246 pp. December 2013, 6-1/8 x 9-1/4, 334 pp. Suggested Price: $89.95 / £57.99 Suggested Price: $132.95 / £85.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2014,6-1/8 x9-1/4,435pp. February eBook ISBN:978-1-4665-8138-8 Print ISBN:978-1-4665-8137-1 design toreviewsoflaseraccidents. laser use,fromvibrationcontrol,powermeterselection&pitfallsin lab over thelastseveralyears,thissecondeditionexplainsmanyfactorsaffecting hazards ofanylaserprocedure.Reflectingtheexponentialusetechnology presents simple,effectivewaysforuserstoevaluatethe applications, buttherearemanyinherentrisks.Thisbook manyuniquefunctionsinaplethoraof Lasers perform Series: OpticalScienceandEngineering Lawrence BerkeleyNationalLab,California,USA Ken Barat Edited by Tools andTraining, SecondEdition Laser Safety Suggested Price: April 2014,6-1/8x9-1/4,274pp. eBook ISBN:978-1-4665-8251-4 Print ISBN:978-1-4665-8250-7 applied immediately, andnumerically, toreallasersystems. iscoveredinanaccessiblewaythatcanbe linear optics,andmore.Lasertheory address gainsaturation,thermaleffectsonsolid-statelasers,Q-switching,non- alongside apractical,solvedexamplebasedoncommercial laser. Chapters in tandem to make concepts easier to digest. Each technique is introduced algebraic modelsandtraditionalcalculus-basedmethods downloadable spreadsheets,thisnoveltextpresents way ofunderstandingtheconcepts.Completewith Don’t letthemathematical rigorofsolutionsgetinthe Niagara College,Welland, Ontario,Canada Mark StevenCsele with AlgebraandCalculus A NumericalApproach Laser Modeling Suggested Price: June 2014,6-1/8x9-1/4,581pp. eBook ISBN:978-1-4665-6101-4 Print ISBN:978-1-4665-6100-7 software. wavelength dependence,channelintegrators,geometricaloptics,andoptical gratings, vortexbeams,andmicrolensdiffusers.Italsocontainsnewmaterialon new chaptersonaxiconringgenerationsystems,laser-beam-splitting(fan-out) technology andlaserbeamshapingusingdiffractivediffusers,includes is appropriate,describesthelatestadvancesinbeamprofilemeasurement when beam shaping is practicaland when each technique provides experimentalresultsaswellguidanceon important techniqueforlosslessbeamshaping.It andpracticeofevery This bookaddressesthetheory FMD ConsultingLLC.,Springfield,Missouri,USA Fred M.Dickey Edited by andTechniques,Theory SecondEdition Laser BeamShaping $129.95 /£82.00 $129.95 /£82.00 $189.95 /£121.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

of Explosives Laser-Based OpticalDetection Suggested Price: April 2013,7x10,764pp. eBook ISBN:978-1-4398-4153-2 Print ISBN:978-1-4398-4151-8 forunderstandingtheexperimentalapplications. framework necessary time- andfrequency-domainapplicationsoflasers,developsthetheoretical techniques, offers a detailed account of the most recent results obtained for provides allthebackgroundinformationonmainkindsoflasersources and frequency combsynthesizersbasedonfemtosecondmode-lockedlasers.It of the areas revolutionized by optical gives a wide-ranging, balanced overview applications, and futuretrends in optical,atomic, and molecular physics. It last 25years,thisself-containedbookpresentsbasicconcepts,state-of-the-art Based ontheauthors’experimentalworkover Series inOpticsandOptoelectronics and PaoloDeNatale Pasquale Maddaloni,Marco Bellini, A Handbook Applications Time andFrequencyDomain Laser-Based Measurementsfor Suggested Price: November 2014,7x10,551pp. Print ISBN:978-1-4398-7216-1 different opticalmaterials,andeffects of contamination. high-power lasercoatings,modelingapproaches,heatingphenomena in thresholds inthecontextofinternationalstandardsandscalinglaws.Italsocovers discusses state-of-the-artmeasurementapproachesforevaluatinglaserdamage mechanisms andtechniquestodamageinopticalmaterialsthinfilms. It components. Itstreatmentspansfromfundamental andcoatingofoptical the bulkaswellonsurface ofthelaserdamagefield,coveringin overview This bookprovidesthemostcompleteandauthoritative Laser ZentrumHannovere.V., Germany Detlev Ristau Edited by in OpticalMaterials Laser-Induced Damage Suggested Price: March 2015,6-1/8x9-1/4, 424pp. Print ISBN:978-1-4822-3328-5 imaging, andmore. spectroscopy, photodissociationlaser-inducedfluorescence,hyperspectral laser-induced breakdown,ultrafast,cavityringdown,Raman,andreflectance and accuracyofexplosivedetectionidentification,thetextcoversterahertz, With andsecurityforces theultimategoalofaidingmilitary inincreasingspeed current advantagesandchallenges,discussnovelresearch andapplications. respective technology, andisstructuredtoofferhistoricalperspective,address Each chapterisauthoredbyaleadingexpertonthe laser-based technologiesforthedetectionofexplosives. This bookreviewspast,present,andemergingoptical Series: Devices,Circuits, andSystems,40 and MikellaE.Farrell Paul M.Pellegrino,EllenL.Holthoff, Edited by $209.95 /£134.00 $149.95 /£95.00 $189.95 /£121.00

33 Lasers, Optics, & Optoelectronics Light - The Physics of the Photon Masers and Lasers Ole Keller Second Edition, Aalborg University, Denmark An Historical Approach Series in Optics and Optoelectronics Mario Bertolotti From the early wave-particle arguments to the University of Rome “La Sapienza,” Italy mathematical theory of electromagnetism to Einstein’s work on the quantization of light, different descriptions This book examines the progress of research and of what constitutes light have existed for over 300 years. practical use of lasers chronologically, covering the This book examines the photon phenomenon from fundamental science in detail alongside fascinating

Lasers, Optics, & Optoelectronics several perspectives. It demonstrates the importance of studying the photon as biographical sketches of famous physicists and a concept belonging to a global vacuum (matter-free space). The book explains summaries of seminal papers. It supplies helpful drawings of prototype devices, the models and physical and mathematical descriptions of light and examines conceptual diagrams to aid in understanding, and remarkable historical the behavior of light and its interaction with matter. photographs. The Second Edition features new chapters on ultrashort pulse lasers and nonlinear optics, incorporates the latest developments and insights Print ISBN: 978-1-4398-4043-6 from key scientists, and includes extensive updates on fiber lasers, amplifiers, eBook ISBN: 978-1-4398-4044-3 ultraviolet and X-ray lasers, and plasmonic lasers. June 2014, 7 x 10, 484 pp. Suggested Price: $99.95 / £63.99 Print ISBN: 978-1-4822-1777-3 March 2015, 6-1/8 x 9-1/4 Suggested Price: $99.95 / £63.99

Light Propagation in Mathematical Methods Linear Optical Media for Electron Tomography Glen D. Gillen, Katharina Gillen, and Shekhar Guha Ozan Oktem KTH Royal Institute of Technology, Stockholm, Sweden This book combines the treatment of light propagation Hans Rullgard through various media, interfaces, and apertures using scalar and vector diffraction theories in one volume. After Chapman & Hall/CRC Mathematical and Computational Imaging Sciences Series covering the fundamentals of light and physical optics, the authors discuss light traveling within an anisotropic One of the central issues in life sciences research is to crystal and present mathematical models for light understand human biological processes in the cell in propagation across planar boundaries between different media. They describe time and space, preferably at a molecular level. This book offers a comprehensive the propagation of Gaussian beams and discuss various diffraction models for the overview of various mathematical methods for 3D image reconstruction and propagation of light. They also explore methods for spatially confining (trapping) post-processing methods relevant for electron tomography. It discusses several cold atoms within localized light-intensity patterns. topics in detail, which may appeal to a much larger audience. The authors emphasize development during the last decade that involves an increasing Print ISBN: 978-1-4822-1094-1 degree of mathematical sophistication. Code (or pseudo—code) will in selected eBook ISBN: 978-1-4822-1095-8 cases be included. November 2013, 6-1/8 x 9-1/4, 388 pp. Suggested Price: $132.95 / £89.00 Print ISBN: 978-1-4665-5441-2 34 June 2015, 6 x 9, 400 pp. Suggested Price: $89.95 / £57.99

Light Sources Microlenses Second Edition, Basics of Lighting Properties, Fabrication Technologies and Applications and Liquid Lenses Spyridon Kitsinelis Hongrui Jiang University of France, Toulouse University of Wisconsin, Madison, USA

This book provides the most complete introduction Xuefeng Zeng Global Foundries, Inc to light sources with essential information on the underlying science, technology developments, and Series in Optics and Optoelectronics applications. It offers an essential guide for anyone After describing how certain problems in optics can be interested in the development and use of lamps in different industrial and solved by liquid microlenses, this book introduces the physics and fabrication everyday lighting uses. In this second edition, the author gives an extensive methods involved in microlenses. It also details the facility and equipment update on solid-state lighting (LEDs and organic LEDs) and high-pressure requirements for general fabrication methods. The authors then present examples discharges to reflect the rapid movement in this direction. of various microlenses with non-tunable and tunable focal lengths based on Print ISBN: 978-1-4822-4367-3 different mechanisms. The book concludes by summarizing the importance of June 2015, 6-1/8 x 9-1/4, 352 pp. microlenses, shedding light on future microlens work, and exploring related Suggested Price: $149.95 / £95.00 challenges. Print ISBN: 978-1-4398-3669-9 eBook ISBN: 978-1-4398-3670-5 April 2013, 6-1/8 x 9-1/4, 228 pp. Suggested Price: $145.95 / £93.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2013,6-1/8 x9-1/4,270pp. eBook ISBN:978-1-4665-1427-0 Print ISBN:978-1-4665-1426-3 areas ofapplicationareshapingthefuture. provides abalancedscientificreview andtechnologicalprogressofhowthese The areasofapplicationarechosen fortheirpracticality, andeachchapter photovoltaics, photocatalysts,integrated chips,opticalelements,andsensing. latest developmentsinnanoplasmonicapplications,suchasopticalstorage, and outlinestheprogresschallengesofapplication.Itreviews the and technological background of a particular nanoplasmonic application Nanoplasmonics: AdvancedDeviceApplications Series: Devices,Circuits, andSystems Vancouver, BritishColumbia,Canada CMOS EmergingTechnologies Research, Inc., Krzysztof Iniewski Swinburne UniversityofTechnology, Melbourne,Australia James W. M.Chon Edited by Advanced DeviceApplications Nanoplasmonics Suggested Price: December 2014,6x9,300pp. Print ISBN:978-981-4316-67-5 nanophotonics, andnanobiology, orbiosensorresearch. will appealtoanyoneinthefieldofnanotechnology, especiallynanofabrication, application examplesofthissensorarealsoincludedinthechapters.Thebook and evaluationofnanoimprintbiosensors.Theproto-modelsystemssome followed byadetaileddiscussiononthedesign,fabrication, trends innanofabricationandnanoimprinttechnology, andintroductiononthe This bookstartswithanoverview OMRON Corporation,Kyoto,Japan Takeo NishikawaandSatoshiFujita Edited by Nanophotonics andNanobiology The FusionofNanofabrication, Nanoimprint Biosensors Suggested Price: March 2013,6-1/8x9-1/4,496pp. eBook ISBN:978-1-4665-0287-1 Print ISBN:978-1-4665-0286-4 band sub-THzphotonicwirelesslinks. field, thiseditionincludesnewchaptersonfiberBragggratingsandultrawide- current limitationsandonfuturedirections.Updatedtoreflectadvancesinthe wave to terahertz frequencies. Leading researchers share insights onovercoming and applicationsinmicrowavephotonics,rangingfrommicro-millimeter- and ultrafastnetworks.Thisbooksystematicallyintroduceskeytechnologies many innovativeapplications,includingultrawideband a commercial reality. Suchhybridtechnologywillleadto the integrationofopticalfiberandwirelessnetworksnow Microwave photonicscontinuestoseerapidgrowth,with CollegePark,USA University ofMaryland, Chi H.Lee Edited by Second Edition Microwave Photonics $167.95 /£107.00 $149.95 /£95.00 $157.95 /£99.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

provides a scientific provides ascientific Architectures Natural Biophotonic Suggested Price: September 2014,6x9,598pp. eBook ISBN:978-981-4267-42-7 Print ISBN:978-981-4267-16-8 lenses,andinvisibilitycloaks. electronics, perfect important applicationsofnanoplasmonics,includinginmedicine,nanolasers, differentshapesandtheirclusters.Italsopresentsthemost nanoparticles ofvery estimations andcalculationsofmainproperties many methods,accompaniedbydiagrams,forfast thousands ofresearch articles.Importantly, itcontains nanoplasmonic effectsthatnowarescatteredover principles andmathematicaldescriptionsofmain This bookpresents,forthefirsttime,bothphysical Moscow Lebedev PhysicalInstituteofRussianAcademySciences, Vasily Klimov Nanoplasmonics Suggested Price: May 2013,6-1/8x9-1/4,186pp. eBook ISBN:978-1-4398-6194-3 Print ISBN:978-1-4398-6193-6 chromogenic, photosensitizing,photovoltaic, andfluorescentproperties. molecular designaspectsandapplicationsthatutilizeNIR-absorbing, NIR relationship ofnear-infraredorganiccompoundsandpolymers.Chapterscover of materials, in particular the structure–property author emphasizes the chemistry in anaccessiblestylesuitableforresearchers andgraduatesinthefield.The this cutting-edge book reviewsimportant recent advances communications, biomedicine, and camouflage materials, great attentionduetotheirpotentialuseinoptical (NIR) organicmaterialsthatarecurrentlyreceiving Highlighting emergingapplicationsofnear-infrared Carleton University, Ottawa,Ontario,Canada Zhi Yuan Wang and EmergingApplications Near-Infrared OrganicMaterials Suggested Price: April 2015,6-1/8x9-1/4,350pp. Print ISBN:978-1-4822-3217-2 optics-based deviceconceptsmotivatedbynaturaldesign. polarization sensitivity, andfunctions.Italsodiscussesdevelopmentsofnew the photonicarchitecture intheeyesystemofvariousinsects,itsspectraland challenges inunderstandingnature’s capabilitiestomanipulatelight.Itdescribes for inspiration,reviewsthecurrentstateofart,anddescribesdiscusses complex opticaleffectsinnaturalbiophotonicarchitectures. Itprovidesamodel This bookdocumentskeydevelopmentsinthefieldof Femtosecond LaserLaboratory, KnowledgeCity, Mohali,India Pramod KumarandKamalP. Singh Edited by and BioimimeticApplications Complex OpticalEffects $149.95 /£95.00 $132.95 /£85.00 $169.95 /£108.00

35 Lasers, Optics, & Optoelectronics Textbook OLED Fundamentals Nonlinear Optics Materials, Devices, and Processing of Principles and Applications Organic Light-Emitting Diodes Karsten Rottwitt Edited by Denmark Technical University, Lyngby Daniel J. Gaspar and Evgueni Polikarpov Peter Tidemand-Lichtenberg Pacific Northwest National Laboratory, Denmark Technical University, Roskilde Richland, Washington, USA Series: Optical Sciences and Applications of Light, 3 This book provides comprehensive coverage of the fundamental principles of OLED design and operation Lasers, Optics, & Optoelectronics This book describes the fundamental aspects of nonlinear optics from basic principles to applications. Starting from the polarization induced by an electric for use in the solid-state lighting market and in display technology. Expert field in a material, it relates the induced polarization to the propagating fields. It authors highlight challenges in the search for more stable and efficient materials describes the properties of the induced polarization through a material response and device designs, including aspects of manufacturing, light outcoupling, expressed both in the time and frequency domains leading to the nonlinear properties of substrates and electrodes, and cost considerations. It addresses wave equation. The second part of the book focuses on applications of nonlinear important issues in the OLED-based lighting solutions such as encapsulation, interaction between light and matter, and considers nonlinearities in crystals and light extraction, deposition methods, and tools, as well as the competitive optical fibers. A solutions manual and figure slides are available upon qualifying development of large area OLED-based light sources. course adoption. Print ISBN: 978-1-4665-1518-5 Print ISBN: 978-1-4665-6582-1 April 2015, 7 x 10, 700 pp. November 2014, 7 x 10, 360 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $99.95 / £63.99

Optical Coding Theory Numerical Methods in Photonics with Prime Andrei V. Lavrinenko, Jesper Lægsgaard, Wing C. Kwong Niels Gregersen, Frank Schmidt, Hofstra University, Hempstead, New York, USA and Thomas Søndergaard Guu-Chang Yang Series: Optical Sciences and Applications of Light National Chung Hsing University, Taichung, Taiwan

Choosing the appropriate computational method for a Dedicated to optical coding theory, this unique book covers photonics problem requires a clear understanding of the fundamental concepts and important developments, pros and cons of the available numerical methods. This with a focus on families of prime codes, supplemented book presents six of the most frequently used methods: with several families of non-prime codes. It also explores potential applications FDTD, FDFD, 1+1D nonlinear propagation, modal method, Green’s function, to coding-based optical systems and networks. In a clear, concise manner, the and FEM. Each method is accompanied by a review of the mathematical authors first present the mathematical tools essential to optical coding theory. principles in which it is based, along with sample scripts, illustrative examples of Using a wealth of examples, they then describe applications of optical codes in characteristic problem solving, and exercises. MATLAB® is used throughout the various coding schemes, along with supporting hardware technologies. This is an text. A solutions manual is available upon qualifying course adoption. authoritative reference from two world-renowned experts in the field. Print ISBN: 978-1-4665-6388-9 Print ISBN: 978-1-4665-6780-1 eBook ISBN: 978-1-4665-6389-6 eBook ISBN: 978-1-4665-6781-8 36 September 2014, 6-1/8 x 9-1/4, 362 pp. May 2013, 6-1/8 x 9-1/4, 381 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $167.95 / £107.00

Odyssey of Light in Nonlinear Textbook Optical Fibers Optical Fiber Communication ® Theory and Applications Systems with MATLAB and ® Edited by Simulink Models K. Porsezian Second Edition Pondicherry University, India Le Nguyen Binh R. Ganapathy Huawei Technologies Co., Ltd., European Research Center, Sastra University, Thanjavur, India Muenchen, Germany Series: Optics and Photonics This book explores the very frontiers of lightwave technology. It is a collection of groundbreaking research that portrays the odyssey of light from optical solitons Carefully structured to provide practical knowledge of fundamental issues, to optical rogue waves in nonlinear optical fibers. The technological innovations and fully revised to reflect the latest optical communication techniques and at the core of this book are breakthrough advancements that form the basis applications, this Second Edition includes new and updated case studies, of next-generation ultra-high speed computers and telecommunication devices, examples, end-of-chapter problems, and MATLAB® and Simulink® models that including smartphones, digital TV, and broadband internet. supply a deeper understanding of the current and future state of optical systems and networks. The book fills the need for a text that emphasizes practical Print ISBN: 978-1-4822-3613-2 computing models that shed light on device behavior and dynamics. A solutions April 2015, 6-1/8 x 9-1/4, 400 pp. manual is available with qualifying course adoption. A solutions manual and Suggested Price: $189.95 / £121.00 figure slides are available upon qualifying course adoption. Print ISBN: 978-1-4822-1751-3 December 2014, 7 x 10, 908 pp. Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: August 2013,7x10,438pp. eBook ISBN:978-1-4398-5496-9 Print ISBN:978-1-4398-5495-2 functional information,andexamples of applicationsinregenerativemedicine. particular technique,itsadvantagesand limitationsintermsofstructuraland and lightscatteringspectroscopy. ofa Eachchapterprovidesanoverview microscopy, coherentanti-StokesRamanscattering,fluorescencespectroscopy, vision, bioluminescence,secondharmonicgenerationmicroscopy, multi-photon coherence tomography, acousto-opticimaging,Ramanspectroscopy, machine of regenerativemedicinetherapies.Itcoversoptical fabrication, assessment,andlongitudinalmonitoring imaging techniquesandinstrumentationforthe This practicalbookillustrateshowtouseoptical and StephenJ.Matcher Stephen P. Morgan,FelicityR.Rose, Edited by Regenerative Medicine Optical Techniques in Suggested Price: April 2013,6-1/8x9-1/4,272pp. eBook ISBN:978-1-4398-1850-3 Print ISBN:978-1-4398-1849-7 management inthin-filmPVdevices. and developtheirownmodelsaswellappreciateinnovativeconceptsinlight of simulationswiththedevelopedmodels,helpingreadersbetterunderstand solutions forimprovingthedevices.Manypracticalexamplesillustrateuse the applicabilityofopticalmodeling,andpresentconcretedirections on examplesofexistingopticalmodels,demonstrate film solar cells and PV modules. The authors offer insight optical modeling and simulations of thin- performing This workprovidesreaderswithathoroughguideto University ofLjubljana,Slovenia Janez Krc andMarkoTopic Devices of Thin-FilmPhotovoltaic Optical ModelingandSimulation Suggested Price: 2015,7x10,576pp. February Print ISBN:978-1-4822-2825-0 a comprehensiveresource forstudentsaswellscientistsandengineers. draws upontheauthors’extensiveacademicandindustrialexperiencetodeliver photonics.Thetext sensors, micro-andnanofibersensing,liquidcrystal of-the-art topicsandemergingareasofresearch fiber includingphotoniccrystal supplying detailedexamplesofthetechnologyinuse.Chaptersaddressstate- of, andlatestdevelopmentsin,opticalfibersensors, optic sensingsystems.Itdescribesthephysicalprinciples design, operation,andpracticalapplicationsoffiber This bookprovidesafundamentalunderstandingofthe Series: Devices,Circuits, and Systems,36 Ginu Rajan Edited by Advanced Techniques andApplications Optical FiberSensors $132.95 /£85.00 $132.95 /£85.00 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

parameter changesontheoutcome.Thebookalsodiscussesadvancedtopics. Fundamentals andDeviceApplications Optics ofAperiodicStructures Suggested Price: December 2014,6-1/8x9-1/4,224pp. Print ISBN:978-1-4665-5117-6 the principles.MATLAB Each chapter contains a set of suggested experiments to help readers visualize principles, thebookincludesapplicationsandworkedexamplesthroughout. with heavymathematicalequations.Inadditiontobasic background inmathematics,butdoesnotoverwhelm components andsystems.Thebookassumesabasic non-specialists whofindthemselvesworkingwithoptical ofopticalprinciplesfor This bookprovidesabasicoverview Ler Technologies, Carlsbad,California,USA Araz Yacoubian Guide An Interdisciplinary Optics Essentials Suggested Price: March 2015,7x10,1672pp. Print ISBN:978-1-4398-3977-5 mechanical materials,andmountinglenses onfixtures,amongothers. has addeddiscussionsonlaserdamage tooptics,specialcoatingsforopto- for variableorientationmirrorstoinclude largersubstratediameters.Theauthor techniques forbondingprismsandsmall mirrorsintheirmounts,andmountings ISO andtheOEOSC,catadioptricsystems,semikineticmountingsforprisms, systems. ThisThirdEditionoffersexpandedcoverageoftheprogress ofmajor designing, building,andtestinghardware;theperformance of informationaboutnewopticalinstruments;toolsandtechniques for This textcompilesintoasinglesource avastamount Raytheon, Tucson, Arizona,USA Daniel Vukobratovich Connecticut,USA Norwalk, Paul Yoder Two Volume Set Design, FourthEdition Opto-Mechanical Systems Suggested Price: December 2013,6x9,530pp. eBook ISBN:978-981-4463-09-6 Print ISBN:978-981-4463-08-9 optics. photovoltaics andtechnologies,opticalsensing,lightsources, andnonlinear device andengineeringapplicationstodenseopticalfilters,nanoplasmonics experimental aspectsofdeterministicaperiodicstructures,aswellnumerous of opticalscience,thebookcoversfundamental,computational,and photonics. EditedbyLucaDalNegro,aprominentresearcher intheseareas fascinating fieldsofaperiodicopticsandcomplex in therapidlygrowing, highly interdisciplinary, and number ofleadingexpertsthatactivelyworkworldwide This bookpresentsstate-of-the-artcontributionsfroma Boston University, Massachusetts,USA Luca DalNegro Edited by $79.95 /£49.99 $279.95 /£178.00 $149.95 /£95.00 ® simulations help readers understand the effects of simulationshelpreadersunderstandtheeffectsof

37 Lasers, Optics, & Optoelectronics Opto-Mechanical Systems Photonic Crystals Design, Fourth Edition, Volume 1 Principles and Applications Design and Analysis of Edited by Opto-Mechanical Assemblies Qihuang Gong and Xiaoyong Hu Peking University, Beijing, China Edited by Paul Yoder This book explores the primary principles of photonic Norwalk, Connecticut, USA crystals and the important research progress of photonic Daniel Vukobratovich crystal optical devices. It covers photonic crystal all-optical switching, tunable photonic crystal filter, photonic crystal Lasers, Optics, & Optoelectronics Raytheon, Tucson, Arizona, USA laser, photonic crystal logic devices, and photonic crystal sensors. It comprises The fourth edition of a bestseller, this book focuses on the optomechanical theoretical and experimental analyses of the realization of various functions of system design process, optomechanical structural design, parameters of concern, photonic crystal devices, preparation techniques, measurement methods, and and characteristics of materials. It discusses mounting in detail, including the potential applications. mounting of individual lenses and multiple lens assembly. It also discusses the design of windows, domes, and filters, including conventional windows, special Print ISBN: 978-981-4267-30-4 windows, and spherical and conformal surfaces. The book covers prism designs eBook ISBN: 978-981-4364-83-6 and applications, techniques for mounting prisms, and kinematic design and February 2014, 6 x 9, 366 pp. applications of flexures. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4822-5770-0 February 2015, 7 x 10, 771 pp. Suggested Price: $169.95 / £108.00

Opto-Mechanical Systems Photonics Modeling and Design Design, Fourth Edition, Volume 2 Slawomir Sujecki The University of Nottingham, UK Design and Analysis of Large Mirrors Series: Optical Sciences and Applications of Light and Structures This book delivers a concise introduction to the Edited by modeling and design of photonic devices. It describes Paul Yoder the analysis of the light propagation in dielectric media, Norwalk, Connecticut, USA discusses heat diffusion and carrier transport, applies the Daniel Vukobratovich presented theory to develop fibre and semiconductor Raytheon, Tucson, Arizona, USA laser models, addresses the propagation of short optical pulses in optical fibres, puts all modeling into practical context with examples of devices currently in This volume gives an in-depth overview of the design and mounting of small, development or on the market, and provides hands-on guidance in the form of large, horizontal-axis, vertical-axis, and metallic mirrors for optomechanical MATLAB® scripts, tips, and other downloadable content. A solutions manual is systems. It discusses factors affecting mirror performance, including tolerances, available upon qualifying course adoption. deformations, rigid body responses to dynamic excitation, and thermal effects. The book also highlights emerging technologies focusing on silicon and silicon Print ISBN: 978-1-4665-6126-7 carbide. November 2014, 6-1/8 x 9-1/4, 410 pp. Suggested Price: $129.95 / £82.00 38 Print ISBN: 978-1-4822-5772-4 March 2015, 7 x 10, 784 pp. Suggested Price: $169.95 / £108.00

Phase Estimation in Quantum Optics for Engineers Optical Interferometry F.J. Duarte Interferometric Optics, Rochester, New York, USA Edited by Pramod Rastogi This book is a concise and comprehensive presentation EPFL - Swiss Federal Institute of Technology, Lausanne of numerous fundamental concepts related to the light Erwin Hack nature and its interaction with matter. The Dirac approach Empa - Swiss Federal Laboratories for Materials Science is used in the description of optics, population inversion, and Technology, Dubendorf laser gain, and polarization. The book provides insight into practical laser and quantum mechanics. It also explains the This book covers the essentials of phase-stepping use of quantum mathematics which is required to understand the photon as algorithms used in interferometry and pseudointerferometric techniques. It it is used in real systems. Practical, real-world, worked-out examples are used presents the basic concepts and mathematics needed for understanding modern throughout as well as interferometric calculations using MATLAB®. phase estimation methods. The book first focuses on phase retrieval from image transforms using a single frame. It then examines the local environment of a Print ISBN: 978-1-4398-8853-7 fringe pattern, the phase estimation approach based on local polynomial phase eBook ISBN: 978-1-4398-8854-4 modeling, temporal high-resolution phase evaluation methods, and methods November 2013, 6-1/8 x 9-1/4, 444 pp. of phase unwrapping. It also discusses experimental imperfections liable to Suggested Price: $104.95 / £65.99 adversely influence the accuracy of phase measurements. Print ISBN: 978-1-4665-9831-7 November 2014, 6-1/8 x 9-1/4, 366 pp. Suggested Price: $129.95 / £82.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,6x9,536pp. Print ISBN:978-981-4613-17-0 and nanoscaleenergytransfer. bio(chemical)sensing,drugdiscovery,chiral nanostructuresforlightharvesting, research effortstodevelopnewtypesofplasmonicvortex–pinning platformsand momentum onmicro-andnanoscales.Itoffersaglimpseintotheongoing research intotheemergingareaofharnessingandgenerationphotonangular is acollectiveeffortbyseveralresearch groupstopushthefrontiersofplasmonics spectroscopy, and metamaterials development. This book cancer research, opticalcommunications,sensing, Plasmonics hasalreadyrevolutionizedmolecularimaging, Nikolay I.Zheludev Massachusetts InstituteofTechnology, Cambridge,USA Svetlana Boriskina Edited by Nanoplasmonics Singular andChiral Suggested Price: June 2015,6-1/8x9-1/4,500pp. Print ISBN:978-1-4665-6191-5 adoption. theory. Asolutionsmanualandfigureslidesareavailableuponqualifyingcourse regions ofelectromagneticspectrumalongwithproperstructure,materialsand different wavelengths,viz,ultraviolet,visible,infraredandmidfar can beswitchedonandoff.Italsodiscussesthedifferentlasersworkingat conversion efficiencyandhowfrequentlythedevices by propertheory, andlightpoweroutput,aswell structure, materials,operatingprinciplessupported background of semiconductorlasers. It covers their This bookprovidesthereaderwithacomprehensive and RikmantraBasu Prasanta KumarBasu,BratatiMukhopadhyay, Semiconductor LaserTheory Textbook Suggested Price: October 2013,6-1/8x9-1/4,366pp. eBook ISBN:978-1-4398-1951-7 Print ISBN:978-1-4398-1950-0 beams: communicationsandLiDARsystems.MATLA properties beams,alongwithtwoofthemostimportantapplicationsrandom communications withLiDARsystems.Itcoversmodificationofpolarization that allowcommunicationsandremotesensingofrandommediaforoptical field frompurelytheoretical trendsto applications The bookpresentstheresearch thathaschangedthe beams inimaging,tomography, andsmartillumination. in randombeamsandoutlinespossibleusesofthese ofrecentdiscoveries This bookprovidesanoverview University ofMiami,CoralGables,Florida,USA Olga Korotkova andApplications Theory Random LightBeams included. $179.95 /£114.00 $99.95 /£63.99 $145.95 /£93.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

® simulation codes are simulationcodesare Solar Radiation Suggested Price: September 2013,6-1/8x9-1/4,339pp. eBook ISBN:978-1-4665-1293-1 Print ISBN:978-1-4665-1292-4 trends, includingaminiaturepanoramiclensonmobilephones. detectorandtransformingoptics,arestimulatingnovel such asthecurved focus and optical image stabilization.It also explores how newtechnologies, auto the implementationofseveralactivefunctionalities,includingliquidcrystal terms ofopticaldesign,imagesensor, andfunctionalities.Thebookdescribes of miniaturecameramodule(MCM)componentsin digital stillcamerasandexplainsthespecificrequirements cameras. Itcomparesthistechnologywithtraditional applications, andfuturetrendsofminiaturemobile This bookdiscussesthestructure,operationprinciples, Laval University, Quebec,Canada Tigran V. Galstian Edited by Smart Mini-Cameras Suggested Price: June 2014,7x10,377pp. eBook ISBN:978-1-4665-7045-0 Print ISBN:978-1-4665-7044-3 encompassing generation,detection,andimagingmethods. ofTHztechnology,imaging andcancer diagnosis. Italsoincludesanoverview development ofTHzwavemedicaltechniques,suchasskindrugabsorption the useofTHzspectroscopyinelucidatingbiologicalbehaviorsaswell the and sensitivitytowatermolecules.Thebookexplores energy (greatersafety),longwavelength(lessscattering), (THz) waves. THz waves offer advantages due to their low This bookfocusesonbiomedicalapplicationsofterahertz Department ofPhysics,UniversitySeoul,SouthKorea Joo-Hiuk Son Edited by and Technology Terahertz BiomedicalScience Suggested Price: March 2013,6-1/8x9-1/4, 210pp. eBook ISBN:978-1-4665-0327-4 Print ISBN:978-1-4665-0294-9 concentrating, photovoltaic,solarthermal,anddaylightingengineeringdesigns. for estimating broadband and spectral solar resources available to flat plate, modeling. Themajorityofthebookdescribesmostpopularsimplemodels practical questionsabouttheaccuracyofsolarradiationmeasurementsand broadband andspectralsolarradiationdata.Itaddressesvarioustechnical easily implementedconceptsandmodelsforestimating Laboratory, thisbookbringstogetherthemostwidelyused, experience workingattheNationalRenewableEnergy Written by a leading scientist with over 35 years of National RenewableEnergyLaboratory, Colorado,USA Arvada, R.Myers Daryl Renewable EnergyApplications Practical Modelingfor $145.95 /£93.00 $149.95 /£95.00 $132.95 /£85.00

39 Lasers, Optics, & Optoelectronics Tunable Laser Optics Understanding Biophotonics Second Edition Fundamentals, Advances and Applications F.J. Duarte Edited by Interferometric Optics, Rochester, New York, USA Kevin Tsia This Second Edition of a bestselling book describes the Major advancements in biophotonics have successfully optics and optical principles needed to build lasers. It permeated biochemistry and cell/molecular biology also highlights the optics instrumentation necessary to as well as numerous preclinical applications. This book characterize laser emissions and focuses on laser-based presents the fundamentals of optics and biophotonics to optical instrumentation. The book emphasizes practical

Lasers, Optics, & Optoelectronics newcomers who are interested in this multidisciplinary and utilitarian aspects of relevant optics including the essential theory. This research field. With contributions from leading experts, the text highlights revised, expanded, and improved edition contains new material on tunable lasers major current advancements in preclinical diagnostics using optical microscopy and discusses relevant topics in quantum optics. and spectroscopy, including multiphoton microscopy, nanoscopy, and Print ISBN: 978-1-4822-4529-5 endomicroscopy. The book also introduces a number of emerging techniques and January 2015, 6-1/8 x 9-1/4, 360 pp. toolsets for biophotonics applications, such as nanoplasmonics, microresonators Suggested Price: $129.95 / £82.00 for molecular detection, and subcellular optical nanosurgery. Print ISBN: 978-981-4411-77-6 October 2014, 6 x 9, 350 pp. Suggested Price: $149.95 / £95.00

Ultrafast Laser Processing From Micro- to Nanoscale Textbook Edited by Koji Sugioka Understanding LED Illumination RIKEN, Wako, Japan M. Nisa Khan Ya Cheng IEM LED Lighting Technologies, New Jersey, USA Shanghai Institute of Optics and Fine Mechanics, China This book provides an in-depth introduction to the This book is composed of 12 chapters covering relevant fundamentals and practical aspects of LED lamp design. topics of ultrafast laser processing, including laser itself Covering light generation, efficiency, theoretical limits, and novel beam manipulation methods for processing, fundamentals of ultrafast efficiency limiting factors, and LED lamp design elements, laser processing, nanomaterial synthesis, surface micro- and nanostructuring, it explains the principles of large-space and 3D object micromachining, two-photon photopolymerization, internal modification/ illumination for developing competitive LED lamps. It presents design and fabrication of transparent materials, applications to photonic devices and simulation requirements for LED lamps with real examples that demonstrate how microchips for biological analysis, industrial applications, and so on. Each to make more energy-efficient and higher-quality lamps. This book also applies chapter is written by world-leading scientists in the related field so as to give lamp output metrics and characterization methods to retail and prototype lamps comprehensive reviews in the field of ultrafast laser micro- and nanoprocessing. for comparison. Figure slides are available upon qualifying course adoption. Print ISBN: 978-981-4267-33-5 Print ISBN: 978-1-4665-0772-2 eBook ISBN: 978-981-4303-69-9 eBook ISBN: 978-1-4822-0300-4 June 2013, 6 x 9, 616 pp. August 2013, 6-1/8 x 9-1/4, 272 pp. 40 Suggested Price: $179.95 / £114.00 Suggested Price: $71.95 / £45.99

Ultra-Realistic Imaging Underwater Acoustic Advanced Techniques in Analogue Modeling and Simulation and Digital Colour Holography Fourth Edition Hans Bjelkhagen Paul C. Etter Hansholo Consulting Ltd, UK Ocean Scientist, USA David Brotherton-Ratcliffe Geola Technologies Ltd, UK This fourth edition of a bestseller continues to provide the most authoritative overview of currently available Ultra-high resolution holograms are now finding propagation, noise, reverberation, and sonar-performance commercial and industrial applications in such areas as models. It discusses the fundamental processes involved in simulating the holographic maps, 3D medical imaging, and consumer devices. This handbook performance of underwater acoustic systems and emphasizes the importance provides complete coverage of real-time colour holographic processes and of applying the proper modeling resources to simulate the behavior of sound in applications. In addition to discussing the optics and theory behind these virtual ocean environments. Along with new problem sets, this edition addresses holographic systems, the book details laser technologies, recording devices, data recent advances in inverse techniques and marine-mammal protection and acquisition and processing techniques, and materials for reproduction. Leading includes updated and expanded inventories of available models. researchers in the field cover both digital and analogue colour holography as well Print ISBN: 978-1-4665-6493-0 as real-time displays, CW lasers, and digital holographic printing. eBook ISBN: 978-1-4665-6494-7 Print ISBN: 978-1-4398-2799-4 February 2013, 6-1/8 x 9-1/4, 554 pp. eBook ISBN: 978-1-4398-2800-7 Suggested Price: $283.00 / £181.00 May 2013, 7 x 10, 664 pp. Suggested Price: $177.95 / £113.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 wireless andopticalfibercommunications. the basics to the mostmodern aspects of electromagnetics for next-generation understand thebehaviorofelectromagneticfields.Thechaptersbuildfrom Suggested Price: September 2014,6x9,350pp. Print ISBN:978-981-4303-59-0 lasers fordiffractionapplications. developments. Thebookalsoconsiders futureexploitationofx-rayfreeelectron important characteristicsofthesources, experimentalset-up,and newdetector of solidandliquidmatterwithup-to-date research examples. Itpresents modern synchrotronsources investigations andillustratesbulkinterface ofdiffractionand scattering methods currently available at offers anoverview fromthesub-nanometerrangetomicrometers. Thisbook buried interfaces and tool forstructureanalysisnotonlyinbulkmaterialsbutalsoatsurfaces High-resolution x-raydiffractionandscatteringisakey Kiel, Germany Institut fürExperimentelleundAngewandtePhysik, Bridget M.Murphy HASYLAB amDESY, Hamburg,Germany Oliver H.Seeck Edited by Modern ExperimentalTechniques X-Ray Diffraction Suggested Price: April 2013,6-1/8x9-1/4,406pp. eBook ISBN:978-1-4398-4754-1 Print ISBN:978-1-4398-4753-4 media andincludesMATLAB highlights applicationsofelectromagneticwavesinthewirelessandguided techniques thatemploywirelessradiatedandopticallyguidedwaves.Thetext systems. Itpresentsthefundamentalaspectsofopticalcommunication waves infree space and lightwave communication This book is a one-stop reference on electromagnetic Series: OpticsandPhotonics Munich, Germany European Research Center, HuaweiTechnologies, Le NguyenBinh Fundamentals andApplications Electromagnetics Wireless andGuidedWave Suggested Price: May 2015,6-1/8x9-1/4,375pp. Print ISBN:978-1-4822-3773-3 A solutionsmanualisavailableuponqualifyingcourseadoption. technologies. Thisbookpromisestofascinateyoungmindsintheareaofoptics. textbook, itstartswiththebasicsandthenmovesontocovernewest familiar withtheconceptsbehindtheseadvances.Intendedalsoasanoptics undergraduates tounderstand.Thegoalofthisbookismakeyoungreaders been discussedonlyinresearch articles,whicharedifficultevenforsenior in classicaloptics.Untilnow, theseadvanceshave In recentyears,therehavebeenmanynewadvances and Ayan Banerjee Subhasish DuttaGupta,NirmalyaGhosh, TrendsContemporary Basic Conceptsand Wave Optics Textbook $149.95 /£95.00 $125.95 /£79.99 $89.95 /£57.99

® andSimulink

For more informationand acompletelistof titles,visitusat www.crcpress.com ® computer models to help readers computermodelstohelpreaders

circumradius ofanyhyperbolic simplex. example, theauthoranalyticallydetermineshyperboliccircumcenter and demonstrates thatthisisalsothecasewithanalytichyperbolicgeometry. For and succinctnessinrelatedexpressions.Usingnewmathematicaltools,thebook in NDimensions Analytic HyperbolicGeometry Suggested Price: April 2015,6x9,600pp. Print ISBN:978-1-4822-4503-5 classification ofringsfromahomologicalpointview. injective andweakdimensionofmodules,aswelltherecentresultson rings, andmore.Inaddition,itdiscussesthebasicconceptsonprojective, rings,distributiveandsemi-distributiveserialnon-singular semi- hereditary and classes ofnon-commutativeandnon-Noetherianringsincludinghereditary algebras, ringsandmodules.Itdetailsthedifferent ofassociative advanced topicsofthestructuraltheory This book systematizes the more recent results on Czestochowa UniversityofTechnology, Poland Nadiya M.Gubareni CWI, Amsterdam,Netherlands Michiel Hazewinkel Non-commutative AlgebrasandRings Algebras, RingsandModules Suggested Price: July 2013,6-1/8x9-1/4,550pp. eBook ISBN:978-1-4665-1512-3 Print ISBN:978-1-4665-1511-6 qualifying courseadoption. equations. Asolutionsmanualandaninstructor’s manualareavailableupon only thesimplestdifferentialequations,suchasfirst-orderlinearandseparable no prior knowledge of differential equations, it explains the exact solution of properties ofsomeimportantfunctionsinappliedmathematics.Assuming and integrals.Alongtheway, thebookexplores to familiarproblems,includinglimits,inversefunctions, introduces asymptoticnotationandthenappliesthistool of asymptoticseasytocomprehend.Itimmediately This self-containedtextmakesthedifficultsubject Arkansas StateUniversity, Jonesboro,USA William Paulsen Perturbation Theory Asymptotic Analysisand Suggested Price: 2015,6-1/8x9-1/4,525pp. February Print ISBN:978-1-4822-3667-5 to geometry. TheextensionofcommonEuclideangeometry as animportantconceptinn This bookintroducesforthefirsttimehyperbolicsimplex North DakotaStateUniversity, Fargo,USA Abraham A.Ungar An Introduction N dimensions, with $139.95 /£89.00 $115.95 /£73.99 $99.95 /£63.99 N being any positive integer, results in greater generality

-dimensional hyperbolic -dimensional hyperbolic

41 Lasers, Optics, & Optoelectronics / Mathematics for Physics Coupled Systems Differential Forms and the Theory, Models, and Applications Geometry of General Relativity in Engineering Tevian Dray Juergen Geiser Oregon State University, Corvallis, USA Ernst-Moritz-Arndt University of Greifswald, Germany Requiring little more than calculus and some linear Chapman & Hall/CRC Numerical Analysis algebra, this book provides readers with a coherent and Scientific Computing Series path to understanding relativity. It helps readers learn This book explains how to solve complicated coupled just enough differential geometry to grasp the basics of models in engineering using analytical and numerical general relativity. The first half of the book describes some methods. It extends standard engineering tools to coupled models in materials of the surprising implications of relativity without introducing more formalism and flow problems with respect to their scale dependencies and their influence than necessary. The second half takes a more detailed look at the mathematics

Mathematics for Physics on each time and spatial scale. The author presents splitting multiscale methods of differential forms, showing how they are used to describe key geometric ideas to solve multiscale and multiphysics problems and describes analytical and in general relativity. numerical methods in time and space for evolution equations arising in Print ISBN: 978-1-4665-1000-5 ® ® engineering problems. MATLAB and Simulink are used to implement the October 2014, 6 x 9, 321 pp. methods. Suggested Price: $49.95 / £29.95 Print ISBN: 978-1-4665-7801-2 eBook ISBN: 978-1-4665-7802-9 February 2014, 6-1/8 x 9-1/4, 315 pp. Suggested Price: $89.95 / £57.99

Textbook Textbook Essential MATLAB® and Octave A Course in Mathematical Jesus Rogel-Salazar University of Hertfordshire, UK Methods for Physicists Designed for students in physics, engineering, and Russell L. Herman other disciplines taking a course on MATLAB® or University of North Carolina, Wilmington, USA Octave, this text presents the essential commands Based on the author’s junior-level undergraduate and structures that allow students to unlock the course, this classroom-tested textbook is designed capabilities of MATLAB and Octave without having for an introductory course in mathematical physics. to understand too many technicalities. Given the similarities in syntax between Focusing on the physics of oscillations and waves, both languages, the book shows students how to write code that can be used it helps students understand the mathematical techniques needed for their in both environments. The text assumes no prior programming knowledge, future studies in physics. The book introduces the methods while studying one making it accessible to a wide range of students. A solutions manual and figure underlying theme from physics. It takes a bottom-up approach that emphasizes slides are available upon qualifying course adoption. physical applications of the mathematics. A solutions manual and figure slides are Print ISBN: 978-1-4822-3463-3 available upon qualifying course adoption. November 2014, 7-1/2 x 9-1/4, 288 pp., Soft Cover Print ISBN: 978-1-4665-8467-9 Suggested Price: $69.95 / £44.99 eBook ISBN: 978-1-4665-8469-3 42 December 2013, 8-1/2 x 11, 774 pp., Soft Cover Suggested Price: $94.95 / £46.99

Difference Equations Textbook Theory, Applications and Functions of Advanced Topics, Third Edition a Complex Variable Ronald E. Mickens Hemant Kumar Pathak, Ravi Agarwal, Clark Atlanta University, SW Atlanta, Georgia, USA and Yeol Je Cho This book covers many important classes of difference This text is designed for a first course usually called equations, including general, linear, first, second, and Theory of Functions of a Complex Variable. It is presumed Nth order, along with nonlinear equations, partial that students have some prior knowledge of complex difference equations, functional equations, and numbers. The authors introdue the subject by Nth order equations having constant coefficients. It presents a wide range of capturing the fundamental idea of complex numbers leading to different tools techniques for calculating exact and approximate solutions. Numerous worked of complex analysis presenting them both in an interesting and a rigorous examples illustrate the use of the methodologies. This edition includes new manner. To enhance the understanding of the subject they have also gone down chapters on advanced topics, such as asymptotic behavior of solutions and a number of bypaths. Complete definitions well explained by suitable examples, functional equations, as well as problems that have appeared in the recent explanations, and proofs throughout the text are highlighted. A solutions manual mathematical literature. is available upon qualifying course adoption. Print ISBN: 978-1-4822-3078-9 Print ISBN: 978-1-4987-2015-1 March 2015, 6-1/8 x 9-1/4, 700 pp. June 2015, 6-1/8 x 9-1/4, 624 pp., Pack - Book and Ebook Suggested Price: $119.95 / £76.99 Suggested Price: $99.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,7x10,482pp. Print ISBN:978-1-4398-4815-9 manual isavailableuponqualifyingcourse adoption. includes roughly750exercises, manyofwhicharerelatively new. Asolutions can be applied. It also as well as various examples that show how the theory only somefamiliaritywithgrouptheory, thetextincorporates nearly 600figures approach that incorporates both extensive illustrations and full proofs. Requiring often surprising,applications.Ittakesavisualandrigorous throughmany,while illustratingthepoweroftheory inadirectandengagingmanner and homotopytheory This self-containedbookexploresthebeautyoftopology University ofManitoba,Winnipeg, Canada Sasho Kalajdzievski Topology andHomotopy An IllustratedIntroductionto Textbook Suggested Price: March 2015,7x10 Print ISBN:978-1-4665-6937-9 hydrodynamics, andotherareas. and variousequationsarisinginapplications,suchasheatmasstransfer, with newnonlinearequations,formulasforeffectivelyconstructingsolutions, second-, third-,fourth-andhigher-orderdifferentialequationssystemsalong analyzing and solving linear and nonlinear equations. This edition covers first-, asymptotic, approximateanalytical,symbolic,andquantitativemethodsusedfor available. Encompassingmorethan7,000ODEswithsolutions,itpresentsmany more equations and methods used in the field than any other book currently The neweditionofthispopularhandbookcontains Russian StatePedagogicalUniversity, St.Petersburg Valentin F. Zaitsev Russian AcademyofSciences,Moscow Andrei D.Polyanin Third Edition Differential Equations Handbook ofOrdinary Suggested Price: June 2003,6-1/8x9-1/4,596pp.,SoftCover Print ISBN:978-0-7503-0606-5 fromthegeometricalpointofview.string theory examine anomaliesingaugefieldtheoriesandtheanalysisofPolakov’s bosonic theorem intermsofsupersymmetricquantummechanics.Thefinaltwochapters classes, andindextheorems.Newtothissecondeditionistheproofof concepts oftopologyandgeometry, includingfiberbundles,characteristic illustrations, exercises, andproblems,theauthordemonstratesmoreelaborate general relativity, vectorspaces,andtopology. Usingmany ofquantumfieldtheory,with abriefsurvey gaugetheory, andtopology.techniques ofdifferentialgeometry Itstarts This bookprovidesanintroductiontotheideasand Kinki University, Osaka,Japan M. Nakahara Second Edition Geometry, Topology andPhysics Textbook $89.95 /£57.99 $149.95 /£95.00 $87.95 /£55.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Textbook Suggested Price: July 2002,6-1/8x9-1/4,368pp. eBook ISBN:978-1-4200-3339-7 Print ISBN:978-0-7503-0692-8 references providesavaluableresource forfurtherstudy. transform analysisacrossdisciplines.Acomprehensivelistofmorethan700 areas, makingthereaderawareofsimilaritiesthatexistinusewavelet wavelet transforms. The book concludes with applications in a variety of subject followed byadiscussionofthemathematicsbothdiscreteandcontinuous ofthewavelettransform, of applications.Thebookfirstpresentsanoverview illustrations, someincolor, toconveymathematicalconceptsandtheresults applications ofwavelettransformmethods.Theauthorusesseveralhundred andpractical ofthetheory This bookprovidesanoverview Covidien, Edinburgh,Scotland Paul SAddison and Finance in Science,Engineering,Medicine andApplications Theory Introductory Transform Handbook The IllustratedWavelet Suggested Price: August 2013,6-1/8x9-1/4,329pp. eBook ISBN:978-1-4665-8950-6 Print ISBN:978-1-4665-8948-3 They alsofocusontheimplementation ofthealgorithmsusingMATLAB interpolation theorem,numericaldifferentiation andintegration,ODEs. representations, nonlinearequations,linearalgebraconcepts,theLagrange engineering, andthesciences,authorscoverfloating-pointnumber numerical methods.Drawingontheiryearsofteachingstudentsinmathematics, of numericalmathematics and explainshowtoimplementprogram classroom-tested textpresentsfundamentalconcepts Designed foraone-semestercourseonthesubject,this American UniversityofBeirut,Lebanon Nabil NassifandDollyKhuwayriFayyad Computing Analysis andScientific Introduction toNumerical Textbook Suggested Price: July 2013,6-1/8x9-1/4,363pp. eBook ISBN:978-1-4398-9888-8 Print ISBN:978-1-4398-9886-4 presented aresolvedusingMATLAB used incurrentnaturalscienceandengineeringapplications.Mostofthemodels ecological systems.Itprovidesapracticalunderstandingofhowthemodelsare students, thistextfocusesonmathematicalmodelsinnaturalsystems,particularly Suitable foradvancedundergraduateandgraduate Hyderabad, India Gokaraju RangarajuInstituteofEngineering&Technology, Satteluri R.K.Iyengar Indian SchoolofMines,Dhanbad,India Ranjit KumarUpadhyay Modeling andChaoticDynamics Introduction toMathematical solutions manualandfigureslidesare availableuponqualifyingcourseadoption. slides areavailableuponqualifyingcourseadoption. analyses.Asolutionsmanualandfigure needed tobuildmodelsandperform examples, thetextpresentsallfundamentalconceptsandmathematicalskills $125.95 /£79.99 $94.95 /£59.99 $94.95 /£59.99

® . Alongwithavarietyofexercises andsolved

® . A . A 43 Mathematics for Physics Mathematical Theory of Modeling and Control for Micro/ Quantum Computation Nano Devices and Systems Goong Chen Edited by Texas A&M University, College Station, USA Ning Xi, Mingjun Zhang, and Guangyong Li Zijian Diao Series: Automation and Control Engineering Ohio University, St. Clairsville, USA Series: Chapman & Hall/CRC Applied Mathematics The first to address this emerging field, this book & Nonlinear Science provides experts’ cutting-edge knowledge of micro/ nanotechnology, energy, and bio-systems. The editors The design and construction of the quantum computer offer an integrated view from theory to practice, covering is one of the most exciting and challenging goals of the scientific community. topics ranging from sensors to energy devices and control of biology systems in This book provides an introductory yet comprehensive treatment of the cellular and molecular levels. The book also features case studies for modeling of mathematical theory underlying quantum computation. The author adopts Mathematics for Physics micro/nano devices and systems, and explains how the models can be used for the formal, axiomatic style of stating and proving lemmas, propositions, and control and optimization. Readers benefit from learning new techniques, and theorems, but does so in a way that keeps the treatment self-contained and applying those techniques to their own research. accessible to a broad, multidisciplinary audience. Numerous diagrams of circuits and devices support the text. Plentiful exercises and examples reinforce the Print ISBN: 978-1-4665-5405-4 concepts and make this book suitable for graduate-level course work as well as a eBook ISBN: 978-1-4665-5406-1 valuable reference for researchers and practitioners. December 2013, 6-1/8 x 9-1/4, 175 pp. Suggested Price: $145.95 / £93.00 Print ISBN: 978-1-58488-389-0 May 2015, 6-1/8 x 9-1/4, 320 pp. Suggested Price: $89.95 / £57.99

Textbook Ordinary and Partial The Method of Moments Differential Equations in Electromagnetics Victor Henner, Tatyana Belozerova, Second Edition and Mikhail Khenner Walton C. Gibson This text provides a complete and accessible course Tripoint Industries Inc., Harvest, Alabama, USA on ODEs and PDEs using many examples and exercises as well as intuitive, easy-to-use software. This book explains the solution of electromagnetic The book includes all the topics that form the core of integral equations via the method of moments (MOM). a modern undergraduate or beginning graduate course in differential equations. It incorporates sufficient background material and offers It also discusses other optional but important topics such as integral equations, nuts-and-bolts implementation details. This second edition extends the integral Fourier series, and special functions. Requiring no user programming, the equation framework to treat objects having conducting as well as dielectric parts. accompanying computer software allows readers to fully investigate problems. A It also updates topics to reflect current technology, includes more material on the solutions manual and figure slides are available upon qualifying course adoption. calculation of near fields, and improves equations and figures. Print ISBN: 978-1-4665-1500-0 Print ISBN: 978-1-4822-3579-1 eBook ISBN: 978-1-4665-1513-0 eBook ISBN: 978-1-4822-3580-7 January 2013, 7 x 10, 644 pp. 44 July 2014, 6-1/8 x 9-1/4, 450 pp. Suggested Price: $89.95 / £59.99 Suggested Price: $119.95 / £76.99

Mimetic Discretization Methods Partial Differential Equations Jose E. Castillo with Variable Exponents San Diego University, California, USA Variational Methods Guillermo F. Miranda Universidad Central de Venezuela, South America and Qualitative Analysis

This book focuses on the recent mimetic discretization Vicentiu D. Radulescu Mathematics Institute of the Romanian Academy method co-developed by the first author. Based on the Series: Monographs and Research Notes in Mathematics Castillo-Grone operators, this simple mimetic discretization method is invariably valid for spatial dimensions no This is the first monograph to deal with nonlinear greater than three. The book also presents a numerical method for obtaining partial differential equations with variable exponents. It develops a new and corresponding discrete operators that mimic the continuum differential and flux- rigorous theory for a class of nonlinear elliptic partial differential equations. The integral operators, enabling the same order of accuracy in the interior as well core of the book covers of existence results, non-existence properties, multiplicity as the domain boundary. Problems and the authors’ mimetic methods toolkit results and the spectral analysis of nonhomogenous differential operators with (MTK) are available online. variable exponents. In addition, the book includes many applications from fields Print ISBN: 978-1-4665-1343-3 like smart fluids, space technology, robotics and image restoration. eBook ISBN: 978-1-4665-1344-0 Print ISBN: 978-1-4987-0341-3 January 2013, 6-1/8 x 9-1/4, 260 pp. May 2015, 6-1/8 x 9-1/4, 304 pp. Suggested Price: $125.95 / £79.99 Suggested Price: $99.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2014,6-1/8x9-1/4,260 pp. Print ISBN:978-1-4822-5651-2 possible and uses Mathematica arguments and variouscombinations.Thebook givesthemostelementary function, thedigammaincomplete betafunction,Frullaniintegrals, logarithmic integrals,thegammafunction,trigonometric beta Gradshteyn andI.M.Ryzhik.Itcollects15papersfromRevistaScientiacovering of entriesinthefrequentlyusedtableintegralsbyI.S. This volumeprovidesself-containedproofsofavariety Series: MonographsandResearch NotesinMathematics Tulane University, NewOrleans,Louisiana,USA Victor H.Moll the Proofs-Volume I Gradshteyn andRyzhik Special Integralsof Suggested Price: August 2013,6x9,227pp. Print ISBN:978-1-4822-1781-0 heat recovery, HVAC ofenergycalculations. andasummary walk-through audit,lighting,pumps,fans,motors,insulation,fuelswitching, time-saving methods. Key topicscovered include energy myths and magic, the secrets forsimplifyingcomplexenergycalculationsanddemonstrateshisunique, studies and associated calculations. The author, a practicing engineer, shares his energy savings. This reference will save countless hours doing energy feasibility which guaranteeisbetterfortheirbuildingandESCOcanbestdeliver for and how toevaluate before makinga decision about bestseller helpsbuildingmanagersidentifywhattolook a Completely revisedandupdated,thisfiftheditionof Consultant, Lilburn,Georgia,USA Richard R.Vaillencourt Fifth Edition to EnergyCalculations Simple Solutions Suggested Price: March 2015,41/5x61/2,296pp.,SoftCover Print ISBN:978-1-4987-0475-5 handy size.Figureslidesareavailableuponqualifyingcourseadoption. several additionaltopics,allwhilemaintainingitsaccessible,clearstyleand bestseller providesevenmorecomprehensivecoveragewiththeinclusionof a formulas forengineeringandscientificapplications.Thisfiftheditionof statistical tables,scoresofworkedexamples,andthemostusefulmathematical topics, thiseditionpresentsmanynumericaland Containing acarefulselectionofstandardandtimely Series: AdvancesinAppliedMathematics,2 Temple University, Philadelphia,Pennsylvania,USA Ronald J.Tallarida 5th Edition and MathematicalFormulas Pocket BookofIntegrals beauty, patterns,andunexpectedconnections behindtheformulas. $99.95 /£63.99 $99.95 /£63.99 $29.95 /£19.99

®

to verify the formulas. Readers discover the toverifytheformulas. Readers discoverthe

For more informationand acompletelistof titles,visitusat www.crcpress.com

course adoption. professionals. Asolutionsmanualandfigureslidesareavailableuponqualifying computer science,appliedmathematics,andrelatedfields,aswellradiology the textisbeneficialtostudentsofmedicalphysics,biomedicalengineering, examples fromradiology, internalmedicine,surgery, andradiationtherapy, chapter onclinicalapplicationsandanimage-guidedtherapytutorial.Including segmentation, rendering, registration, and reconstruction, but also containsa Suggested Price: March 2014,7x10,455 pp. eBook ISBN:978-1-4665-5560-0 Print ISBN:978-1-4665-5557-0 MATLAB medical image processing, presenting key principles and algorithms using simple edition ofabestsellerdeliversanidealintroductionto Avoiding excessivemathematicalformalisms,thissecond Medical UniversityofVienna, Austria Wolfgang Birkfellner Second Edition,ABasicCourse Processing Applied MedicalImage Textbook Suggested Price: April 2015,6-1/8x9-1/4,500pp. Print ISBN:978-1-4665-6310-0 stimuli formoreexperiencedengineers alreadyworkinginthefield. problems. Italsoprovidesrealimplementation examplesthatofferinsightsand sensors. Thebookdevelopsthetopics in detail,withaconstantfocusonpractical level topicscommonlyfoundintheworld offront-endelectronicsforradiation blocks, omittingtransistor-levelimplementation. Italsocoversimportantsystem- radiation detectorsanddescribescircuits attheleveloffunctionalbuilding the fundamentalprinciplesofsignalprocessingfor end electronics for radiation detection. It discusses This bookoffersacomprehensivetreatmentoffront- Series: Devices,Circuits, andSystems Istituto NazionalediFisicaNucleare,Torino, Italy Angelo Rivetti for RadiationSensors Front-End Electronics CMOS Suggested Price: 2013,8-1/2x11,284pp. January eBook ISBN:978-1-4398-7876-7 Print ISBN:978-1-4398-7875-0 envisioned clinicaltranslation. of issuesrelatedtohumanuseandasummary book concludeswithregulatory that underlietheuseofnanoparticlesforimagingandtreatingtumors.The Successive chaptershighlightthecomputationalandexperimentaltechniques nanoparticles, andthequantificationofnanoparticleaccumulationwithintissues. radiation biology, thebookdiscussesfabricationofnanoparticles,safety detection. Afteranintroductiontothefirstprinciplesofradiationphysicsand properties ofnanoparticlesleadtonovelstrategiesforcancertreatmentand This comprehensivevolumedemonstrateshowtheuniquephysicochemical Houston, USA The UniversityofTexas MDAndersonCancerCenter, Sunil Krishnan Georgia InstituteofTechnology, Atlanta,USA Sang HyunCho Edited by in RadiationOncology Principles andApplications Cancer Nanotechnology ® /Octave scripts. It not only discusses data storage, transformations, $79.95 /£49.99 $179.95 /£114.00 $177.95 /£113.00

45 Mathematics for Physics / Medical Physics Computational Biomechanics Decommissioning Health Physics of the Musculoskeletal System A Handbook for MARSSIM Users, Edited by Second Edition Ming Zhang Eric W. Abelquist Hong Kong Polytechnic University, Hong Kong ORISE, Tennessee, USA Yubo Fan Written by one of the original MARSSIM authors, this second Focusing on orthopedic and rehabilitation engineering edition incorporates all of the requisite technical aspects applications, this comprehensive reference collects the of planning and executing radiological surveys in support latest research and cutting-edge techniques used in of decommissioning. It covers survey instrumentation, computational biomechanics. The book is divided into chapters based on body detection sensitivity, statistics, dose modeling, survey procedures, and release part: foot and ankle joint, knee joint, lower limb, hip joint, spine, and upper criteria. Along with more case studies and examples, this edition includes new extremity. Each chapter covers basic anatomy of the body part and details the chapters on hot spot assessment and the clearance or release of materials, revises scientific questions and medical problems that are addressed by modeling. The the chapters on statistics and characterization survey design, and updates the book discusses computational model development and techniques used, related regulations and guidance documents. Medical Physics experimental studies for model setup and validation, and clinical applications. Print ISBN: 978-1-4665-1053-1 Print ISBN: 978-1-4665-8803-5 eBook ISBN: 978-1-4665-1054-8 eBook ISBN: 978-1-4665-8804-2 October 2013, 6-1/8 x 9-1/4, 696 pp. September 2014, 7 x 10, 404 pp. Suggested Price: $132.95 / £85.00 Suggested Price: $129.95 / £82.00

Diagnostic Endoscopy Computer-Aided Detection and Edited by Diagnosis in Medical Imaging Haishan Zeng BC Cancer Research Centre, University of British Columbia, Edited by Vancouver, Canada Qiang Li Series in Medical Physics and Biomedical Engineering Chinese Academy of Sciences, Shanghai, China This volume uses case studies to familiarize readers Robert M. Nishikawa with the basics of endoscopic optics, the use of white Covering technical advancements and clinical light endoscopy and fluorescence endoscopy for applications, this book presents the first comprehensive diagnostic applications, and various microscopic endoscopy imaging modalities. overview of computer-aided detection (CAD) and Covering the details of design and various biomedical uses, it covers not only diagnosis systems in breast, chest, and abdominal imaging. Each chapter gives the conventional field imaging modality (white light endoscopy), but also the an introduction to the topic, relevant methodological approaches, a summary new field imaging modality (fluorescence endoscopy) as well as microscopic of results and performance, and key challenges and opportunities. The book endoscopy and endoscopic spectroscopy. Emphasizing both working principles explores the latest advances and emerging areas of medical applications, and practical applications, it offers examples from the authors’ first-hand research including detection and characterization of brain tumors, cerebrovascular and development work. diseases, pulmonary embolism, eye diseases, bone metastasis, and lung function. Print ISBN: 978-1-4200-8346-0 Print ISBN: 978-1-4398-7176-8 eBook ISBN: 978-1-4200-8347-7 46 March 2015, 8-1/2 x 11, 496 pp. December 2013, 6-1/8 x 9-1/4, 272 pp. Suggested Price: $179.95 / £114.00 Suggested Price: $104.95 / £65.99

Cone Beam Computed Electromagnetic Fields Tomography in Biology and Medicine Edited by Edited by Chris C. Shaw Marko S. Markov The University of Texas MD Anderson Cancer Center, Williamsville, New York, USA Houston, USA Electromagnetic fields (EMF) modalities offer an This book explains how cone beam computed alternative of increasing use, rather than pharmaceutical tomography (CBCT), with its superior spatial resolution products in everyday life that even when successfully and compact configuration, is implemented and used used treat the medical problem, but cause significant in clinical applications and animal research. With a focus on image acquisition, side effects largely due to the patient’s overdosing. In contrast, EMF therapy reconstruction, processing, and display, the text covers the basic principles and provides noninvasive, easy-to-apply modalities that treats the cause of the applications of CBCT as well as advanced techniques. It reviews the historical problem. This book provides a detailed overview of these EMF applications to development of medical x-ray imaging, explores current research, and considers help address specific medical conditions. future developments while addressing issues related to implementation and system characteristics, including image quality, artifacts, radiation dose, and Print ISBN: 978-1-4822-4850-0 perception. March 2015, 7 x 10, 488 pp. Suggested Price: $169.95 / £108.00 Print ISBN: 978-1-4398-4626-1 eBook ISBN: 978-1-4398-4627-8 February 2014, 8-1/2 x 11, 273 pp. Suggested Price: $179.95 / £114.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2007,7x10,1450pp.,Pack- Book andEbook eBook ISBN:978-1-4200-1202-6 Print ISBN:978-0-7503-0860-1 attenuation data. legislation. Thefinalpartcontainsuseful tablesofbothphysicalconstantsand the frameworkofradiationprotection, includingthedetailedapplicationofUK sections examine brachytherapy using sealed and unsealed sources and provide by adiscussionofnewadvancesinphotonandparticletherapy. Subsequent discuss thesupportrequirementsofexternalbeamradiotherapy, followed underlying physics, radiobiology, and technology involved. The ensuing sections physics andbiology. Thefirstthreepartspresentthefundamentalsof covers alltheoreticalandpracticalaspectsofradiotherapy latest imagingandtreatmentmodalities,thishandbook From background physicsand biological models to the P. Mayles,A.Nahum,andJ.C.Rosenwald Edited by andPractice Theory Radiotherapy Physics Handbook of Suggested Price: October 2013,8-1/2x11,886pp. eBook ISBN:978-1-4398-8470-6 Print ISBN:978-1-4398-8469-0 applications ofphototherapyinclinicalpractice. human diseasescaused by light,the rationale for photoprotection,and major of light, known collectively as phototherapies. It facilitates understanding of andfundamentalsofphotomedicinetodiversetherapeuticapplications history of light in healthcare and medical science. The book progresses logically from the to givereadersacompleteaccountoftheapplication gathers togetheralargeteamofinternationalexperts coverage ofthisexcitingbiomedicalfield,handbook Providing themostcomprehensive,up-to-date Photomedicine, MassachusettsGeneralHospital,Boston,USA MedicalSchoolandWellmanHarvard Centerfor Michael R.HamblinandYing-Ying Huang Edited by Handbook ofPhotomedicine Suggested Price: May 2015,8x10,300pp.,Pack-BookandEbook Print ISBN:978-1-4398-9874-1 qualifying courseadoption. as wellwhatinformationeachcanobtain.Figureslidesareavailableupon applications. Readersgainasolidunderstandingofhoweachmodalityworks integrating didacticmaterialwithanimalstudiesandhumanmolecularimaging resonance, ultrasonic,andx-raycomputertomographicimagingmodalities, scientist, thetextextendsitscoverageequallyacrossoptical,nuclear, magnetic needsofthenewbreedimaging Designed tomeettheinterdisciplinary for basic,preclinical,andclinicalbiomedicalresearch. to non-invasive,invivoimagingtechnologiesastools This bookisthefirsttoofferanauthoritativeintroduction Simon R.Cherry, RamseyD.Badawi,andJinyiQi Edited by Biomedical Imaging Essentials ofInVivo Textbook $375.00 /£239.00 $209.95 /£134.00 $99.95 /£63.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

manual andfigureslidesareavailableuponqualifyingcourseadoption. book alsoincludesnewmodalitiessuch as ultrasound,andmore.A solutions imaging systems,imagesegmentationmethods,anddeformationmodels.The image registration.Substantialupdateshavebeengiventochaptersonmedical added inmorphologicaloperations,validationofimageanalysismethods,and Textbook Suggested Price: August 2013,8-1/2x11,286pp. eBook ISBN:978-1-4398-3018-5 Print ISBN:978-1-4398-3017-8 assessment. these toolsareusedinradiationplanning,treatmentdelivery, andoutcomes segmentation, reconstruction,andevaluationofimagingdata.Itdescribeshow to-date, detailedtreatmentoftechniquesandalgorithmsfortheregistration, efficiently andaccuratelyinaclinicalenvironment.Thisbookpresentsanup- radiation therapists,andtraineestointegratesegmenttheseimages requiring medicalphysicists,clinicians,dosimetrists, radiotherapy processinthepasttwodecades,thus instrumentation havebecomecentraltothe Images fromCT, MRI,PET, andothermedical University ofMichigan,AnnArbor, USA Kristy K.Brock Edited by in RadiationTherapy Image Processing Suggested Price: September 2013,8-1/2x11,329pp. eBook ISBN:978-1-4398-2583-9 Print ISBN:978-1-4398-2582-2 more effectiveandprocessesefficient. resultstomedical images—canbefullyexploitedtomaketreatments laboratory applied toradiationoncology. Theresult isthatallthedatagathered—from of currentandemerginginformationtechnologyinformaticsprinciples information relates to other patient data. The book deepens readers’ knowledge imaging informationisrepresented,stored,andretrievedaswellhow this principles totheprocesseswithinradiotherapy. Itexploreshowtreatmentand This bookdiscussesthebenefitsofapplyinginformatics University ofIowaCollegeMedicine,City, USA R. AlfredoC.Siochi Houston, USA University ofTexas MD AndersonCancerCenter, George Starkschall Edited by Radiation Oncology Informatics in Suggested Price: June 2015,7x10,475pp. Print ISBN:978-1-4822-3246-2 of MATLAB undergraduate text in biomedical image processing with a strong incorporation This isasubstantialrevisionofwell-received and PrasannaK.Sahoo Omer Demirkaya,MusaH.Asyali, Second Edition Applications inMedicineandBiology, MATLAB Image Processingwith ® . Each chapter has been revised and updated with new chapters . Eachchapterhasbeenrevisedandupdatedwithnewchapters ® $132.95 /£85.00 $157.95 /£99.00 $99.95 /£63.99

47 Medical Physics Magnetic Resonance Imaging Modern Diagnostic The Basics X-Ray Sources Christakis Constantinides Technology, Manufacturing, Reliability University of Cyprus, Nicosia Rolf Behling Based on courses taught at The Johns Hopkins University, Philips Medical Systems DMC GmbH, Hamburg, Germany this text provides a solid introduction to MRI technology. The performance of X-ray sources (tubes) is an essential After an overview of magnetic resonance and Fourier component for assuring the quality of diagnostics transformations, it examines the principles of physics in clinical practice. This book gives a state of the art for nuclear magnetic resonance (NMR) signal formation summary of X-ray tube design for applications in modern diagnostic medical and image construction. It explains the mathematical formulation of MRI and imaging. It covers design concepts, tube types, materials and processes, discusses image quantitative indices. Additional topics include hardware and manufacturing technologies, applications in different modalities, systems electronics of an MRI scanner, magnetic fields, and NMR spectroscopy and interfacing, quality assurance, standards, failure detection and repair, and cost spectral acquisition and imaging techniques. The final section explores advanced aspects. imaging techniques. The book is enriched by numerous worked examples and

Medical Physics problem sets with selected solutions. Figure slides are available upon qualifying Print ISBN: 978-1-4822-4132-7 course adoption. June 2015, 6-1/8 x 9-1/4, 250 pp. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4822-1731-5 eBook ISBN: 978-1-4822-1733-9 March 2014, 7 x 10, 235 pp., Soft Cover Suggested Price: $69.95 / £44.99 Monte Carlo Techniques in Radiation Therapy Edited by Medical Equipment Management Joao Seco Keith Willson, Keith Ison, and Slavik Tabakov Massachusetts General Hospital, Boston, USA Series in Medical Physics and Biomedical Engineering Frank Verhaegen Maastro Clinic, Maastricht, Netherlands As medical technology in clinical care becomes more complex, clinical professionals and support staff must This book explores the use of Monte Carlo methods know how to keep patients safe and equipment working for modeling various features of internal and external in the clinical environment. Accessible to all healthcare radiation sources. It addresses applications of the Monte Carlo particle transport professionals and managers, this book presents an simulation technique in radiation therapy, mainly focusing on external beam integrated approach to managing medical equipment in radiotherapy and brachytherapy. Along with presenting mathematical and healthcare organizations. It explains the underlying principles and requirements technical aspects of the methods, the book discusses the modeling of medical and raises awareness of what needs to be done and what questions to ask. The linacs and other irradiation devices; issues specific to electron, photon, and book also provides practical advice and refers readers to appropriate legislation proton ion beams and brachytherapy; and the optimization of treatment and guidelines. planning, radiation dosimetry, and quality assurance. Print ISBN: 978-1-4200-9958-4 Print ISBN: 978-1-4665-0792-0 eBook ISBN: 978-1-4200-9959-1 eBook ISBN: 978-1-4665-0794-4 48 December 2013, 6-1/8 x 9-1/4, 344 pp. March 2013, 8-1/2 x 11, 342 pp. Suggested Price: $83.95 / £53.99 Suggested Price: $157.95 / £99.00

Medical Imaging Nanomedicine Technology and Applications A Soft Matter Perspective Edited by Edited by Troy Farncombe Dipanjan Pan McMaster University, Hamilton, Ontario, Canada This book provides a broad introduction to soft matters Krzysztof Iniewski for nanomedicinal applications, with a deeper discussion of CMOS Emerging Technologies Research, Inc., Vancouver, British Columbia, Canada the individual modalities for molecular imaging. It includes Series: Devices, Circuits, and Systems a general introduction to the opportunities provided by this technology in chemistry, materials, biology and The book has two intentions. First, it assembles the latest research in the field of nanomedicine. It is designed and written with the perspective that anyone, with medical imaging technology in one place. Detailed descriptions of current state- or without previous knowledge of nanotechnology, would benefit. of-the-art medical imaging systems (comprised of x-ray CT, MRI, ultrasound, and nuclear medicine) and data processing techniques are discussed. Information Print ISBN: 978-1-4665-7282-9 is provided that will give interested engineers and scientists a solid foundation eBook ISBN: 978-1-4665-7283-6 from which to build with additional resources. Secondly, it exposes the reader to July 2014, 6-1/8 x 9-1/4, 203 pp. myriad applications that medical imaging technology has enabled. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4665-8262-0 eBook ISBN: 978-1-4665-8263-7 October 2013, 6-1/8 x 9-1/4, 732 pp. Suggested Price: $157.95 / £99.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,296 pp. Print ISBN:978-1-4822-6103-5 based molecularPAT. combinations ofPAT/PAM withotherimagingmethods,andcontrast-agents- quantitative PAT, array-based PAT systems, photoacoustic microscopy (PAM), the technology’s clinicaluses. Thebookalsodiscussesadvancedmethodsfor effect, imagereconstructionmethods,instrumentation,andanimalstudies to aspectofPAT,every onphotoacoustic fromthetheory Written inatutorialformat,thetextaddressesnearly photoacoustic tomography(PAT) inasystematicmanner. the underlyingprinciplesandpracticalapplicationsof and leadingexpert,thisfirst-of-its-kindbookcovers Presenting theresearch ofawell-respectedpioneer University ofFlorida,Gainesville,USA Huabei Jiang Photoacoustic Tomography Suggested Price: April 2013,7x10,374pp. eBook ISBN:978-1-4200-8510-5 Print ISBN:978-1-4200-8509-9 well asthetoleranceoforganstovariousdosesradiation. disease, describestreatmentplanninganddelivery, latenteffectsas andsurveys ofthe presents disease-specificchapters.Eachoneprovidesaclinicaloverview of intensity-modulatedradiationtherapy(IMRT)inchildren.Thesecondsection malignanciesandaddressestheuse literature onradiation-inducedsecondary Itreviewsthe pediatric cancerincidenceandsurvival. The firstsectionofthebookdiscussesstatistics accurately plananddeliverradiationtherapytochildren. This bookisdesignedtohelphealthcareproviders California, USA Radiation OncologyProgram,Children’s HospitalLosAngeles, Arthur J.Olch and Treatment Pediatric RadiotherapyPlanning Suggested Price: December 2014,7x10,322pp. Print ISBN:978-1-4665-5283-8 the appendix. threatening cardiac arrhythmia. Codes for numerical simulation are provided in schemes foreliminatingpatternsfromanexcitablemedium,suchaslife- heterogeneities inthesystem.Thebookalsodiscusseslow-amplitudecontrol it explores the impact of pattern dynamics on the structural and functional media models.Usingexamplesofmanyreal-lifesystems, in nonlinearbiologicalsystemsdescribedbyexcitable fieldofdynamicsandcontrolpatterns interdisciplinary This bookcoversrecentdevelopmentsinthe S. Sridhar Institue ofMathematicalSciences,Chennai,India Sitabhra Sinha Genesis, Dynamics,andControl Patterns inExcitableMedia $139.95 /£89.00 $157.95 /£99.00 $89.95 /£57.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Also Available inSoftCover Suggested Price: August 2011,7x10,720pp. eBook ISBN:978-1-4398-9640-2 Print ISBN:978-1-4200-8315-6 choice questions,extensivereferences,andfurtherreadingaidinunderstanding. resolution, dualenergyapplications,andconebeamCT. Exercises, multiple analogue anddigitalimagescoversmulti-sliceCTthree-dimensional radiology.and interventional Italsoemphasizesthedifferencesbetween patients, andspecialradiographictechniques,includingsubtractiontechniques PACS aswellnewmaterialondigitalreceptors,radiationdosesandrisksto various imagingtechniqueswork.ThiseditionincludesnewchaptersonPETand Fully revisedandupdated,thisbestsellingtexthelpsreadersunderstandhow Series: SeriesinMedicalPhysicsandBiomedicalEngineering UK Aberdeen RadiationProtectionServices, B. Heaton Addenbrookes NHSTrust, Cambridge,UK P.P. Dendy Third Edition Physics forDiagnosticRadiology Textbook Suggested Price: July 2014,6x9,266pp. eBook ISBN:978-981-4364-80-5 Print ISBN:978-981-4364-79-9 source andthepropertiesofbeamattargetlevel. The authorfocusesonthedirectlinkbetweenoperatingconditionsof the ofelectron beamequipment? and Howdoitspropertiesaffecttheperformance What istheSchottkyelectronemitter?Howdoesitwork? main questionsthatwillbeaddressedinthisbookare practical aspectsoftheSchottkyelectronemitter. The This bookcomprehensivelycoversthetheoreticaland Merijntje Bronsgeest andOptimumOperation Theory Electron Sources Physics ofSchottky Suggested Price: June 2015,8-1/2x11,500pp. Print ISBN:978-1-4665-6013-0 in pre-clinicalimagingusingPETandSPECT. also discussesinstrumentationformultimodalityimagingandtechnologiesused corrections to the datatoproduce quantitative images,and dynamic imaging.It of producingquantitativeimages,suchastechniquesforimagereconstruction, SPECT, followedbyasectionondetectortechnology. Itaddressesvariousaspects clinician’s perspectives.ItbeginswithanintroductiontobasicphysicsofPETand an integrativeapproach,bridgingtheresearcher and instrumentation andmultimodalityimaging.Ittakes This textprovidescoverageofPETandSPECT California, USA David GeffenSchoolofMedicineatUCLA,LosAngeles, Magnus Dahlbom Edited by Imaging Physics ofPETandSPECT $87.95 /£55.99 $149.95 /£95.00 $159.95 /£99.00

49 Medical Physics Quantifying Morphology Stereotactic Radiosurgery and Physiology of the and Stereotactic Body Human Body Using MRI Radiation Therapy Edited by Edited by L. Tugan Muftuler Stanley H. Benedict, David J. Schlesinger, Department of Neurosurgery, Medical College of Wisconsin, Steven J. Goetsch, and Brian D. Kavanagh Milwaukee, USA Series in Medical Physics and Biomedical Engineering Detailing multi-modality image co-registration and radiobiology, this book discusses state-of-the-art This book delivers an indispensable reference for readers strategies for patient simulation and immobilization, treatment planning, and who would like to explore in vivo MRI techniques to quantify changes in the dose calculation algorithms in stereotactic radiosurgery (SRS) and stereotactic morphology and physiology of tissues caused by various disease mechanisms. It radiotherapy (SRT). It presents a comprehensive treatment of the field’s history, presents a wide range of quantitative MRI techniques to study the morphology major technological developments, clinical status, and practical considerations. and physiology of the whole body, from the brain to musculoskeletal systems. The three main sections of the book cover delivery systems, precision patient With internationally renowned experts sharing their insight on the latest

Medical Physics positioning and immobilization, and treatment planning and dosimetry. The final developments, the book goes beyond conventional MRI contrast mechanisms section gives an overview of clinical outcomes and future directions for the field. to include new techniques that measure electromagnetic and mechanical properties of tissues. Print ISBN: 978-1-4398-4197-6 eBook ISBN: 978-1-4398-4198-3 Print ISBN: 978-1-4398-5265-1 August 2014, 7 x 10, 418 pp. eBook ISBN: 978-1-4398-5268-2 Suggested Price: $159.95 / £99.00 May 2013, 6-1/8 x 9-1/4, 525 pp. Suggested Price: $177.95 / £113.00

Surface Imaging for Radiosensitizers and Biomedical Applications Radiochemotherapy in Edited by the Treatment of Cancer Ahmad Fadzil Mohamad Hani Shirley Lehnert Universiti Teknologi Petronas, Perak, Malaysia McGill University, Montreal, Quebec, Canada A range of medical imaging devices can be used to Series in Medical Physics and Biomedical Engineering diagnose skin abnormalities and related diseases as well Discussing the combined use of chemicals and radiation as for interventional and non-invasive procedures. This in the treatments of cancer, this book gathers into a book focuses on the various aspects of medical imaging single volume the most up-to-date information on radio sensitizing drugs, the devices and techniques including processing and pattern recognition. The book mechanisms of radio sensitization, and the clinical applications of this treatment is structured in a reader-friendly fashion, with chapters designed according to modality. Written for radiation oncologists, medical oncologists, and residents in the various measurement parameters related to surface imaging such as skin various branches of oncology, this text details a range of approaches, agents, and coloring, thickness, roughness, and body surface. treatment pathways. Intuitively organized by topic and application, it includes Print ISBN: 978-1-4822-1578-6 the latest clinical trials, extensive illustrations, and a wealth of references. eBook ISBN: 978-1-4822-1579-3 50 Print ISBN: 978-1-4398-2902-8 June 2014, 6-1/8 x 9-1/4, 333 pp. December 2014, 6-1/8 x 9-1/4, 516 pp. Suggested Price: $159.95 / £99.00 Suggested Price: $159.95 / £99.00

Textbook Targeted Muscle Reinnervation Statistical Computing A Neural Interface for Artificial Limbs in Nuclear Imaging Edited by Arkadiusz Sitek Todd A. Kuiken, Aimee E. Schultz Feuser, Massachusetts General Hospital, Harvard Medical School, and Ann K. Barlow Boston, USA Series in Medical Physics and Biomedical Engineering Series in Medical Physics and Biomedical Engineering, 32 Targeted muscle reinnervation (TMR) is a new approach to Designed for advanced undergraduate and graduate accessing motor control signals from peripheral nerves after students in biomedical engineering and medical physics, amputation and providing sensory feedback to prosthesis this self-contained, classroom-tested book presents computing methods for users. This practical approach has many advantages over other neural-machine medical imaging, particularly image reconstruction and visualization. Taking interfaces for the improved control of artificial limbs. With contributions from a practical, hands-on approach, the author emphasizes high performance renowned leaders in the field, including the developers of the technology, this computing applications to imaging, includes a range of programming codes, book provides a template for the clinical implementation of TMR and a powerful and offers coverage of the latest computing techniques. Java codes and a C/ resource for further research in this new area of science. C++ library are downloadable for students to use with the projects in the book as well as their own applications. Figure slides are available upon qualifying course Print ISBN: 978-1-4398-6080-9 adoption. eBook ISBN: 978-1-4398-6081-6 July 2013, 6-1/8 x 9-1/4, 225 pp. Print ISBN: 978-1-4398-4934-7 Suggested Price: $157.95 / £99.00 December 2014, 6-1/8 x 9-1/4, 279 pp. Suggested Price: $119.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,8-1/2x11,450pp. Print ISBN:978-1-4398-6628-3 in image-guidedinterventions. discusses diagnosticapplicationsandthe lastpartlooksattheuseofultrasound deals withtransducers,beamformers,andimagingsystems.Thesecondsection agents, andultrasound-guidedbiopsytherapy. Thefirstpartofthebook developments intissuecharacterization,Dopplertechniques,ultrasoundcontrast transducers and beam formers for use in 2D, 3D and 4D ultrasound as well as ultrasound-based therapy. Itcoversthebackgroundontechnologyof and for diagnosiswithimage-guidedinterventions This bookdiscussestheuseofultrasoundimaging The UniversityofWestern Ontario, London,Canada James C.Lacefield Robarts Research Institute, London,Ontario,Canada Aaron Fenster Edited by and Therapy Ultrasound Imaging Suggested Price: March 2014,8-1/2x11, 257pp. eBook ISBN:978-1-4398-7871-2 Print ISBN:978-1-4398-7870-5 totailortheirtomosynthesissystemsfornewclinicalapplications. necessary depth understandingoftheprocessimageformationandpracticaltools design and image reconstruction strategies. It provides readers with an in- aspects andclinicalapplicationsoffersdetaileddiscussionsofsystem improved visualizationofcomplexanatomicstructures.Thetextcoverstechnical dimensional x-rayimagingtechniquethatprovides of tomosynthesis, a new quasi-three- overview This cutting-edgebookpresentsacomprehensive The UniversityofMassachusetts,Worcester, USA Stephen Glick The UniversityofChicago,Illinois,USA Ingrid Reiser Edited by Tomosynthesis Imaging Suggested Price: December 2014,7x10,617pp. Print ISBN:978-1-4398-0847-4 processers, displays,andimagingtechniques. imaging modalities, and data analysis, the book covers sensors, amplifiers, signal mechanical, andchemicalengineeringaspectsofinstrumentdesignuse, board ofthejournalPhysiological Measurement . Focusingontheelectrical, single volumesinthefieldandoffersreviewsdiscussionsfromeditorial of thehighlyrespectedJohnG.Webster. Itrepresentsoneofthefirstmajor handbook drawsoncontributionsfromleadersinthefieldundereditorship in arangeofdisciplines,thiscomprehensiveyetaccessible measurement andvisualizationofphysiologicalstructures Providing baselineinformationonthequantitative Series inMedicalPhysicsandBiomedicalEngineering University ofWisconsin-Madison, USA John G.Webster Edited by Handbook The PhysiologicalMeasurement $149.95 /£95.00 $169.95 /£108.00 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com Suggested Price: June 2012,7x10,864pp. eBook ISBN:978-1-4200-1241-5 Print ISBN:978-0-7503-0573-0 on medicalimageprocessingandmultimodalityimaging. Along withmanynewexamplesandfigures,thiseditionincludeschapters the-art detectortechnologyandcomputerprocessingusedinmedicalimaging. application acrossallthemodalitiesofmedicalimaging.Itnowcoversstate-of- the basicphysics,moderntechnology, andup-to-dateexamplesofclinical developments intoonevolume,thiscomprehensivesecondeditionpresents applications ofmedicalimaginghavechangedsignificantly. Gatheringthese Since the publication of the best-selling first edition, the technology and clinical Series inMedicalPhysicsandBiomedicalEngineering Foundation Trust, UK Institute ofCancerResearch/Royal MarsdenNHS M AFlower Edited by Second Edition Medical Imaging Webb’s Physicsof Textbook Suggested Price: December 2013,6-1/8 x9-1/4,278pp. eBook ISBN:978-1-4665-5312-5 Print ISBN:978-1-4665-5310-1 course adoption. seamlessly integratedwiththeory. Figureslidesareavailableuponqualifying learned viaexperimentsasfundamental research toolsand applications are techniquesare without priorbackgroundinthefield. Principlesandlaboratory of colloidscience.Itisaimedatundergraduate studentsorgraduate applications techniques forthepreparationofnanoparticlesaswelleveryday through experimentsunderliningthefundamentalprinciples.Itincludes science help studentsunderstandthebasicprinciplesofcolloidandinterface integrating chemistry, physics,andbiology. bookisdesignedto Thislaboratory subject, sciencehasbecomeatrulyinterdisciplinary Colloid andinterface Rensselaer PolytechnicInstitute,Troy, NewYork, USA Deniz Rende Yeditepe University, Istanbul,Turkey Seyda Bucak of theNanoWorld GuideforExploration A Laboratory Chemistry Colloid andSurface Textbook Suggested Price: July 2014,7x10,480pp. eBook ISBN:978-1-4665-8239-2 Print ISBN:978-1-4665-8238-5 safety issues. presents various tools and methods used to evaluate the nano toxicity and nano materials andnanosystems.Itcoverstheinteractionsinbiologicalsystems book addressestheissuesrelatedtonanotoxicityandsafetyof nano materials contact are inhalation, dermal absorption, and ingestion. This of thesesystemswith bio systems.Themainroutesof an increasedconcernaboutthesafetyandcompatibility various fieldsasnanomaterialsandsystems,thereis With the advent of nanotechnology and its applications in University ofSouthFloridaCollegePharmacy, Tampa, USA Vijaykumar B.Sutariyaand Yashwant Pathak Edited by Nanomaterials Biointeractions of $97.95 /£56.99 $41.95 /£26.99 $169.95 /£108.00

51 Medical Physics / Nanoscience & Nanotechnology Handbook of Nanoelectrochemistry Personalized Medicine Edited by Advances in Nanotechnology, Michael V. Mirkin Queens College, New York, USA Drug Delivery, and Therapy Shigeru Amemiya Edited by University of Pittsburgh, Pennsylvania, USA

Ioannis S. Vizirianakis This book provides an overview of nanoscale Aristotle University of Thessaloniki, Greece electrochemistry in the context of well-established This book compiles multidisciplinary efforts to concepts and principles of electrochemistry. It presents

Nanoscience & Nanotechnology conceptualize the environment in research and clinical setting that creates the fundamental theory with the emphasis on differences between charge-transfer fertile ground for the practical utility of personalized medicine decisions and and mass-transfer processes on the nanoscale and analogous reactions occurring also enables clinical pharmacogenomics for establishing pharmacotyping in at macroscopic electrochemical interfaces. The rigorous theoretical treatment drug prescription. Its covers innovative drug formulations and nanotheranostics, enables readers to gain an in-depth understanding of nanoelectrochemical molecular imaging and signatures, translational nanomedicine and informatics, systems discussed. The book also covers modern electrochemical tools and stem cell therapy approaches, modeling and predictability of drug response, techniques that enable the fabrication and characterization of electrochemical pharmacogenetics-guided drug prescription, pediatric drug dosing, systems on the nanometer scale. pharmacovigilance and regulatory aspects, ethical and cost-effectiveness issues, Print ISBN: 978-1-4665-6119-9 pharmacogenomics knowledge bases, personal genome sequencing, molecular March 2015, 7 x 10, 872 pp. diagnostics, as well as information-based medicine. Suggested Price: $199.95 / £127.00 Print ISBN: 978-981-4411-19-6 eBook ISBN: 978-981-4411-20-2 February 2014, 6 x 9, 1560 pp. Suggested Price: $700.00 / £445.00 Nanoelectronic Device Applications Handbook Edited by Labs on Chip James E. Morris Principles, Design and Technology Portland State University, Oregon, USA Eugenio Iannone Krzysztof Iniewski Dianax s.r.l. CEO and Founder, Milano, Italy CMOS Emerging Technologies Research, Inc., Vancouver, British Columbia, Canada Series: Devices, Circuits, and Systems Series: Devices, Circuits, and Systems This book provides a complete reference for labs on chip This handbook gives a comprehensive snapshot of the state of the art in in biotechnology, presenting a global view of current nanodevices for nanoelectronics applications. Combining breadth and depth, the research and development. It integrates coverage of book includes 68 chapters on topics that range from nano-scaled CMOS devices technology issues with strong theoretical explanations through developments in nano capacitors. Among the nanodevices covered are of design techniques; describes biochemical elements required to work on labs single electron transistors and other electron tunneling devices, quantum cellular on chip; discusses fabrication, microfluidic, and electronic and optical detection automata, memristors, graphene and carbon nanotube transistors, nanowire techniques; and addresses planar technologies, polymer microfabrication, and transistors, and nanodevices for spintronics. Featuring contributions by world- process scalability to huge volumes. Devoting a chapter to labs on chip for renowned experts, this is an invaluable source of ideas for anyone working in this genetics, this cutting-edge text offers valuable guidance for the design decision- rapidly expanding field. making process. Print ISBN: 978-1-4665-6523-4 52 Print ISBN: 978-1-4665-6072-7 eBook ISBN: 978-1-4665-6524-1 eBook ISBN: 978-1-4665-6073-4 June 2013, 7 x 10, 940 pp. October 2014, 7 x 10, 1178 pp. Suggested Price: $199.95 / £127.00 Suggested Price: $189.95 / £121.00

Textbook Nanomedicine in Drug Delivery Learning Bio-Micro- Edited by Nanotechnology Arun Kumar, Heidi M. Mansour, Adam Friedman, and Eric R. Blough Mel I. Mendelson Loyola Marymount University, Los Angeles, California, USA Recent breakthroughs in nanomedicine are now making it possible to deliver drugs and therapeutic proteins A primary text for undergraduate nanotechnology to local areas of disease or tumors to maximize clinical courses, this book is designed for students who lack a benefit while limiting unwanted side effects. This book cross-disciplinary background and knowledge of micro- gives an overview of aspects of nanomedicine to help and nano-technology. It contains examples, questions, readers design and develop novel drug delivery systems and devices that build and problems divided into three hierarchical learning skills: understanding, on nanoscale technologies. Contributors explore the use of nanoparticles in analyzing, and evaluating the concepts. The author breaks down the boundaries inhalation aerosols, nanodermatology, wound healing, bioimaging, anticancer between biology, chemistry, physics, engineering and ethics by co-mingling drug delivery, ocular drug delivery, and more. They also discuss nanotoxicity and the vocabularies and concepts of these disciplines around bio-applications. safety studies. Copiously illustrated, this text emphasizes biological and biomedical applications and includes a comprehensive chapter on ethics. Ancillaries are available with Print ISBN: 978-1-4665-0616-9 qualifying course adoption. A solutions manual and Figure slides are available eBook ISBN: 978-1-4665-0617-6 upon qualifying course adoption. June 2013, 6-1/8 x 9-1/4, 469 pp. Suggested Price: $167.95 / £107.00 Print ISBN: 978-1-4200-8203-6 eBook ISBN: 978-1-4200-8204-3 January 2013, 7 x 10, 611 pp. Suggested Price: $94.95 / £59.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2014,6-1/8 x9-1/4,408pp. February eBook ISBN:978-1-4665-6428-2 Print ISBN:978-1-4665-6426-8 knowledge forthem. level analog design automation domain. This book presents the foundation researchers andpost-graduatestudentstodevelopresearch careersinthehigh- challenges, andCADtechniquestohandlethem.Secondismotivateyoung physics of MOS transistors, devicemodeling, nano-scale characterization and structured CADapproachesforanalogdesign,desiredknowledgeabout the to traditional analog design professionals the various The objectiveofthisbookistwofold.Firsttointroduce and AmitPatra Soumya Pandit,ChittaranjanMandal, for High-LevelDesign Models andCADTechniques Analog Circuits Nano-scale CMOS Suggested Price: April 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4398-6083-0 This bookcoversalloftheseissues. assembly are the main approaches for building and characterization of NEMS. these nanorobotsmaybedeveloped.Atpresent,nanoroboticmanipulationand be usedforfabricatingfuturenanorobotsaswellthecomponentsfromwhich asboththetoolsto nanorobots, whichareyettoberealized.NEMSwillserve nanorobotic manipulationsystems,nanoelectromechanicalsystems(NEMS),and of nanoroboticsandincludethemanufacturingapplicationtechnologies Nanorobotic systemsemphasizetheengineeringaspect Series: NanomaterialsandtheirApplications Zumikon, Switzerland ETH Zurich,InstituteofRobotics&IntelligentSystems, Bradley J.Nelson Michigan StateUniversity, EastLansing,USA Lixin Dong An Introduction Nanorobotics Suggested Price: 2015,6x9,250pp. February Print ISBN:978-981-4463-16-4 and discussestheimpactofdosageonhealtheffects. radon progeny, explorestheunattachedradonprogenyasanexperimentaltool, area by measuring unattached fraction of the assessment of nanoparticle surface andmeasurementofnanoparticleactivityinthelungs.Itdiscusses spectrometry nanoparticles exposure.Itbeginsbydiscussingradonandhealth.reviews lungs and the effectiveness of respirators in case of area andlocal deposition of nanoparticles in surface an understandingofthemethodsformeasuring This bookuniquelyusesgraphsanddiagramstobuild Lawrence BerkeleyNationalLaboratory, California,USA Lev S.Ruzer Edited by Experiments, MethodsandStrategies Nanoparticles inHumans $139.95 /£89.00 $99.95 /£63.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Technology andApplications Memories Nanoscale Semiconductor Suggested Price: December 2014,6-1/8x9-1/4,266pp. Print ISBN:978-1-4822-3380-3 universities, industrialinstitutions,andgovernment,givingitbroadappeal. for engineers,scientists,andbiologists,thisbookisalsodesignedresearchers, applications andcommercialization of nanoscaleflowtechnology. Areference and challenges innanoscaleflowtechnology. Italsodiscussesthebusiness chemistry, physics, and engineering. It covers futuredirections,opportunities, advances, modeling,applicationsinbiology, medicine, principlesofnanoscaleflow the multidisciplinary been agreatinterestinrecentyears.Thisbookemphasizes Understanding thebehaviorofaflowatnanoscalehas Prairie View A&MUniversity, Houston,Texas, USA Sarhan M.Musa Edited by Advances, Modeling,andApplications Nanoscale Flow Suggested Price: November 2013,6x9,488pp. eBook ISBN:978-1-4822-1426-0 Print ISBN:978-1-926895-59-8 numerous comparisonsofdifferentmethods. atameaningfullevel,andgiving the field,explainingbasicunderlying theory systems. Thisbookisahighqualitytoolforresearchers, of providinganoverview understanding ofthematerialand/orstructuralbehaviornewandadvanced methods tonovelapplicationsofexistinghelpreadersgain an of nanoscienceandcomputationalchemistry. Contributions range fromnew methodologies andimportantapplicationsinthefields This bookprovidesinnovativechapterscoveringnew and A.K.Haghi Andrew G.Mercader, Eduardo A.Castro, Edited by Research Progress Chemistry Nanoscience andComputational Suggested Price: December 2013,6-1/8x9-1/4,448pp. eBook ISBN:978-1-4665-6061-1 Print ISBN:978-1-4665-6060-4 Nanoscale memoriestodayhaveawidespreadapplicationrange. engineers, academicians,research scientists,andseniorgraduatestudents. researchers. Thiswaythe bookhasawidespreadappeal,includingpracticing The book ismeant for advanced graduate research work or for academicians and reader tomyriadapplicationsthatnanoscalememoriestechnologyhasenabled. field ofnanoscalememoriestechnologyinoneplace.Andsecondly, itexposesthe The bookhastwo-foldintentions.Firstlyitassemblesthelatestresearch inthe Series: Devices,Circuits, andSystems Vancouver, BritishColumbia,Canada CMOS EmergingTechnologies Research, Inc., Krzysztof Iniewski Rochester InstituteofTechnology, NewYork, USA Santosh K.Kurinec Edited by $189.95 /£121.00 $149.95 /£95.00 $177.95 /£113.00

53 Nanoscience & Nanotechnology Textbook Nanotechnology Nanotechnology and Human Health Understanding Small Systems, Edited by Third Edition Ineke Malsch Malsch Techno Valuation, Utrecht, Netherlands Ben Rogers, Jesse Adams, and Sumita Pennathur Claude Emond Mechanical and Aerospace Engineering Series Addressing medium- and long-term expectations for This is a substantial revision of one of the first true human health, this book reviews current scientific and primary texts in nanotechnology. The second edition technical developments in nanotechnology for biomedical, Nanoscience & Nanotechnology was a CHOICE Award winner in 2011. Each chapter in the third edition has been agrofood, and environmental applications. This collection of perspectives on the thoroughly revised and updated. It adds a major new chapter on nanomedicine. ethical, legal, and societal implications of bionanotechnology provides unique It maintains the pedagogy along with the glossary. Vetted by a number of insight into contemporary technological developments. Readers with a technical current and previous adopters, this text incorporates their comments in this new background will benefit from the overview of the state-of-the-art research in edition. A solutions manual and figure slides are available upon qualifying course their field, while readers with a social science background will benefit from the adoption. discussion of realistic prospects of nanotechnology. The text also includes a Print ISBN: 978-1-4822-1172-6 glossary as well as extensive end-of-chapter references. eBook ISBN: 978-1-4822-1174-0 October 2014, 7 x 10, 427 pp. Print ISBN: 978-0-8493-8144-7 Suggested Price: $99.95 / £72.99 eBook ISBN: 978-0-8493-8145-4 August 2013, 6-1/8 x 9-1/4, 376 pp. Suggested Price: $145.95 / £93.00 Nanotechnology and Drug Delivery, Volume 1 Nanotechnology for Nanoplatforms in Drug Delivery Sustainable Manufacturing Edited by Edited by José L. Arias David Rickerby University of Granada, Spain Institute for Environment and Sustainability, European Commission Joint Research Centre, Ispra VA, Italy Pharmacotherapy is often limited by the inefficient activity Nanomaterials have the potential to contribute to more and severe toxicity of drug molecules. Nanotechnology sustainable manufacturing through cleaner, less wasteful offers a revolutionary and definitive approach for the efficient delivery of drug production processes and can substitute conventional molecules to non-healthy tissues and cells. This first volume of a series of two materials, leading to savings in raw materials and energy. This book provides volumes analyzes the basics in the development of drug-loaded nanoplatforms, an innovative perspective by establishing connections between the subject the so-called nanomedicines. Special attention is given to physicochemical areas associated with nanotechnology and by bridging academic and engineering, pharmacokinetics, biocompatibility and biodegradability, industrial research. It also covers methods for assessing the sustainability of representative nanoplatforms (based on lipids, polymers, cyclodextrins, metals, nanotechnology-based products and processes using life-cycle analysis, taking carbon, silica, iron oxides, etc.), and advanced nano-engineering strategies for into account material and energy consumption during manufacture, use, and passive, ligand-mediated, and/or stimuli-sensitive drug delivery and release. final disposal and/or recycling. Print ISBN: 978-1-4665-9947-5 Print ISBN: 978-1-4822-1482-6 54 eBook ISBN: 978-1-4665-9948-2 eBook ISBN: 978-1-4822-1483-3 August 2014, 6-1/8 x 9-1/4, 380 pp. June 2014, 6-1/8 x 9-1/4, 306 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $99.95 / £63.99

Nanotechnology and Drug Smart Sensors for Delivery, Volume 2 Industrial Applications Nano-Engineering Strategies and Edited by Nanomedicines against Severe Diseases Krzysztof Iniewski CMOS Emerging Technologies Research, Inc., Edited by Vancouver, British Columbia, Canada Jose L. Arias Series: Devices, Circuits, and Systems University of Granada, Spain The demand for portable and lightweight sensors Volume one of this book series, Nanoplatforms in is relentless in several industries, from consumer Drug Delivery, established the basic aspects in the development of drug- electronics to biomedical engineering to the military. This book brings together loaded nanoplatforms, the so-called nanomedicines or nanodrugs, focusing the latest research in smart sensors technology and exposes the reader to myriad on representative materials and strategies used in their formulation. Taking applications that the technology has enabled. Contributors delve into advanced advantage of the advanced conceptualizations on nanomedicine engineering topics in photonics and optoelectronic, infrared and thermal, magnetic and that were described in volume one, volume two, Nano-Engineering Strategies inductive, sound and ultrasound, and piezoresistive, wireless, and electrical and Nanomedicines against Severe Diseases, analyzes in depth special sensors. Applications include oxygen detection, sensing inside explosions, features related to the formulation of nanoplatforms for oral, dental, topical magnetic field measurements on airplanes, health monitoring, and more. and transdermal, pulmonary and nasal, ocular and otic, vaginal, and brain drug Print ISBN: 978-1-4665-6810-5 delivery and targeting. eBook ISBN: 978-1-4665-6811-2 Print ISBN: 978-1-4822-6271-1 May 2013, 7 x 10, 598 pp. May 2015, 6-1/8 x 9-1/4, 500 pp. Suggested Price: $157.95 / £99.00 Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2014,6-1/8x 9-1/4,261pp. eBook ISBN:978-1-4665-9012-0 Print ISBN:978-1-4665-9011-3 for measurements,detectionmethods, andmore. aspects of THz IC design using Si CMOS devices, including experimental setups commercially availableSiGeHBTdevicesandtheirapplications. Italsodetails the physicsofSiGeheterojunction bipolartransistor(HBT),aswell nanoscale nanowireMOSFETs, simulationmethods,andtheirresults.Itexplores describes SOImultigatenanowireFETs, underpinning andexplainsthetheory imaging devices based onnanodevicesandmaterials, connectivity technologies,discussesTHzsensingand This bookcoversthelatesthigh-speeddatarate Series: Devices,Circuits, andSystems Fraunhofer Institute,Berlin,Germany Jung HanChoi Edited by with THzApplications High-Speed DevicesandCircuits Suggested Price: November 2014,6-1/8x9-1/4,324pp. Print ISBN:978-1-4665-8940-7 applications. stacking,andemerging (TCI),NANDflashmemory explores ThruChipInterface addresses thermalmanagementformultiprocessorsystems-on-chip,and the useofinterposertechnologyandroleThrough-SiliconVias (TSVs), aswellacademia,thetextdiscusses contributions fromexpertsinindustry of3Dsystems.Containing restrict powerdissipationandimproveperformance application ofnovelmaterialsfor3Dsystems,andthethermal challenges to communication schemesfor3Dcircuits andsystems, processes andsimulationtechniques,alternative This bookcovers3Dcircuit andsystemdesign,new Series: Devices,Circuits, andSystems,33 Indian InstituteofTechnology Ropar, Punjab,India Rohit Sharma Edited by and Systems Design of3DIntegratedCircuits Suggested Price: October 2013,6-1/8x9-1/4,259pp. eBook ISBN:978-1-4398-2942-4 Print ISBN:978-1-4398-2941-7 paths inthecircuit. defects (SDDs),whichcancausetimingfailuresonbothcriticalandnon-critical (DfM)-related ruleviolations.Thebookalsoaddressestestingforsmall-delay supply noise,crosstalk,resistiveopens/bridges,anddesign-for-manufacturing This bookcoverscommonproblemsinareassuchasprocessvariations,power andqualityissues. susceptible tomanufacturingdefects,aswellperformance increased complexityandnanometer-sizefeaturesofmodernICsmakethem continuous increaseinthecomplexityofintegratedcircuits (ICs).However, the Advances indesignmethodsandprocesstechnologiesareleadingtoa Series: Devices,Circuits, and Systems Duke University, Durham,NorthCarolina,USA Krishnendu Chakrabarty TSMC Technology Inc.,SanJose,California,USA Sandeep K.Goel Edited by Integrated Circuits in NanoscaleCMOS Testing forSmall-DelayDefects $149.95 /£95.00 $139.95 /£89.00 $157.95 /£99.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

mastering biological,engineering,physical,andtechnologicalfacets. engineering, simulationtools,andcomputationalmethodstoassistreadersin 61 new, 34 revised, and 352 revisited entries, it covers advances in nanoscale methodologies, aswellthelatestinformationonnanotechnologies.Featuring crosses disciplinestoexamineessentialparadigms,principles,theories,and Nanotechnology of Nanoscienceand Dekker Encyclopedia Suggested Price: September 2014,7x10,863pp. eBook ISBN:978-1-4665-1225-2 Print ISBN:978-1-4665-1224-5 demonstrates theroleofnanotechnologyinwatertreatment. of nanotechnologyforwaterpurificationanddesalination.Iteffectively perspective, presenting the latest research and developments in the use fromaglobal for desalination.Thisbookprovidesacomprehensiveoverview media, membranesfordesalinationplants,andfundamentalnewmethods water industry, areafiltration includinghighsurface Nanotechnology isfindingnumeroususesinthe Indian InstituteofTechnology Madras,Chennai,India T. Pradeep The NanoGroup,Inc.,Farmington,Connecticut,USA David E.Reisner Edited by Global Prospects Aquananotechnology Suggested Price: September 2014, 6 x9,278pp. eBook ISBN:978-1-4822-5192-0 Print ISBN:978-1-77188-026-8 adsorbents. process has also been of interest to overcome some of the limitations of the oforganiccompounds.Theactivatedcarbonmodification removal andrecovery adsorption processes usingPC make the adsorption techniqueattractivefor the compounds. Thelowcost,highefficiency, simplicity, andeaseintheupscalingof so farfortheremovalofvariouspollutantsfromwater, wastewater, andorganic porous carbon(PC),CNTs, andcarbonnanostructuresthathavebeenemployed This volumecoversawiderangeofadsorptionactivities Series: AAPResearch NotesonNanoscienceandNanotechnology and MoeinMehdiPourMirMahaleh A. K.Haghi,SabuThomas, Nano-Adsorbents Pore SizeinCarbon-Based Volume One Foundations ofNanotechnology, Suggested Price: March 2014,8-1/2x11, 6290pp. Print ISBN:978-1-4398-9134-6 to cover the field as nootherresource, the seven-volume reference againstwhichallothernanoreferencesaremeasured.Continuing Encyclopedia of Nanoscience and Nanotechnology immediately became the With its original publication, the Dekker Rochester InstituteofTechnology, NewYork, USA Sergey EdwardLyshevski Edited by Third Edition,Seven-Volume Set $149.95 /£95.00 $129.95 /£82.00 $4550.00 /£2850.00

Third Edition

55 Nanotechnology & Mesoscale Physics Foundations of Nanotechnology, Metallic Spintronic Devices Volume 3 Edited by Mechanics of Carbon Nanotubes Xiaobin Wang Avalanche Technology, Fremont, California, USA Saeedeh Rafiei Series: Devices, Circuits, and Systems Technopark, Kerala, India Series: AAP Research Notes on Nanoscience and Nanotechnology This state-of-the-art work addresses both mainstream and emerging metallic spintronic devices. Featuring In this research notes book, the modelling of mechanical contributions from well-known academic and industrial Nanotechnology & Mesoscale Physics properties of CNT/polymer nanocomposites is presented. experts, the book examines the latest metallic spintronic The book begins with the structural and intrinsic mechanical properties of device research, developments, and applications, from magnetic tunneling CNTs and then introduces computational methods that have been applied to junction sensors and spin torque oscillators to spin torque memory and logic. polymer nanocomposites, covering from molecular scale (molecular dynamics, The text aims to equip anyone who is serious about metallic spintronic devices Monte Carlo), microscale (Brownian dynamics, dissipative particle dynamics, with up-to-date design, modeling, and processing knowledge. It can be used lattice Boltzmann, time-dependent Ginzburg–Landau method, dynamic density either by an expert in the field or a graduate student in course curriculum. functional theory method) to mesoscale and macroscale (micromechanics, equivalent-continuum and self-similar approaches, finite element method). Print ISBN: 978-1-4665-8844-8 eBook ISBN: 978-1-4665-8845-5 Print ISBN: 978-1-77188-076-3 August 2014, 6-1/8 x 9-1/4, 273 pp. February 2015, 6 x 9, 302 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $129.95 / £82.00

Nanoscale Liquid Interfaces Wetting, Patterning and Force Microscopy at the Molecular Scale Foundations of Nanotechnology, Edited by Volume 3 Thierry Ondarçuhu Nanoelements Formation and Interaction CEMES-CNRS, Toulouse, France Jean-Pierre Aimé Sabu Thomas, Saeedeh Rafiei, Shima Maghsoodlou, CPMOH, Talance, France and Arezo Afzali Series: AAP Research Notes on Nanoscience and Nanotechnology This book addresses the recent developments in the investigation and manipulation of liquids at the nanoscale. This new field has shown important The collection of topics in this book reflects the diversity breakthroughs on the basic understanding of physical mechanisms involving of recent advances in nanoelements formation and liquid interfaces, which led to applications in nanopatterning. It has also interactions in nanosystems with a broad perspective that is useful for scientists consequences in force microscopy imaging in liquid environment. The book as well as for graduate students and engineers. proposes is a timely review of these various aspects. It is co-authored by 25 Print ISBN: 978-1-77188-028-2 among the most prominent scientists in the field. October 2014, 6 x 9, 420 pp. Print ISBN: 978-981-4316-45-3 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-981-4364-48-5 56 April 2013, 6 x 9, 780 pp. Suggested Price: $179.95 / £114.00

Fundamentals of Picoscience Nanoscale Spectroscopy Edited by with Applications Klaus D. Sattler Edited by University of Hawaii at Manoa, Honolulu, USA Sarhan M. Musa Ushering in the next technological era, this state- Prairie View A&M University, Houston, Texas, USA of-the-art book focuses on the instrumentation This book introduces the key concepts of nanoscale and experiments emerging at the picometer scale. spectroscopy methods used in nanotechnologies in a International scientists and researchers at the forefront manner that is easily digestible for a beginner in the of the field address the key challenges in developing field. It discusses future applications of nanotechnologies new instrumentation and techniques to visualize and measure structures at this in technical industries. It also covers new developments and interdisciplinary sub-nanometer level. The book helps you understand how picoscience is an research in engineering, science, and medicine. An overview of nanoscale extension of nanoscience, determine which experimental technique to use in spectroscopy for nanotechnologies, the book describes the technologies with an your research, and connect basic studies to the development of next-generation emphasis on how they work and on their key benefits. It also serves as a reference picoelectronic devices. for veterans in the field. Print ISBN: 978-1-4665-0509-4 Print ISBN: 978-1-4665-6853-2 eBook ISBN: 978-1-4665-0510-0 eBook ISBN: 978-1-4665-6854-9 September 2013, 8-1/2 x 11, 756 pp. November 2013, 6-1/8 x 9-1/4, 578 pp. Suggested Price: $188.95 / £120.00 Suggested Price: $188.95 / £120.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Silicon Earth Suggested Price: April 2015,6-1/8x9-1/4,350pp. Print ISBN:978-1-4398-2631-7 biodiversity, resource patterns,andecosystemengineering. ecology research, frommodelingwater-limitedplantcommunities tostudiesin ecosystem ecology. Theauthoralsocovers state-of-the-artapplicationsin as applied tospatialaspectsoflandscape,community,formation theory and formation andspatialecology. ofpattern Thebooksuppliesadetailedoverview emerging research fieldthatintegratespattern problems inecology. Itexposesreaderstothenew basic concepts,tools,andapplicationstoimportant and applicationsinecology, thistextintroducesthe Providing anintegrativetreatmentofnonlinearphysics Ben-Gurion University, SedeBoqer, Israel Ehud Meron Ecosystems Nonlinear Physicsof Suggested Price: June 2015,6-1/8x9-1/4,427pp.,SoftCover Print ISBN:978-1-4987-0825-8 chance! DVDs, and digital cameras. Want to know how that iPhone works? Here’s your micro/nano-enabled pieces of technology such as cell phones, flash drives, GPS, “widget deconstruction”chaptersaddresstheinnerworkingsofubiquitous essence ofcivilization.To roundthingsoutforthetechnologicallycurious,special technological revolutionistransformingthevery and nanotechnology, andexploreshowthisnew engineering underpinningsofmicroelectronics This bookintroducesthegeneralscientificand Georgia InstituteofTechnology, Atlanta,USA John D.Cressler Nanotechnology, SecondEdition Introduction toMicroelectronicsand Suggested Price: October 2014,6x9,250pp. Print ISBN:978-981-4463-63-8 nanostructures andphotovoltaics. renowned researchers andexperiencedteachersinthefieldofsemiconductor authors aimtoprovideaneducativebackgroundofthefield.Allare is notintendedtobejustareviewofthemostup-to-dateliterature,but techniques, andfinisheswiththedesigntestingofprototypedevices.It cell principles,technologicalaspects,andnanostructurecharacterization for PV, whichincludesthetheoreticalbackground,presentationofmainsolar ofgroupIVnanostructures for futuredevelopment.Itpresentsausefuloverview researchers aswelltopointoutsomeopenquestionsandpromisingdirections in PV, thisbookaimstoprovideabackgroundstudentsandnewcomer In viewoftheincreasingresearch effortdevotedtonanostructuresapplications Universita’ diCatania,Italy Salvo Mirabella Charles UniversityinPrague,CzechRepublic Jan Valenta Edited by with GroupIVNanostructures Light EnergyHarvesting Photovoltaic Devices Nanotechnology and $89.95 /£57.99 $79.95 /£49.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: 2014,6-1/8x9-1/4,223pp. January eBook ISBN:978-1-4822-2765-9 Print ISBN:978-1-4200-6067-6 qualifying courseadoption. to furtherreading.Asolutionsmanualandfigureslidesareavailableupon compare withmeasurements.Eachchapterincludesproblemsetsandguidance explains howtosimulatethemodelscomputationallyandgeneratedata analytical toolsareusedtodevelopandsolvediscretestochasticmodels.Italso that gobeyondthosefeaturedinexistingbooks.Thistextshowsstudentshow However, thecharacterizationofthesediscretephenomenarequiresmodels mechanisms andasmanifestationsofdiversebehaviors. complex systems,actingbothasunderlyingdriving Discrete phenomenaareanimportantaspectofvarious Graduate StudentSeriesinPhysics and KevinD.Ridley Keith IainHopcraft,EricJakeman, Populations andSeriesofEvents The DynamicsofDiscrete Textbook Suggested Price: June 2013,6-1/8x 9-1/4,430pp. eBook ISBN:978-1-4665-8733-5 Print ISBN:978-1-4665-8731-1 figure slidesareavailableuponqualifying courseadoption. levels of exercises.includes more examples and varying A solutions manual and method ofcharacteristics.Italsoadds achapteronnormedlinearspacesand the material on wavelet theory, measure theory, differential forms, and the andlogictoappendicesremoves numbersystems andsettheory elementary to realanalysis.Offeringamorestreamlinedpresentation,thiseditionmoves ones, providingasmoothtransitionfromlogicandproofs the gapbetweenclassictheoreticaltextsandlessrigorous Back bypopulardemand,thisbest-sellingbookbridges Series: Textbooks inMathematics Washington University, St.Louis,Missouri,USA Steven G.Krantz Third Edition Real AnalysisandFoundations Textbook Suggested Price: March 2013,6-1/8x9-1/4, 420pp. eBook ISBN:978-1-4398-9897-0 Print ISBN:978-1-4398-9892-5 adoption. all nuclidesmentioned.Asolutionsmanualisavailableuponqualifyingcourse additional end-of-chapterproblems.Anewappendixprovidesnucleardatafor proton orneutronemission.Allchaptershavebeenupdatedandcontain sections onnuclearforensics,radiology, gammacameras, and decay through andnuclearreactorsnew material andincludesnewchaptersondosimetry second editionofabestseller, itcontains60percent more concepts tonuclearpowerandmedicalapplications.The andphysics,frombasic introduction tonuclearchemistry textbookprovides a clear and complete This introductory University ofWisconsin–La Crosse,USA Jeff C.Bryan Second Edition Introduction toNuclearScience Textbook $79.95 /£49.99 $104.95 /£66.99 $94.95 /£59.99

57 Nonlinear Physics / Nuclear Physics Computational Methods for Textbook Data Evaluation and Assimilation Physics of Nuclear Radiations Dan Gabriel Cacuci, Ionel Michael Navon, Concepts, Techniques and Applications and Mihaela Ionescu-Bujor Chary Rangacharyulu This self-contained book presents interdisciplinary University of Saskatchewan, Saskatoon, Canada and Nuclear Physics / Particle/High Energy Nelson Mandela African Institute of Science and Technology methods for integrating experimental and computational (NM-AIST), Arusha, Tanzania information in many scientific and engineering areas. It explains how to estimate covariances and confidence This text makes the physics of nuclear radiations accessible intervals from experimental data. It then describes to students with a basic background in physics and algorithms for both unconstrained and constrained minimization of large- mathematics. Rather than convince students one way or the other about the scale systems, such as time-dependent variational data assimilation in weather hazards of nuclear radiations, the text empowers them with tools to calculate prediction. The book also discusses several basic principles of four-dimensional and assess nuclear radiations and their impact. It discusses the meaning behind variational assimilation (4D VAR) and highlights specific difficulties in applying mathematical formulae as well as the areas in which the equations can be applied. 4D VAR to large-scale operational numerical weather prediction models. Coverage includes archeology, health, and medical physics applications. A solutions manual and figure slides are available upon qualifying course adoption. Print ISBN: 978-1-58488-735-5 eBook ISBN: 978-1-58488-736-2 Print ISBN: 978-1-4398-5777-9 August 2013, 6-1/8 x 9-1/4, 373 pp. eBook ISBN: 978-1-4822-2929-5 Suggested Price: $104.95 / £65.99 December 2013, 6-1/8 x 9-1/4, 383 pp. Suggested Price: $104.95 / £66.99

Textbook Measurement and Detection of Radiation At the Root of Things 4th Edition The Subatomic World Nicholas Tsoulfanidis Palash B. Pal University of Nevada, Reno, USA Saha Institute of Nuclear Physics, Calcutta Sheldon Landsberger The book is a journey into the world of elementary The University of Texas, Austin, USA particles which are the basic constituents of all matter This fourth edition reflects recent major developments that have occurred in in the universe, as well as the nature of the interactions radiation detector materials, systems, and applications. It continues to provide between them. It is written in a non-technical way so that the most practical and up-to-date introduction to radiation detector technology, anyone interested about these issues will be able to read it. proper measurement techniques, and analysis of results for engineers and All and all, this is a book that not only helps outsiders understand the subject in scientists using radiation sources. New chapters emphasize the expanded use a non-mathematical manner; it also inspires them to join the exciting endeavor. of radiation detection systems in nuclear non-proliferation, homeland security, It contains many line diagrams to illustrate the ideas and a few mathematical and nuclear medicine. The book also discusses the correct ways to perform equations like E = mc2. measurements following current health physics procedures. A solutions manual Print ISBN: 978-1-4665-9129-5 and figure slides are available upon qualifying course adoption. eBook ISBN: 978-1-4665-9130-1 Print ISBN: 978-1-4822-1549-6 August 2014, 6-1/8 x 9-1/4, 215 pp., Soft Cover 58 February 2015, 8 x 10, 611 pp., Pack - Book and Ebook Suggested Price: $49.95 / £31.99 Suggested Price: $134.95 / £85.00

Monte Carlo Methods for Textbook Particle Transport A Course in Field Theory Alireza Haghighat Pierre van Baal Virginia Polytechnic Institute and State University, Leiden University, The Netherlands Blacksburg, USA Extensively classroom-tested, this textbook provides This book explains the fundamental concepts, issues, and material for an introductory, one-semester field theory limitations of the Monte Carlo method. A practical guide to course for advanced undergraduate or graduate students the method’s application, the text introduces the particle in physics. Based on the author’s course that he has been importance equation and its use for variance reduction, teaching for over 20 years, the text presents complete and describes general and particle-transport-specific variance reduction techniques, detailed coverage of the core ideas and theories in quantum field theory. Ideal for presents particle transport eigenvalue issues and methodologies to address students taking particle physics courses, it could also be used as a supplementary these issues, explores advanced formulations based on the author’s research text for courses on the standard model and applied quantum physics. Figure activities, discusses parallel processing concepts and factors affecting parallel slides are available upon qualifying course adoption. performance, and includes illustrative examples, mathematical derivations, Print ISBN: 978-1-4665-9459-3 computer algorithms, and homework problems. A solutions manual is available eBook ISBN: 978-1-4665-9461-6 upon qualifying course adoption. August 2013, 6-1/8 x 9-1/4, 224 pp. Print ISBN: 978-1-4665-9253-7 Suggested Price: $71.95 / £45.99 December 2014, 6-1/8 x 9-1/4, 272 pp. Suggested Price: $119.95 / £76.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: July 2014,6-1/8x9-1/4,808pp. eBook ISBN:978-1-4822-1700-1 Print ISBN:978-1-4822-1698-1 adoption. of themainideasinvolved.Figureslides areavailableuponqualifyingcourse as scatteringcross-sectionandlifetime. Thebookalsogivesalucidsummary work outvariouspropertiesoffundamentalparticles,such related tothesubject.Itgivesthemcompetence text teachesthebasictechniquesandfundamentaltheories For graduatestudentsunfamiliarwithparticlephysics,this Saha InstituteofNuclearPhysics,Calcutta,India Palash B.Pal of ParticlePhysics Course An Introductory Textbook Suggested Price: November 2014,6-1/8x9-1/4,314pp. Print ISBN:978-0-7503-0263-0 topics, includingaberrationintegralsandanalysisofresonances. single- andmulti-passsystemstheirpropertiesaswellsomeadvanced whenever possiblefromthehistoricalperspective.Itcoverstransfermapsof with essential techniques of production, acceleration, and storage of beams, Training Programme,andothervenues.Itbegins the U.S.ParticleAcceleratorSchool,CERNAcademic Michigan StateUniversity, theonlineVUBeamprogram, engineering, thisbookisbasedonlecturesgivenat undergraduate studentsinphysics,mathematics,and Accessible tobeginninggraduateandupper-division Series inHighEnergyPhysics,CosmologyandGravitation Martin Berz,KyokoMakino,andWeishi Wan An IntroductiontoBeamPhysics Suggested Price: December 2012,6-1/8x9-1/4,960pp. Print ISBN:978-1-4665-1317-4 an instructor’s manualareavailableuponqualifyingcourseadoption. these quantitativepredictionswithexperimentalresults.Asolutionsmanualand practical calculationsofphysicalquantitiesfromfirstprinciples,andcompare For eachtheory, theauthorsdiscussmainconceptualpoints,detailmany the threegaugetheoriesincludedinStandardModelofparticlephysics. and neutrinooscillations.Itoffersanaccessiblepracticalintroductionto substantial newexperimentalresults,especiallyintheareasofCPviolation fundamental introductiontoadvancedparticlephysicswhileincorporating The fourth edition of this bestselling two-volume set continues to provide a Microsoft Research Connections,Redmond,Washington, USA Anthony J.G.Hey UK, andVisiting Scientist,SLACNationalAcceleratorLaboratory, California,USA Professor Emeritus,UniversityofOxford, Ian J.R.Aitchison Two-Volume Set Fourth Edition, Practical Introduction Particle Physics:A Gauge Theoriesin Textbook $79.95 /£49.99 $129.95 /£82.00 $139.95 /£89.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: November 2013,6-1/8x9-1/4,336pp. eBook ISBN:978-1-4665-8178-4 Print ISBN:978-1-4665-8177-7 materials andtheirstructure. usingSAStoexplore,understand,andtailorpropertiesof and crystallographers of theleadersinfield,itisessentialreadingformaterialscientists,physicists, and approachesofSASforthestudydenselypackedsystems.Written byone particle assemblescanbeexploredviaSAS.Thisbookexplainsseveralmodels describing (micro)particlesembeddedinamaterial.Particularly, disordered investigating the whole setof geometric parameters techniquefor Small-angle scattering(SAS)isapowerful Martin LutherUniversity, Halle-Wittenberg, Germany Wilfried Gille (SAS) Applications Small-Angle Scattering Characterization Particle andSystems Suggested Price: December 2013,6-1/8x9-1/4,392 pp. eBook ISBN:978-1-4665-5792-5 Print ISBN:978-1-4665-5788-8 are utilizedformulti-elementfocused ion beams. applications where such compact high densities plasmas such compactplasmas.Finally, itbringsoutanewareaof cutoff oftheplasma.Itthenpresentsproperties by (i)geometricalcutoffofthewaveguideand(ii)density microwave plasmabyovercoming challengesposedboth This bookdiscussesamethodtoproducecompact Sudeep Bhattacharjee and FocusedIonBeams Compact Plasma Suggested Price: May 2014,6-1/8x9-1/4,112pp. eBook ISBN:978-1-4665-8105-0 Print ISBN:978-1-4665-8104-3 a wayaspossible. arespontaneouslybroken.Hediscussesalloftheideasinassimple of thetheory some classicalsymmetriesarebrokenbyanomaliesandhowother indiscussinggaugetheories.Theauthorexplainshow uses constrainttheory books,thisone gauge theories.Unlikemostfieldtheory anomalies, zetafunctionregularization,andanomalous Pauli–Villars regularization,themeasureapproachto in fieldtheory, includingconstrainttheory, generalized This bookshedslightonvariousaspectsofsymmetry Saha InstituteofNuclearPhysics,Calcutta,India P. Mitra Breaking inFieldTheory Symmetries andSymmetry $145.95 /£93.00 $125.95 /£79.99 $79.95 /£49.99

59 Particle/High Energy Physics / Plasma Physics Electrochemical Discharges and Plasma Harmonics Applications in Nanotechnology Edited by Anis Allagui, Rolf Wuthrich, Rashid A. Ganeev and Amel El Messabeb-Ouali Imperial College London, UK The phenomenon of electrochemical discharge is This book compiles and details cutting-edge research growing in importance in applications in synthetic in science and medicine from the interdisciplinary team chemistry, wastewater treatment, surface engineering, of the Michigan Nanotechnology Institute for Medicine micro-precision machining, and most recently the and Biological Sciences, who are currently revolutionizing drug delivery techniques through the development of Plasma Physics / Quantum synthesis of nanoparticles in which the process has the advantage of versatility, easy application, and cost effectiveness. This book engineered nanodevices. Edited by Istvan J Majoros and James Baker, Jr., two focuses on the use of electrochemical discharges in the analysis and description prominent nanotechnology researchers, this book is design for workers involved of electrochemical systems. in nanotechnology, macromolecular science, cancer therapy, or drug delivery research. Print ISBN: 978-1-4665-0931-3 April 2015, 6-1/8 x 9-1/4, 240 pp. Print ISBN: 978-981-4463-30-0 Suggested Price: $139.95 / £89.00 eBook ISBN: 978-981-4463-31-7 June 2014, 6 x 9, 320 pp. Suggested Price: $149.95 / £95.00

Low Temperature Plasma Technology Methods and Applications Textbook Edited by Plasma Physics Paul K. Chu City University of Hong Kong, Kowloon An Introduction XinPei Lu Richard Fitzpatrick HuaZhong University of Science & Technology, HuBei, China The University of Texas, Austin, USA

This book provides a balanced and thorough treatment of the core principles, Based on the author’s course from the University of Texas novel technology and diagnostics, and state-of-the-art applications of low at Austin, this textbook is designed for an introductory temperature plasmas. It explores related phenomena, such as plasma bullets, course in plasma physics at the advanced undergraduate discharge-mode transition of atmospheric pressure plasmas, and self-organization or graduate level. It covers applied areas, such as space and of microdischarges, and describes relevant technology and diagnostics, including laboratory plasmas, as well as some advanced topics. Unlike other introductory nanosecond pulsed discharge, cavity ringdown spectroscopy, and laser-induced texts in the field, this one is driven by the physics and provides students with fluorescence measurement. The authors also discuss how low temperature a strong foundation to take higher level courses in plasma physics. A solutions plasmas are used in the synthesis of nanomaterials, environmental applications, manual and figure slides are available upon qualifying course adoption. the treatment of biomaterials, and plasma medicine. Print ISBN: 978-1-4665-9426-5 Print ISBN: 978-1-4665-0990-0 eBook ISBN: 978-1-4665-9428-9 eBook ISBN: 978-1-4665-0991-7 August 2014, 6-1/8 x 9-1/4, 293 pp. July 2013, 7 x 10, 493 pp. Suggested Price: $79.95 / £44.99 60 Suggested Price: $157.95 / £99.00

Plasma Electronics, Beyond Quantum Second Edition Edited by Applications in Microelectronic Andrei Khrennikov Linnaeus University, Sweden Device Fabrication The present wave of interest in quantum foundations Toshiaki Makabe is caused by the tremendous development of Keio University, Minato-ku, Tokyo, Japan quantum information science and its applications to Zoran Lj. Petrovic quantum computing and quantum communication. University of Belgrade, Zemun, Serbia It has become clear that some of the difficulties Emphasizing computational algorithms and techniques, this updated edition encountered in realizations of quantum information processing have roots at of a popular monograph provides a complete picture of plasma physics, the very fundamental level. To solve such problems, quantum theory has to be computational methods, cutting-edge applications, and processing techniques. reconsidered. This book is devoted to the analysis of the probabilistic structure Reflecting the growing importance of computer-aided approaches to plasma of quantum theory, probing the limits of classical probabilistic representation of analysis and synthesis, it showcases recent advances in fabrication from micro- quantum phenomena. and nano-electronics, MEMS/NEMS, and the biological sciences. This edition Print ISBN: 978-981-4411-73-8 reflects recent progress in the quantitative understanding of non-equilibrium eBook ISBN: 978-981-4411-74-5 low-temperature plasma, surface processing, and predictive modeling of the April 2014, 6 x 9, 392 pp. plasma and the process. Suggested Price: $149.95 / £95.00 Print ISBN: 978-1-4822-2205-0 eBook ISBN: 978-1-4822-2210-4 August 2014, 6-1/8 x 9-1/4, 412 pp. Suggested Price: $179.95 / £114.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2013,6-1/8x9-1/4,340pp. eBook ISBN:978-1-4665-1796-7 Print ISBN:978-1-4665-1791-2 and figureslidesareavailableuponqualifying courseadoption. references, exercises, andproblemswithdetailedsolutions.A solutions manual brief biographiesofkeyplayersinthe field,eachchapterincludesexamples, advanced textsandjournalpapers.Alongwiththought-provokingcartoons and field, itpreparesreadersforfurtherstudyandhelpsthemunderstand more communication. Exploringrecentdevelopmentsandopenquestionsin the book givesaclear, self-containedintroduction toquantumcomputationand beginners or not complete enough. Filling the gap, this information theory, mostareeithertootechnicalfor While therearemanyavailabletextbooksonquantum Anirban Pathak Quantum Communication Computation and Elements ofQuantum Textbook Suggested Price: December 2013,7x10,388pp. eBook ISBN:978-1-4665-5630-0 Print ISBN:978-1-4665-5628-7 upon qualifyingcourseadoption. quantization pathintegrals.Asolutionsmanualandfigureslidesareavailable beintimidatingtobeginners,suchas“second” topics thatwouldotherwise relativistic level.Inanin-depthyetaccessibleway, theauthorpresentsmany them develop analytical skillsrelatedto classical and quantum fields atthe non- through numerous problems, helping think about the concepts and theory to formulateandsolveproblemsoftheirown.Studentsareencouraged withthegoalofenablingstudents approach, theauthordevelopstheory to low-energysituations.Taking aproblem-oriented This textfocusesonnon-relativisticphysicsapplicable Indian InstituteofTechnology, Guwahati,India Girish S.Setlur An Introduction and QuantumFields Dynamics ofClassical Textbook Suggested Price: September 2013,6x9,355pp. eBook ISBN:978-1-4665-6877-8 Print ISBN:978-1-926895-29-1 quantum chemistry. The second part of the book covers a range of new research on computational molecules andpatterns,includingthehydrocarbonsallotropesofcarbon. edifice, aswellachemicaltopologyschemethatsuccessfullydescribes emergence ofasynthetic,analytical,andtheoreticalspiroquantumchemistry coversthetechnicalpresentationofideassurrounding quantum theory to exoticcarbonallotropesandspiroquantumtheory. Thesectiononspiro quantum chemistry, alongwithaspecialsectiondevoted This book covers a range of new research on computational and EduardoA.Castro Tanmoy Chakraborty, MichaelJ.Bucknum, Edited by Developments andApplications Experimental Chemistry Computational and $83.95 /£52.99 $94.95 /£59.99 $119.95 /£76.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

Processing Physics andInformation Introduction toQuantum Suggested Price: March 2015,6x9,250pp. Print ISBN:978-981-4463-82-9 schemes toentangledistantquantumsystemson-chip. studies. Thebookoutlinesthewayformorecomplexdevicesandtorealize recent resultsanddiscussesnewproposalsforfurther experimental fundamentals,thebookpresentsseveral fast-growing field.Afterintroducingthetheoreticaland a comprehensiveintroductionintothisexcitingand Addressing younggraduatestudents,thisbookgives Humbold University, Berlin,Germany Janik Wolters Hybrid Systems Integrated Quantum Suggested Price: December 2013,6x9,164pp. eBook ISBN:978-1-4822-1215-0 Print ISBN:978-1-4822-1214-3 experimentalfindingsisalsoprovided. analysis thatsupportsobserved a varietyofexperimentalmethodsusedintheirstudy. Adetailedtheoretical polaritons andcondensatesinoutofequilibrium,thebookthenconsiders ofthebasicconcepts forexcitons, polariton condensation.Afteranoverview presents indetailthedifferentaspectsoffundamentalimportancerelatedto the at boththeoreticalandexperimentallevel.Thisbook an intenseinteresthasbeenattractedbythisphenomenon polariton condensatesinthewiderscientificcommunity, in thesolidstate2006andestablishmentofexciton After thefirstdemonstrationofBoseEinsteincondensation Stanford University, California,USA Konstantinos Lagoudakis Condensates The PhysicsofExciton-Polariton Suggested Price: April 2015,6-1/8x9-1/4,525pp. Print ISBN:978-1-4822-3811-2 compact summaries,marginnotes,andcitationstooriginalreferences. by examplesandsupplementedexercises andproblems,thebookbears quantum informationprocessinganderrorcorrection.Richlyillustrated applicationsof information contentinqubits,and discusses cryptographic It alsocoversfundamentalquantumalgorithms,describesthenotationof model forcomputation,computationalcomplexity, andreversiblecomputation. mechanics offinitestatesystems.Itexplainsthecircuit linear algebramethodsusedforthequantum mechanics or computer science, this text introduces Assuming nopreviousknowledgeofquantum BITS PilaniKBirla,Zuarinagar, India Radhika Vathsan $179.95 /£114.00 $89.95 /£57.99 $89.95 /£57.99

61 Quantum Physics Textbook Quantum Mechanics II Quantum Mechanics Advanced Topics Fifth Edition S. Rajasekar Bharathidasan University, Tiruchirapalli, India Alastair I. M. Rae Birmingham University, UK R. Velusamy ANJA College, Tamilnadu, India For more than 25 years, Quantum Mechanics has been one of the most highly regarded books in this area. This This book offers a tutorial guide to some of the most fifth edition offers additional worked examples of the cutting edge topics in quantum mechanics, covering application of quantum mechanics principles to a range such areas as quantum field theory, path integral of physical problems, more information on modern quantum information formulation, Berry’s phase, quantum computing, quantum cryptography, and technology, and problems at the end of each chapter. This text was one of quantum optoelectronics. The authors explain the basic principles, key features, the first to include a substantial discussion of the conceptual and philosophical and applications. They cover quantum technologies as well as emerging areas implications of quantum mechanics, which has been revised and extended in including quantum versions of the theory of gravity, teleportation, games,

Quantum Physics the fifth edition. Other topics covered include Schrödinger equations, angular cloning, diffusion, and chaos. Problem sets are provided for each chapter with momentum, time-independent perturbation theory, time dependence, complete solutions at the end of the book and many original figures throughout scattering, and relativity. A solutions manual is available upon qualifying course the text to help the reader visualize important concepts. A solutions manual and adoption. figure slides are available upon qualifying course adoption. Print ISBN: 978-1-58488-970-0 Print ISBN: 978-1-4822-6345-9 eBook ISBN: 978-1-58488-971-7 December 2014, 6-1/8 x 9-1/4, 313 pp. September 2007, 6 x 9, 352 pp., Soft Cover Suggested Price: $129.95 / £82.00 Suggested Price: $79.95 / £33.99

Quantum Mechanics Quantum Optics for Beginners for Thinkers Zbigniew Ficek Gennaro Auletta King Abdulaziz City for Science and Technology, Pontifical Gregorian University, Rome, Italy Riyadh, Saudi Arabia Shang-Yung Wang Mohamed Ridza Wahiddin International Islamic University Malaysia, Kuala Lumpur This book provides quick access to quantum mechanics without dealing with a true textbook that demands proper This graduate-level text discusses from first principles the specialized studies in physics (and related mathematics) background theory of various effects of quantum optics, for about a couple of years. It consists of three parts: introduces students to the main ideas of quantum optics basic formalism, formal development, and ontological issues. The 70 figures are as clearly as possible, and teaches the mathematical a crucial instrument for becoming acquainted in a “representative” way with methods used by researchers working in the fields of quantum and atom optics. abstract problems, and the 30 in-section boxes assist readers understand for It contains numerous valuable derivations and calculations that are often hard to difficult mathematical problems. The book offers a considerable number of clear find in scientific articles and other texts on quantum optics. The book provides a and analytical treatments of what are considered the most difficult conceptual useful starting point for those interested in learning more. problems of the theory. Print ISBN: 978-981-4411-75-2 Print ISBN: 978-981-4411-71-4 eBook ISBN: 978-1-4822-9899-4 62 eBook ISBN: 978-1-4987-0218-8 May 2014, 6 x 9, 350 pp. June 2014, 6 x 9, 500 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $99.95 / £63.99

Textbook Understanding Spin Dynamics Quantum Mechanics I Danuta Kruk The Fundamentals University of Warmia and Mazury in Olsztyn, Poland S. Rajasekar This book concentrates on the theory of spin resonance phenomena and the Bharathidasan University, Tiruchirapalli, India relaxation theory, which have been discussed from first principles to introduce the reader to the language of quantum mechanics used to describe the behaviour of R. Velusamy atomic nuclei and electrons. There is a long way from knowing complex formulae ANJA College, Tamilnadu, India to apply them correctly to describe the studied system. The book shows through Requiring no prior knowledge of the subject, this textbook examples how symbols can be “replaced” in equations by using properties of provides a complete introduction to basic concepts and methods of quantum real systems to formulate descriptions that link the quantities observed in spin mechanics. Fully worked, step-by-step examples and end-of-chapter problem resonance experiments with dynamics and structure of molecules. sets illustrate the application of formalism to physical problems and develop Print ISBN: 978-981-4463-49-2 students’ ability to solve problems. The text addresses core topics, including December 2014, 6 x 9, 400 pp. Schrödinger wave mechanics, the Heisenberg uncertainty principle, and the Suggested Price: $149.95 / £95.00 hydrogen atom, as well as recent theoretical developments and experimental research breakthroughs. A solutions manual and Figure slides are available upon qualifying course adoption. Print ISBN: 978-1-4822-6337-4 December 2014, 6-1/8 x 9-1/4, 613 pp. Suggested Price: $99.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2013,6-1/8x9-1/4,308 pp. eBook ISBN:978-1-4398-9558-0 Print ISBN:978-1-4398-9557-3 diffusion equationsinbiology, andexamines diffusioninthequantumdomain. impact oftranslational/rotationaldiffusion onexperimentaldata,coversreaction- and discusses topics in materials science and metallurgy. He also addresses the and stochasticcalculus He describestheroleofdiffusioninprobabilitytheory together avarietyoftopicsfromphysics,mathematics,chemistry, andbiology. ofdiffusion,expertlyweaving centuries-old history applications. Theauthorexploresthemorethantwo classical andquantumdomains,alongwithnumerous Within aunifyingframework,thisbookcoversboth West Bengal,India Indian InstituteofScienceEducation&Research, Sushanta Dattagupta Formalism andApplications Diffusion Suggested Price: May 2015,6-1/8x9-1/4,450pp. Print ISBN:978-1-4665-8609-3 slides areavailableuponqualifyingcourseadoption. texts inmechanicalandchemicalengineering.Asolutionsmanualfigure topics, whicharetypicallynotcoveredinclassicortraditionalthermodynamics the animalbodyareaconcernofscientists.Thisbookcoversthesekey body areimportanttodieticiansandhealthscienceexperts,applications and secondlawsofthermodynamicstothehuman energy suchasfatandstarch. Applicationsofthefirst This concernstopicssuchasmuscleworkandinternal in thermodynamics as applied to biological systems. Over thepastdecadestherehasbeenincreasinginterest Yeditepe University, Istanbul,Turkey Mustafa OzilgenandEsraSorguvenOner Principles andApplications Biothermodynamics Suggested Price: December 2013,6-1/8x9-1/4,630pp. eBook ISBN:978-1-4398-8729-5 Print ISBN:978-1-4398-8658-8 qualifying courseadoption. and professionalsalike.Asolutionsmanualfigureslidesareavailableupon energyengineeringstudents sets, propertydata,andreferencesthatserve for highlyefficientenergyconversion.Itcontainsexamples,chapterproblem advanced energysystems,thussupplyingastrongtheoreticalbackground the book covers the fundamentals, analysis, design, and practical aspects of Power GenerationTechnology andRenewableEmergingCleanEnergySystems, as wellalternativeenergytechnologies.Organizedintotwoparts:Conventional treatment ofadvancedconventionalpowergenerationandcogenerationplants, This secondeditiontoapopularfirstprovidescomprehensive,fullyupdated Energy Technology Series Kiev, Ukraine Vadym M.Kharchenko Berlin, Germany Institute forEnergyEngineeringoftheTechnical University, Nikolai V. Khartchenko Second Edition Advanced EnergySystems Textbook $94.95 /£59.99 $149.95 /£95.00 $132.95 /£85.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Textbook Suggested Price: May 2014,6x9,448pp. eBook ISBN:978-981-4411-86-8 Print ISBN:978-981-4411-85-1 systems, whichhavenotbeendiscussedinanyotherbook. provide experimentalandtheoreticaldescriptionsofdisordereffectsinCoulomb approaches to elucidate the behavior of strongly charged soft matter. They also modern methodsinstatisticalphysicsofCoulombsystems.Theydetailvarious in thefieldofferadetailedintroductiontodifferent Coulomb (bio)colloidalsystems.Leadingscientists a unifiedview ofthe current advancesof inthe field Filling avoidintheliterature,thisvolumepresents and RudolfPodgornik David S.Dean,JureDobnikar, AliNaji, Edited by and DisorderedMatter Electrostatics ofSoft Suggested Price: April 2015,7x10, 936pp. Print ISBN:978-1-4665-8482-2 plants. Itoutlinesthedevelopment,current use,andfutureofnuclearfission. Stirling engines,advancedfossilfuelpower systems,andcombined-cyclepower power cycle, gas turbines, internal combustion engines, hydraulic turbines, energy resource ofthesteam andtheirequivalence.Itincludesanoverview geothermal, andocean,thenprovides theterminologyandunitsusedforeach biomass includingrefuse-derived fuels,nuclear, solarradiation,wind, available energysources. Itdescribesenergysources suchasfossilfuels, the latest advances in energy conversion from a wide variety of surveys currently Completely revisedandupdated,thissecondedition Mechanical andAerospaceEngineeringSeries University ofColorado,Boulder, USA(retired) Frank Kreith University ofSouthFlorida,Tampa, USA D. Yogi Goswami Edited by Second Edition Energy Conversion Suggested Price: March 2014,6-1/8x9-1/4, 720pp.,SoftCover eBook ISBN:978-1-4398-2646-1 Print ISBN:978-1-4398-2645-4 available uponqualifyingcourseadoption. nuclear energyprogramsintoweaponsproliferation.Figureslidesare climate change, oil prices,renewableand alternative fuels,anddiversionofcivil completely rewritten material, regardingthe last decadein areas includingglobal with energyuseingeneral.Thiseditionofferssimpleupdates,aswell demand, geopoliticsofenergy, andthevariousenvironmentalissuesassociated the developmentofnuclearenergy, energysupplyand medieval times,andtheIndustrialRevolution.Itaddresses from the time of early humans through antiquity, This bookcoversthedevelopmentofenergytechnology The PennsylvaniaStateUniversity, UniversityPark,USA Harold H.Schobert An Introduction,SecondEdition Energy andSociety $149.95 /£95.00 $169.95 /£108.00 $79.95 /£49.99

63 Statistical Physics & Thermodynamics Energy Efficiency and Textbook Renewable Energy Handbook Experimental Combustion Second Edition An Introduction Edited by D. P. Mishra D. Yogi Goswami This book provides an overview of the key aspects of University of South Florida, Tampa, USA combustion—including chemical kinetics, premixed Frank Kreith flame, diffusion flame, and liquid droplet combustion— Statistical Physics & Thermodynamics University of Colorado, Boulder, USA (retired) followed by a discussion of the general elements of Mechanical and Aerospace Engineering Series measurement systems and data acquisition and analysis. Building upon this This book has been a bestselling reference in its first edition; the new second foundation, the text proceeds to address measurements, instruments, analyses, edition represents a thorough updating of the contents to reflect the major and diagnostics specific to experimental combustion. It not only describes trends and technologies in energy engineering. There is added coverage of the construction, working principles, application areas, and limitations of the nuclear energy and its place in energy systems, a chapter on natural gas, and necessary instruments, but also details the procedure for uncertainty analysis extensive coverage of energy storage for various types of energy generation. in practical combustion experiments. A solutions manual and figure slides are Existing chapters have been updated, and the newest data is supplied for available upon qualifying course adoption. reference. Print ISBN: 978-1-4665-1735-6 Print ISBN: 978-1-4665-8508-9 eBook ISBN: 978-1-4665-1737-0 April 2015, 7 x 10 May 2014, 6-1/8 x 9-1/4, 390 pp. Suggested Price: $249.95 / £159.00 Suggested Price: $129.95 / £82.00

Textbook Fuel Cells Energy Management and Principles, Design, and Analysis Conservation Handbook Shripad T. Revankar Second Edition Purdue University, West Lafayette, Indiana Edited by Pradip Majumdar Northern Illinois University, Dekalb, USA D. Yogi Goswami University of South Florida, Tampa, USA Mechanical and Aerospace Engineering Series Frank Kreith This resource combines coverage of the basic principles, analysis, analytical University of Colorado, Boulder, USA (retired) techniques, and design aspects of the fuel cell. It presents fuel cell design at Mechanical and Aerospace Engineering Series component and system levels, and then elaborates on analysis methods for various phenomena associated with components and systems. With its examples, This second edition includes chapters from leading experts on the economics problems, and simulation activities, it makes an excellent graduate text or and fiscal management of energy, with a focus on efficiency and conservation reference for researchers, engineers, and others involved in energy development. measures. The handbook contains updated coverage of energy storage The text guides the reader from foundations and fundamental principles through technologies, energy audits for buildings and building systems, and demand-side analysis methods and fuel cell design. Figure slides are available upon qualifying management. It also provides appendices with fully updated data. course adoption. Print ISBN: 978-1-4665-8516-4 Print ISBN: 978-1-4200-8968-4 64 April 2015, 7 x 10, 440 pp. eBook ISBN: 978-1-4200-8969-1 Suggested Price: $149.95 / £95.00 May 2014, 6-1/8 x 9-1/4, 748 pp. Suggested Price: $129.95 / £82.00

Essentials of Natural Gas Handbook of Hydrogen Energy Microturbines Edited by Valentin A. Boicea S.A. Sherif, D. Yogi Goswami, E.K. (Lee) University Politehnica of Bucharest, Romania Stefanakos, and Aldo Steinfeld Series: Mechanical and Aerospace Engineering Series This book examines several natural gas microturbine technologies suitable for distributed generation and the This text provides the technical know-how for creating a automotive industry; explains the importance of natural hydrogen-based economy in which hydrogen is the main gas microturbines and their use in distributed energy energy carrier along with electricity. It outlines the benefits systems; discusses the history, development, design, and challenges to converting to a hydrogen economy. It and operation of gas microturbines; introduces the Evolutionary Algorithm for details how hydrogen can be produced efficiently, and how to take advantage of pollutant emissions and fuel consumption minimization; analyzes the power it being an abundant and completely renewable fuel. It examines the advantages electronics for grid connection of the natural gas microturbines; and includes and challenges in the areas of hydrogen storage and transportation, and explores power quality measurements—graphical representations and numerical data— ways of efficiently converting it into other forms of energy. from a real system. Readers learn new techniques to improve equipment Print ISBN: 978-1-4200-5447-7 exploitation. eBook ISBN: 978-1-4200-5450-7 Print ISBN: 978-1-4665-9471-5 July 2014, 7 x 10, 1058 pp. eBook ISBN: 978-1-4665-9472-2 Suggested Price: $189.95 / £121.00 December 2013, 6-1/8 x 9-1/4, 250 pp. Suggested Price: $167.95 / £107.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2015,6-1/8x9-1/4,504pp. Print ISBN:978-1-4822-5400-6 of heattransferproblemsinnanofluids. coupling betweennanofluidsandporous media,anduseofsecondlaw-analysis In addition,itemphasizesthespecificinsightsofcurrentapplicationssuch as the couplingofnanofluidswithotherheattransferenhancementmethodologies. innovative methodologiesofanalysis,suchasentropygeneration,anddiscusses offluids.Itintroduces capabilities ofthisnewcategory heat transferinnanofluids.Itexploresthe experienced engineersandscientistsonthetopicof This bookisdesignedasareferencepointfor Nardini, andKambizVafai Vincenzo Bianco,OrnonzioManca,Sergio Edited by with Nanofluids Heat Transfer Enhancement Suggested Price: May 2015,6-1/8x9-1/4,400pp. Print ISBN:978-1-4200-4737-0 issues, andleadtoviablesolutions. features practicalexamplesandproblemsineachchapterthataddressreal-world Applications provides a comprehensive look at refrigeration system design and efficiency regulations,andoperatingcosts.HeatExchangersforRefrigeration engineers mustdesignmoreefficientsystems,toaddressenvironmentalimpacts, are amajorsource ofglobal warming.Inviewofthis,refrigerationequipment plants thatgenerateenergyforrefrigerationsystems production, andelectroniccooling.However, power comfort control, gas liquefaction, food and beverage indoorairquality,and areneededforfoodpreservation, Refrigeration systems are a vital part ofour daily lives Isotherm, Inc.,Arlington,Texas, USA Zahid H.Ayub Refrigeration Applications Heat Exchangersfor Suggested Price: May 2013,7x10,1260pp. eBook ISBN:978-1-4398-4213-3 Print ISBN:978-1-4398-4212-6 fabrication techniques. expanded andupdatedcoverageofmaterialsselection;alookatthenewest material throughout;coverageofthelatestadvancesinHEdesigntechniques; undergraduate andgraduatestudents.Thissecondeditionincludesupdated engineers; processequipmentandpressurevesseldesigners;upper-level making itagreatresource formechanical,chemical,andpetrochemical other industries. It includes over 400 drawings, diagrams, tables, and equations, heatrecovery,transport, airconditioning,refrigeration,cryogenics, energy, and operation andpractical,large-scaleapplicationsinprocess,power, petroleum, aspects ofheatexchangers(HEs):designandmodes This comprehensivereferencecoversalltheimportant Series: MechanicalEngineering Indian Railways,Chennai,India Kuppan Thulukkanam Second Edition Design Handbook Heat Exchanger $159.95 /£99.00 $119.95 /£76.99 $240.00 /£154.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Nuclear EngineeringHandbook Suggested Price: May 2015,7x10,992pp. Print ISBN:978-1-4822-2149-7 solutions manualandfigureslidesareavailableuponqualifyingcourseadoption. A enough tomeettheneedsoffirst-andsecond-yeargraduatestudents. meet theneedsofbothjuniorandseniorundergraduates,butitisadvanced of nuclearscienceandengineering.Thesubjectmatterissufficientlybroadto as wellanyoneseriouslyinterestedinpursuingalong-termcareerthefield covers topicsofinteresttothemodernnuclearengineer not beensignificantlyupdatedoverthelast20years.It nuclearengineeringtextbooksthathave introductory This textprovidesamodernalternativetoother Virginia PolytechnicandStateUniversity, Blacksburg,USA Robert Masterson Fundamentals Nuclear Engineering Textbook Suggested Price: March 2013,8-1/2x11,792pp. eBook ISBN:978-1-4398-6230-8 Print ISBN:978-1-4398-6228-5 principles, applications,andequipment designinonevolume. Written byexpertsinacademiaandindustry, itintegrates fundamentals such asheat transfer, noise, CFD modeling,burner design, andburner testing. petrochemicals, anddieselengines.Thebookalsocoversmorefundamentals, including power generation, fluidized bed combustion, chemicals and size, with 19 new chapters and extensive updates. It describes many applications, oxygen. Thissecondeditionhasmorethandoubledin up-to-date look at how to enhance combustion with A majorupdateofabestseller, thisbookprovides an Series: IndustrialCombustion John ZinkCompany, LLC,Tulsa, Oklahoma,USA Charles E.BaukalJr. Edited by Second Edition Oxygen-Enhanced Combustion Suggested Price: August 2015,7x10,896pp. Print ISBN:978-1-4822-1592-2 applications. Thehandbookexaminesmanyoftheseaspectsinitsfoursections. useful operatinglife.Italsointroducessomeimportantaspectsofradiationandit the decontaminationanddecommissioningofthesefacilitiesatendtheir nuclear reactors,powerplants,fuelcyclefacilities,andfinally which areappliedinthedesign,licensing,construction,andoperationof audience. Itencompassesalltheengineeringdisciplines expansive topic of nuclear engineeringtoan extensive This secondeditionprovidesanintroductiontothe Series: MechanicalandAerospaceEngineeringSeries URS SMSLLC Kenneth D.Kok Edited by Second Edition $159.95 /£99.00 $188.95 /£120.00 $189.95 /£121.00

65 Statistical Physics & Thermodynamics Textbook Quantum Thermodynamic Processes Principles of Solar Engineering Energy and Information Flow at the Nanoscale Third Edition Guenter Mahler ITP1 Universitaet Stuttgart, Germany D. Yogi Goswami University of South Florida, Tampa, USA Why does the world around us typically look thermal—from cosmology down to Thoroughly updated and revised, this book provides individual embedded spins? Is the transition between mechanical and thermal an engineering-based survey of modern solar energy systems gradual or discontinuous? Pertinent examples can be found in various Statistical Physics & Thermodynamics concepts and practical applications. Since publication of processes implemented on small quantum systems. Particularly attractive are the 2nd edition, in 2000, a number of major developments model systems that can be treated thermodynamically, but—to some extent— have taken place in solar energy, which makes it essential to revise the book also exactly, for example based on pure quantum dynamics. This possibility completely. Changes in the energy policies in a number of countries in the world opens the door to nano-thermodynamics. In this sense, the book aims at a have resulted in a rapid growth of solar energy systems deployment in the world. modern perspective of nanoscale applications, defined as a potential realization Solar Photovoltaic systems have grown over the past decade at an average annual of various functions as constrained by given resources. rate of more than 30%. Because of the large investments required for these Print ISBN: 978-981-4463-73-7 systems, accurate knowledge of solar radiation resource has become essential. A November 2014, 6 x 9, 400 pp. solutions manual and figure slides are available upon qualifying course adoption. Suggested Price: $179.95 / £114.00 Print ISBN: 978-1-4665-6378-0 February 2015, 6-1/8 x 9-1/4, 576 pp. Suggested Price: $149.95 / £95.00

Textbook Principles of Sustainable Energy Systems Sodium Fast Reactors Second Edition with Closed Fuel Cycle Baldev Raj, P. Chellapandi, and P.R. Vasudeva Rao Frank Kreith University of Colorado, Boulder, USA (retired) This book covers research and development on the Susan Krumdieck sodium cooled fast reactors. It deals with a wide range Mechanical and Aerospace Engineering Series of topics in the domain of science and technology under topics like design aspects, safety, construction, Completely revised and updated, this second edition of a bestseller presents fuel cycles, and more. broad-based coverage of sustainable energy sources and systems. The book is designed as a text for undergraduate seniors and first-year graduate students. Print ISBN: 978-1-4665-8767-0 It focuses on renewable energy technologies, but also treats current trends April 2015, 7 x 10, 824 pp. such as the expanding use of natural gas from fracking and development of Suggested Price: $199.95 / £127.00 nuclear power. It covers the economics of sustainable energy, both from a traditional monetary as well as from an energy return on energy invested (EROI) perspective. A solutions manual and figure slides are available upon qualifying course adoption. 66 Print ISBN: 978-1-4665-5696-6 eBook ISBN: 978-1-4665-5698-0 August 2013, 7 x 10, 790 pp. Suggested Price: $132.95 / £85.00 The Coen & Hamworthy Combustion Handbook Textbook Fundamentals for Power, The Principles of Marine & Industrial Applications Thermodynamics Edited by Stephen Londerville N.D. Hari Dass Coen Company Inc., San Mateo, California, USA Chennai Mathematical Institute, Siruseri, Tamil Nadu, India Charles E. Baukal Jr. This text presents the conceptual and technical John Zink Company, LLC, Tulsa, Oklahoma, USA developments of the subject without unduly compromising Series: Industrial Combustion on either the historical or logical perspective. It also Sharing the knowledge of top combustion engineers and technologists from the covers the tremendous range of scientifically deep and Coen Company and John Zink Hamworthy Combustion, this unique handbook technologically revolutionary applications of thermodynamics. The text explains provides practical guidance to help you make decisions about fuels, burners, how thermodynamics evolved from a few basic laws that were amazingly and combustion chambers for combustion systems. It begins with the necessary successful and with tremendous range, without even knowing about the atomic combustion engineering fundamentals and then uses a building-block approach structure of matter or the laws governing the behavior of atoms. A solutions to tackle specific computations and applications in industrial, marine, and utility manual and figure slides are available upon qualifying course adoption. combustion systems. A handy reference and refresher, it is designed for anyone Print ISBN: 978-1-4665-1208-5 involved in combustion equipment selection, sizing, and emissions control. eBook ISBN: 978-1-4665-1214-6 Print ISBN: 978-1-4398-7333-5 October 2013, 6-1/8 x 9-1/4, 352 pp. eBook ISBN: 978-1-4398-7334-2 Suggested Price: $94.95 / £59.99 March 2013, 8-1/2 x 11, 561 pp. Suggested Price: $231.00 / £147.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,8-1/2x11,2650pp. Print ISBN:978-1-4822-6096-0 eBook andonlineformatsaswellthe traditionalprintformat. updated tablesandhonorsfourhistorical figuresinscience.Itisavailable discipline.Thelatesteditioncontainsnewandsignificantly usefulness spansevery reference intheworld.Anauthoritativeresource consistingoftablesdata,its venerable work continuesto be the most accessedand respected scientific reference, mirroringthegrowthanddirectionofscienceforacentury. This century, this96theditionisanupdateofaclassic a thescientificcommunityforover Proudly serving Boulder, Colorado, USA National InstituteofStandardsandTechnology, William M.Haynes Edited by 96th Edition andPhysics Chemistry CRC Handbookof Suggested Price: 2014,6-1/8x9-1/4,267pp.,SoftCover February eBook ISBN:978-1-4822-5320-7 Print ISBN:978-1-4398-8805-6 dynamic interplaybetweeninfringeabilityandpatentvalidity. provisional patentapplications,independentinventors,obviousness,andthe office, andcoversimportanttopicsfrequentlyignoredorglossedover, including phenomena, suchashowandwhyinvalidpatentsareissuedbythepatent business. Itexplainsoftenmisunderstoodpatent of howpatentsareusedandabusedinthetechnology book provideskeyinsightsandperspectivesonthereality real technologybusinesses,thispracticalandengaging Using examplesofactualpatentsandpatentportfolios Opticus IPLawPLLC,Sarasota,Florida,USA Joseph E.Gortych IP andPatentinginTechnology Business Consider aSphericalPatent Suggested Price: November 2014,7x10,856pp. Print ISBN:978-1-4822-3855-6 upon qualifyingcourseadoption. thermodynamics throughout.Asolutionsmanualandfigureslidesareavailable supported byextensiveexamples,andthoroughlyhighlightstheapplicationsof methods haspromptedthisrevision.Thebookexplainsconceptscarefully, is finding alternativestothedependenceoncoal-andoil-basedenergyconversion to theanalysisofenergyconversionmethods.Thecurrentglobalconcernwith at thisacademiclevel,theoverallthemeofrevisionisasystemsapproach in theUnitedStates,Canada,andcountriessuchasIndiathatofferprograms A basictextforengineeringtechnologystudentsandtransfer Purdue University, Indianapolis,USA Professor Emeritus,IndianaUniversity Maurice Bluestein of CityUniversityNewYork, NewYork, USA Queensborough CommunityCollege Granet Irving Eighth Edition Thermodynamics andHeatPower Textbook $169.95 /£108.00 $59.95 /£38.99 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Dictionary ofInequalities Dictionary Suggested Price: September 2014,6x9,300pp. Print ISBN:978-981-4463-58-4 meaningful, andsustainableways. continual discourse, which is essential if biotechnology is to evolve in ethical, one daymakepossible.Thebookmotivatesreaderstowarddeepreflectionand life. Yet therearestillmanychoicestobemadeinshapingthefuturethatitmay global scalemanydecadesago,hastakenadirectcoursetowardre-creating endeavors continuetoevolve. The biotechnology“revolution,”launchedona what it may mean to be human as our biotechnological about themoralityofwhatwemayonedaybe,and scientists intosciencefictionstories.Itopensaconversation This bookmeldsessaysonbiotechnologywrittenby University ofVirginia, Charlottesville,USA Rosalyn W. Berne Edited by Biotechnology andScienceFiction Creating Lifefrom Suggested Price: 2013,7x10, 365pp.,SoftCover January eBook ISBN:978-1-4665-1203-0 Print ISBN:978-1-4665-1202-3 academics andmusicians,thetextrequires aminimalsetofprerequisites. illustrates itsapplicationtothestudyofmusicalrhythm.Accessibleboth The bookalsointroducesthedistanceapproachtophylogeneticanalysis and mathematical problemsthatariseinavarietyofseeminglydisparatefields. study ofthemathematicalpropertiesmusicalrhythmgeneratescommon musical rhythms of the world. It explains how the accessible computationalgeometricanalysisofthe This isthefirstbooktoprovideasystematicand New York UniversityAbuDhabi,UnitedArabEmirates Godfried T. Toussaint What Makesa“Good”RhythmGood? Musical Rhythm of The Geometry Suggested Price: 2015,6-1/8x9-1/4,368pp. February Print ISBN:978-1-4822-3761-0 the onlyprerequisiteforusingtext. terminology anddoesnotofferproofs,thusmakinganinterestininequalities ofmathematical information. Theauthorusesonlythemostelementary comments, references to related inequalities, and alistofsources for further its commonnameorsubject-withashortstatementoftheresult,some a concise,alphabeticallistingofeachinequality-by the referencestoinformationyouneed.Itprovides where toturnfindaresult,relatedinequality, or ofInequalitiesendsthedilemma A Dictionary Series: MonographsandResearch NotesinMathematics University ofBritishColumbia,Vancouver, Canada Peter Bullen Second Edition $99.95 /£63.99 $41.95 /£26.99 $99.95 /£63.99

67 Statistical Physics & Thermodynamics / General Reference Textbook Bioadhesion and Biomimetics Mathematics and Music

General Reference / Biomaterials & Regenerative Medicine From Nature to Applications Composition, Perception, Edited by and Performance Havazelet Bianco-Peled and Maya Davidovich-Pinhas Technion—Israel Institute of Technology, Haifa James S. Walker and Gary W. Don University of Wisconsin, Eau Claire, USA Bioadhesion is often defined as the state in which two materials, at least one of which is biological in nature, This accessible text teaches the basics of reading music and are held together for extended periods of time by explains how various patterns in music can be described interfacial forces. This book highlights different aspects with mathematics. The authors extensively use the powerful time-frequency of this phenomenon. The first section of the book describes studies of natural method of spectrograms to analyze the sounds created in musical performance. adhesives. These include “wet” adhesives that are produced and secreted by Numerous examples of music notation assist students in understanding basic sessile marine organisms such as mussels and algae and “dry” adhesives such as musical scores. The text also provides mathematical explanations for musical the one characterizing the gecko foot. The second section focuses on biomimetic scales, harmony, and rhythm and includes a concise introduction to digital audio adhesives. These man-made materials are fabricated on the basis of the lessons synthesis. Video demos, music software, and more are available on the book’s learned from nature. Finally, the last section reviews medical applications of CRC Press web page. A solutions manual and figure slides are available upon adhesive materials, including surgical sealants and mucoadhesive drug delivery qualifying course adoption. vehicles. Print ISBN: 978-1-4398-6709-9 Print ISBN: 978-981-4463-98-0 eBook ISBN: 978-1-4398-6710-5 January 2015, 6 x 9, 400 pp. April 2013, 7 x 10, 342 pp., Soft Cover Suggested Price: $169.95 / £108.00 Suggested Price: $62.95 / £39.99

Textbook Biofunctional Renewable Energy Surface Engineering A First Course Edited by Robert Ehrlich Martin Scholz George Mason University, Fairfax, Virginia, USA LEUKOCARE AG, Munich, Germany

This accessible textbook takes a fresh, well-balanced The lack of effective sterilization techniques for approach to the fundamentals of renewable energy biologics has spawned discussions about the reduction science, technology, and policy implications. It of regulatory requirements which might impose examines alternative and sustainable supply strategies significant safety risks. On the other hand, novel and based on biofuels and wind, hydro, solar, and geothermal energy, and looks safe technologies enable the coupling, stabilization, and protection of effector at conventional sources such as fossil fuels and nuclear energy for comparison. molecules in a way that allows terminal sterilization without loss of function. This It also explores the overarching topics of energy conservation, storage, book provides a comprehensive overview on the state of the art and the future transmission, and policy, and discusses the important issue of climate change. of biofunctional surface engineering and will be of major interest for all those Throughout, a wealth of illustrations and real-world examples make the concepts working in the fields of medicine and medical devices. more concrete. Figure slides are available upon qualifying course adoption. Print ISBN: 978-981-4411-60-8 68 Print ISBN: 978-1-4398-6115-8 eBook ISBN: 978-981-4411-61-5 eBook ISBN: 978-1-4398-6116-5 February 2014, 6 x 9, 344 pp. March 2013, 8-1/2 x 11, 464 pp., Soft Cover Suggested Price: $149.95 / £95.00 Suggested Price: $99.95 / £63.99

Advanced Bioactive Inorganic Biomaterial Applications Materials for Bone Regeneration Macro to Nanoscale and Drug Delivery Edited by Edited by Sabu Thomas, Nandakumar Kalarikkal, Chengtie Wu, Jiang Chang, and Yin Xiao Weimin Yang, and Snigdha S. Babu Bioceramics play an important role in repairing and This book covers a variety of recent research on natural regenerating defective or damaged bone. This volume polymers, biomaterials, composites, and their applications. reviews the latest advances in the field. Offering It provides valuable insights into the developments that guidance for biomedical engineering researchers and material scientists, the arose with the merger between biological and polymeric book summarizes innovative concepts, bioceramic design, and methods for materials that have led to many technological and commercial developments. material synthesis and drug delivery. It covers design and fabrication of these The extensive research being conducted in the field of bio-based polymers materials, down to the nanoscale, and includes chapters on medical device will eventually lead to better health care, cleaner energy sources, and a safer engineering using these materials. The book is designed to enhance study and environment for future generations. career development for those in this field and to facilitate further research and Print ISBN: 978-1-77188-027-5 opportunities for new solutions. October 2014, 6-1/8 x 9-1/4, 205 pp. Print ISBN: 978-1-4665-5199-2 Suggested Price: $119.95 / £76.99 eBook ISBN: 978-1-4665-5200-5 March 2013, 6-1/8 x 9-1/4, 244 pp. Suggested Price: $199.95 / £127.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2013,6x9,364pp. eBook ISBN:978-1-4822-4218-8 Print ISBN:978-981-4411-37-0 biomechanics androbotics. reviews historical developments,andgivesup-to-date insights on modern-day and exercises, thebookpresentsapedagogicalintroductiontovarietyoftopics, the state-of-the-artscienceandtechnology. With numerousfigures,references, at provide thefirstunifiedtextbookonsubject.Itoffersa“bigpicture”look biomechatronics, andbiologicallyinspiredroboticsto biomechanics, robotics, biomedical engineering, and Roboticsgoesbeyondtheindividualareasof directions ofthetwenty-firstcentury. Biomechanics promise tobesomeofthemostinfluentialresearch The scienceandtechnologyofbiomechanicsrobotics Worcester PolytechnicInstitute,Massachusetts,USA Marko B.Popovi´c Biomechanics andRobotics Suggested Price: 2013,6-1/8x9-1/4,662pp. January eBook ISBN:978-1-4665-7640-7 Print ISBN:978-1-4665-7639-1 materials pointofview. construction ofthehumanbodyanditsprincipalanatomyarediscussedfroma cardiovascular therapy. Alldevelopmentsinthefieldreflectingdesignand regeneration, liver, pancreas,skin,trachea,cartilageandbonerepair adult originarediscussedwithapplicationsranging,butnotlimitedto,nerve and for remodeling,toproductionprocesses.Stemcellsofbothembryonic tissues andorgansintegratingstrategiesfrombasicbiology, tomaterials interaction ofstemcellswithbiomaterialsforconstructingandregenerating This bookprovidesstate-of-the-artdevelopmentswithaspecificfocusonthe Leipzig, Germany Center forBiotechnologyandBiomedicine(BBZ), Augustinus Bader Institute onMembraneTechnology, Rende,Italy Loredana DeBartolo Edited by State ofArtandVision fortheFuture Stem CellTherapy Biomaterials for Suggested Price: December 2014,7x10,736pp. Print ISBN:978-1-4822-2769-7 manual andfigureslidesareavailableuponqualifyingcourseadoption. extensive lecturenotescreatedbyDr. ChenatMonashUniversity. Asolutions practices,andproblems.Itwasdevelopedfrom learning objectives,laboratory of biomaterialsfromthepointviewclinicalapplicationsandincludes from awideacademicspectrum.Thebook presents thepropertiesandprinciples enable understandingofthemostimportantconceptsandprinciplesbystudents between depth and broadness of coverage, sufficient to medicine. Thistextbookprovidesanappropriatebalance materials science,engineering,cellbiology, and subjectinvolving Biomaterials isamultidisciplinary Monash University, Clayton,Victoria, Australia Qizhi ChenandGeorgeThouas A BasicIntroduction Biomaterials Textbook $149.95 /£95.00 $209.95 /£134.00 $119.95 /£76.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

and Informatics Biomedical Signals,Imaging, Suggested Price: December 2014,7x10,1210pp. Print ISBN:978-1-4398-2518-1 research findings. is presentedinasystematicmannerandhasbeenupdatedtoreflectthelatest soft tissuereplacements,neuralengineering,andvisualprostheses.Thematerial mechanics ofbloodvessels,cochlearmechanics,biodegradablebiomaterials, dozen specifictopicsareexamined,includingcardiacbiomechanics,the biomaterials, bioelectricphenomena,andneuroengineering.Morethanthree areas suchas physiological systems,biomechanics, Handbook, FourthEdition,thisbookcoversbroad As thefirstvolumeofTheBiomedicalEngineering Series: TheBiomedicalEngineeringHandbook,ThirdEdition Texas A&MUniversity, Texarkana, USA Donald R.Peterson Joseph D.Bronzino Fundamentals Biomedical Engineering Suggested Price: May 2015,6x9,520 pp. Print ISBN:978-1-4398-4141-9 their implicationsforresearchers, technologists,andindustrialists. and biodefenseanalysis. In addition, the textaddresses emerging challengesand including microscaleandnanoscale devices, inclinical,environmental,food, in thefield.Italsoexploresapplications ofbiosensingsystemsanddevices, a widerange of biosensing approaches and discusses the latest developments growingly relevantfieldofbiosensors. Coveringthefundamentals,itpresents comprehensive guide for academics, professionals, and postgraduates to the developments inminiaturizationandnanotechnology. Thisbookprovidesa Remarkable advancesintheareaofbiosensorshavebeenfueledbyexplosive Series: BiotechnologyandBioprocessing National Research Council Canada,Montreal,Quebec John H.Luong Complutense UniversityofMadrid,Spain Jose M.Pingarron Edited by and NewChallenges Fundamentals, Applications, Biosensor Technology Suggested Price: December 2014,7x10,1468pp. Print ISBN:978-1-4398-2527-3 latest applicationsandresearch findings. material ispresentedinasystematicmannerandhasbeenupdatedtoreflectthe imaging, hospitalinformationsystems,andcomputer-basedpatientrecords.The computed tomography, positron-emissiontomography, magneticresonance biomedical signalacquisition,thermographs,infraredcameras,mammography, informatics. Morethanthreedozenspecifictopicsareexaminedincluding such asbiosignalprocessing,medicalimaging,infraredand Handbook, FourthEdition,thisbookcoversbroadareas As thethirdvolumeofTheBiomedicalEngineering Series: TheBiomedicalEngineeringHandbook,ThirdEdition Texas A&MUniversity, Texarkana, USA Donald R.Peterson Joseph D.Bronzino Edited by $189.95 /£121.00 $139.95 /£89.00 $189.95 /£121.00

69 Biomaterials & Regenerative Medicine Carbonated Hydroxyapatite Textbook Materials, Synthesis and Applications Design of Biomedical Edited by Devices and Systems Michael E. Fleet Third Edition University of Western Ontario, London, Canada Paul H. King, Richard C. Fries, This book introduces recent advances in understanding and Arthur T. Johnson the crystal structure of carbonate hydroxylapatite (also Biomaterials & Regenerative Medicine known as bone mineral), which forms the hard tissue of Intended for a senior design course in biomedical/ bones and teeth. The book includes chapters on apatite bioengineering, this book offers a comprehensive mineralogy and geochemistry, synthesis methods, x-ray structure, infrared approach to the design methodologies of modern medical devices. A substantial spectroscopy, crystal chemistry of carbonate hydroxylapatite, and biological revision of a solid text, the third edition contains new coverage on clinical trials, apatites. There are 75 illustrations, 25 tables of data, and 3 appendices. provides additional mathematical modeling tools, includes information on Discussion of the new research is supported by an outline of the theory behind sterilization and bioprocessing, devotes more instruction to integrating medical the methods of investigation and reviews of previous research on hydroxylapatite and biological considerations with engineering, and features updates to all materials, for the benefit of non-specialist students and researchers. chapters as well as new problems, examples, and case studies throughout. A solutions manual and figure slides are available upon qualifying course adoption. Print ISBN: 978-981-4463-67-6 December 2014, 6 x 9, 300 pp. Print ISBN: 978-1-4665-6913-3 Suggested Price: $179.95 / £114.00 eBook ISBN: 978-1-4665-6915-7 July 2014, 7 x 10, 505 pp. Suggested Price: $129.95 / £82.00

Devices for Mobility and Computational Bioengineering Manipulation for People Edited by with Reduced Abilities Guigen Zhang Clemson University, South Carolina, USA Teodiano Freire Bastos-Filho, Dinesh Kumar, and Sridhar Poosapadi Arjunan Computational bioengineering takes advantage of the Rehabilitation Science in Practice Series latest computational capabilities to deal with scientific and engineering problems associated with the field of Exploring the details of mobility and manipulative bioengineering, using a multidisciplinary approach. The technologies, this volume provides insight into current first book of its kind, this book introduces readers to the research trends and discusses technologies that are under development. Each need and power of multidisciplinary computer modeling to advance a number chapter covers one specific technology, starting with a general introduction, of critical areas within bioengineering. It contains comprehensive coverage of followed by technical details and an assessment from the user viewpoint— the interplay of multiple governing principles underlying common biomedical including the user benefits, user suitability, cost, reliability, and required devices and problems. Many of the contributors will be world class experts and infrastructure. Each chapter also provides illustrations or photographs of appropriate case studies will be included. the devices, making it accessible to lay and clinical audiences. The book also identifies shortcomings, current research related to the technology, and possible Print ISBN: 978-1-4665-1755-4 development opportunities. May 2015, 7 x 10, 512 pp. 70 Suggested Price: $179.95 / £114.00 Print ISBN: 978-1-4665-8645-1 eBook ISBN: 978-1-4665-8647-5 May 2014, 6-1/8 x 9-1/4 Suggested Price: $139.95 / £89.00

Design Controls for DNA Nanotechnology the Medical Device Industry Satyam Priyadarshy RKR Group, Inc., Herndon, Virginia, USA Second Edition Latha Shankar Marie B. Teixeira QA/RA Compliance Connection, Inc., Odessa, Florida, USA While DNA has proven to be a versatile molecule that is ideal for building complex structures at the nanometer This second edition of a bestseller provides a scale, until now scientists have lacked a cohesive reference comprehensive review of design control requirements, as that details nanotechnology applications in which DNA well as techniques to ensure your design control program plays a key role. This work describes current applications follows current industry practice. The text assists you in developing a program across many fields, including robotics, lithography, computation, electronics, and that not only satisfies US FDA Quality System Regulation (QSR) and ISO 9001 and fabrication. Whether you are building biomedical scaffolds, designing molecular 13485 standards, but also meets third-party auditor/investigator expectations. motors, or producing nanowires, sensors, solar cells, or new fuels, this work The author’s continual participation in FDA QSR inspections and Notified Body inform you as to what has been accomplished and expands your understanding ISO audits is reflected in practical updates to all chapters and appendices of the of what is possible. book. Print ISBN: 978-1-4200-8633-1 Print ISBN: 978-1-4665-0354-0 June 2015, 6-1/8 x 9-1/4, 464 pp. eBook ISBN: 978-1-4665-0355-7 Suggested Price: $149.95 / £95.00 November 2013, 6-1/8 x 9-1/4, 205 pp. Suggested Price: $171.95 / £111.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2015,7x10,600pp. Print ISBN:978-1-4822-3232-5 fragrances. supplements,cosmetics,flavors,and medical, agriculture,nutraceuticals,dietary industries suchasthoserelatedtofood, consumerproducts,pharmaceutical/ broader scope and is designed for scientists and engineers working in various apply thoseprocessesfordifferentapplications in industry. Thisworktakesa including thechemicalandphysicochemicalprocesses,exploreshow to research andproductdevelopmentinavastfield.Itprovidesthefundamentals, (microencapsulation) which is a growing area of This handbookcovers the entirearea of encapsulation Pennsylvania, USA and PolymericBiomaterials,Taylor &Francis, Philadelphia, Editor inChief,InternationalJournalofPolymericMaterials Munmaya Mishra Edited by and ControlledRelease Handbook ofEncapsulation Suggested Price: 2015,6x9,800pp. February Print ISBN:978-981-4316-17-0 licensing, andtoxicology. engineering, biomedicine,policy, futurestudies,ethics,intellectualpropertylaw, alike infieldssuchasmedicine,law, biotechnology, pharmaceuticalsciences, of references.Thehandbookisanessentialreadingforthenoviceandexpert words, extensivetables,colorfigures,futureprojections,andanlist commercialization activities. Eachofthe45-pluschapterscontains10–20key nanomedicine aswellclinicalapplicationsand a comprehensiveroadmapofbasicresearch in The handbook,dividedintofoursections,provides Raj Bawa,GeraldF. Audette,andIsraelRubinstein Edited by From BenchtoBedside Clinical Nanomedicine Handbook of Suggested Price: April 2013,6x9,142pp. eBook ISBN:978-981-4364-46-1 Print ISBN:978-981-4364-45-4 elongation fromtheperspectiveofpolysaccharideengineering. chain- the practicalsynthesisofpolysaccharidesbyphosphorylase-catalyzed that ishighlystereo-andregion-controlled.Thisbookfocusesonadvancesin toolbecausethereactionproceedsinamanner powerful method isavery well-defined structureisincreasinglyimportant.Forthispurpose,enzymatic foods, andcosmetics.Therefore,precisionsynthesisofnewpolysaccharideswith functional materialsinmanyresearch fieldssuchasmedicine,pharmaceutics, attracting muchattentiondueto their potentialasnew Polysaccharides andtheirrelatedcompoundsare Kagoshima University, Japan Jun-ichi KadokawaandYoshiro Kaneko Enzymatic Chain-Elongation by Phosphorylase-Catalyzed Polysaccharide Materials Engineering of $179.95 /£114.00 $495.00 /£315.00 $129.95 /£82.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: March 2013,6x9,616 pp. eBook ISBN:978-981-4411-22-6 Print ISBN:978-981-4411-21-9 environment. best accessit.Italsoguidesproductdevelopersthroughtheglobalregulatory the world,handbookexplainsbasicsofAsianmarketandhowto affairs. With bodiesaround contributionsfromauthorsworkingwithregulatory the particularareatoprovidereaderswithabetterunderstandingofregulatory application. Eachchapterprovidessubstantialbackgroundmaterialsrelevantto requirements,anddocumentationfor devices, clinicaltrialandregulatory systemsindifferentregions,ISOstandardsformedical medical deviceregulatory With afocusonAsiancountries,thishandbookcovers Hong KongPolytechnicUniversity, HungHom,Kowloon Raymond Tong Kaiyu Kowloon, HongKong ProfessionalAssociation,KwunTong,Asia Regulatory Jack Wong Edited by AffairsinAsia Regulatory Handbook ofMedicalDevice Suggested Price: October 2014,6x9,372pp. Print ISBN:978-981-4411-56-1 of theengineerednanomaterials. defects, dentistry, and tissue engineering. It also discusses the toxicology aspects dermatology, virology, hematology, and congenital orthopaedics, embryology of clinical medicine,such as cardiology, oncology, pharmacology, immunology, ontheforefrontdevelopmentsofnanotechnology invariousdomains overview of nanostructuredmaterialsanddevices.Thisbookprovidesacomprehensive improved andnovelphysical/chemicalcharacteristics many importantmedicalproblemsbyexploitingthe to healthsciences—hasthepotentialaddress Nanomedicine—the applicationofnanotechnology Aristotle UniversityofThessaloniki,Greece Varvara Karagkiozakiand StergiosLogothetidis Edited by Clinical Nanomedicine Horizons in Suggested Price: July 2014,6x9,674pp. eBook ISBN:978-981-4463-13-3 Print ISBN:978-981-4463-12-6 an invaluableopportunitytolearnaboutthelateststepsindentalbiomaterials. biomaterialsscience.Formedicalpractitioners,thebookoffers contemporary students ofengineeringandbasicsciencewhowanttogainaninsightin A solidprimerfordentalstudents,thebookisalsohighlyrecommended over theworldandaredistinguishedintheirdisciplines. oral biomaterials.Thecontributingauthorsarefromall introduction andcoversceramic,metallic,polymeric and biomaterialsscience.Itcontainsacomprehensive The bookintroducesthelatestadvancesindentalmaterials University ofHongKong,SaiYing Pun Jukka Matinlinna Edited by Handbook ofOralBiomaterials $149.95 /£95.00 $149.95 /£95.00 $249.95 /£159.00

71 Biomaterials & Regenerative Medicine Hydroxyapatite Coatings Marine Biomaterials for Biomedical Applications Characterization, Isolation Edited by and Applications Sam Zhang Edited by Nanyang Technological University, Singapore Se-Kwon Kim Series: Advances in Materials Science and Engineering Pukyong National University, Busan, South Korea

With a bonelike structure that promotes osseointegration, Bringing together a wide range of research in Biomaterials & Regenerative Medicine hydroxyapatite (HA) coating can be applied to otherwise this important area, this book includes the latest bioinactive implants to make their surface bioactive, thus developments and applications of marine-derived achieving faster healing and recovery. This book explores developments in the biomaterials, from preliminary research to clinical trials. Essential reading processing and property characterization and applications of hydroxyapatite, for the novice and expert alike, it details the isolation and characterization of providing a timely resource for active researchers and newcomers to the field. biomaterials and their biological activities, including antiviral, anti-allergic, and HA experts from the United States, Japan, Singapore, and China present anticoagulant effects. The book also discusses the viability of low-cost marine valuable insights on topics ranging from deposition processes to applications in biomaterials, biomedical applications such as tissue engineering and drug orthopedic and dental implants and drug delivery. delivery, and commercialization of marine-derived products. Print ISBN: 978-1-4398-8693-9 Print ISBN: 978-1-4665-0564-3 eBook ISBN: 978-1-4398-8694-6 eBook ISBN: 978-1-4665-0565-0 May 2013, 6-1/8 x 9-1/4, 469 pp. April 2013, 7 x 10, 840 pp. Suggested Price: $231.00 / £147.00 Suggested Price: $199.95 / £127.00

Mechanics of Cellular Imaging in Cellular Bone Remodeling and Tissue Engineering Coupled Thermal, Electrical, Edited by and Mechanical Field Effects Hanry Yu and Nur Aida Abdul Rahim National University of Singapore Qing-Hua Qin Australian National University, Canberra, Acton Series in Cellular and Clinical Imaging Research on bone remodeling has resulted in much new As the field of tissue engineering moves from creating information and has led to improvements in design simpler outer body parts to more sophisticated internal and biomedical practices. This volume presents a unified exploration of recent organs, researchers need to evaluate and control how advances, giving readers a sound understanding of bone remodeling and its well the tissues are engineered and integrated into the living body. Suitable for mathematical representation. Beginning with a description of the basic concept both experts and newcomers in bioengineering and biomedical imaging, this of bone remodeling from a mathematical point of view, the book details the book shows researchers how to apply imaging techniques to next-generation development of each of the techniques and ideas. From there it progresses to engineered cells and tissues. It helps them assess the suitability of specific the derivation and construction of multifield and cellular bone remodeling and imaging modalities for applications with various functional requirements. shows how they arise naturally in response to external multifield loads. Print ISBN: 978-1-4398-4803-6 Print ISBN: 978-1-4665-6416-9 eBook ISBN: 978-1-4398-4804-3 eBook ISBN: 978-1-4665-6417-6 72 May 2013, 7 x 10, 298 pp. January 2013, 6-1/8 x 9-1/4, 320 pp. Suggested Price: $157.95 / £99.00 Suggested Price: $145.95 / £93.00

Magnesium Alloys Medical Devices as Degradable Biomaterials and Human Engineering Zheng Yufeng Edited by This book is a comprehensive review of the biomedical Joseph D. Bronzino applications of biodegradable magnesium and its Donald R. Peterson alloys. The metal has seen increasing use in orthopedic Texas A&M University, Texarkana, USA and cardiovascular applications over the last decade, Series: The Biomedical Engineering Handbook, Third Edition particularly for coronary stents and bone implants. As the second volume of The Biomedical Engineering The book covers at a variety of magnesium alloys and Handbook, Fourth Edition, this book covers broad areas reviews their structure, fabrication, and in vivo biocompatibility. such as biomedical sensors, medical instrumentation and devices, human Print ISBN: 978-1-4665-9804-1 performance engineering, rehabilitation engineering, and clinical engineering. May 2015, 6-1/8 x 9-1/4, 256 pp. More than three dozen specific topics are examined, including optical sensors, Suggested Price: $129.95 / £82.00 implantable cardiac pacemakers, electrosurgical devices, blood glucose monitoring, human–computer interaction design, orthopedic prosthetics, clinical engineering program indicators, and virtual instruments in health care. The material is presented in a systematic manner and has been updated to reflect the latest applications and research findings. Print ISBN: 978-1-4398-2525-9 December 2014, 7 x 10, 892 pp. Suggested Price: $189.95 / £121.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2015,6-1/8x9-1/4,400pp. Print ISBN:978-1-4822-4011-5 including scientists,technicians,andmanagers. not onlytostudentsandresearchers butalsotoindividualsengaged inindustry, perspective and state-of-the-art materials. The book is designed to be suitable and defense.Thebooksimultaneouslypresentsauniquecriticalliterature nanocomposites, transportation,powerandenergy, biologicalandbiomedical, in applicationssuchaswaterpurification,packagingof nanocomposite materialsaswellrecentdevelopments This bookdetailsboththefundamentalsof University ofSouthFlorida,Tampa, USA Manoj KumarRamandEliasK.Stefanakos Edited by Practical Applications Fundamentals and Nanocomposite Materials Suggested Price: August 2013,6-1/8x9-1/4,490pp. eBook ISBN:978-1-4398-7642-8 Print ISBN:978-1-4398-7641-1 biotechnology, biomedicine,andenvironmentalremediation. and more.Thebookdemonstratestheimportanceofbionanomaterialsto manufacturing offunctionalnanomaterials,tumortargeting,cytotoxicity, includes biomimeticsynthesis,bioimagingandcancerdiagnosis,virus-enabled of research intheirdisciplines exploreadiversesetoftopics.Coverage and applicationsinbionanomaterials.Internationalcontributorsattheforefront of the“bridge.”Thisbook bio, withnanoscalematerialsprovidingthebuildingblocksforconstruction as abridgebetween nano and Nanobiotechnology serves Series: AdvancesinMaterialsScienceandEngineering Villanova University, Pennsylvania,USA Georgia C.Papaefthymiou Gachon University, Gyeonggi-do,SouthKorea Dong KeeYi Edited by Development andApplications Nanobiomaterials Suggested Price: 2015,7x10,1886pp. February Print ISBN:978-1-4398-2530-3 as amajorreferenceforallpracticingbiomedicalengineersandstudents. the definitiveresource ofthefieldbiomedicalengineering.Assuch,ithasserved discusses futureprojections.Thehandbook,nowinitsfourthedition,hasbecome including thelatestresearch findings.Thiseditiondiscussesmedicalethicsand coverage, beginningwithahistoricalperspectiveand Handbook, Fourth Edition, thisbookprovidescomprehensive The thirdvolumeoftheBiomedicalEngineering Series: TheBiomedicalEngineeringHandbook,ThirdEdition Texas A&MUniversity, Texarkana, USA Donald R.Peterson Joseph D.Bronzino and Tissue Engineering Molecular, Cellular, $179.95 /£114.00 $157.95 /£99.00 $189.95 /£121.00 gives you a broad, interdisciplinary view of advances viewofadvances gives youabroad,interdisciplinary

For more informationand acompletelistof titles,visitusat www.crcpress.com of TherapeuticNucleicAcids Nanotechnology fortheDelivery Suggested Price: May 2015,7x10,500pp. Print ISBN:978-1-4822-3527-2 detect anumberofdebilitatingdiseasesandconditions. methodologies available,andputsintoperspectivethematerialsneededto detecting severalchronicdiseases.Ithighlightsthenumerousandvarious applications forseveralanalysesimportanthumanwell-beingaswell detail the current state of knowledge on nano-inspired biosensors for healthcare practical insightintotheselectionandoptimizationofbiosensors.Itprovidesin scale, thisbookisacomprehensivereferencefor Utilizing worldclassresearchers onawideinternational Western MichiganUniversity, Kalamazoo,USA Sherine O.Obare University ofSouthFlorida,Tampa, USA Manoj KumarRam Edited by for ImprovedHealthcare Nano-Inspired Biosensors Suggested Price: 2014,7x 10, 476pp. February eBook ISBN:978-1-4665-0351-9 Print ISBN:978-1-4665-0350-2 practitioners whomaylackformaltraining inengineering. as appliedtomedicalresearch andtreatment(biomaterials)forstudents both teachingandself-studysettings.Theworkintroducesmaterialsscience native tissuesandman-made(engineered)materials.Itisintendedforuse in and ofmaterialsusedtoreplaceortreatthem,theinteractionsbetween emphasizing propertiesofnaturalsoftandhardtissues disabilities, anddiseasesofthemusculoskeletalsystem, aspects ofresearch onandtreatmentofinjuries, Extensively revised,thistextexploresthebiomaterials Kevin L.Ong,ScottLovald,andJonathanBlack Second Edition in Research andPractice Orthopaedic Biomaterials Suggested Price: March 2013,6x9,240 pp. eBook ISBN:978-981-4411-05-9 Print ISBN:978-981-4411-04-2 and foundersofdifferentapproaches. strategies. Thecontributingauthorsareworldleadersintheirrespectivefields targets immune-toxicity, pharmacokinetics,andtheefficacyvalidationofnewdrug workinginareassuchasstability,the pharmaceuticalindustry generaltoxicity, proteins. Theystronglyemphasizeissuesandaspectsthatareofessenceto polymers, chemical conjugates,NA aptamers, and strategiesusinglipids, the stateofartindelivery for nucleicacid(NA)delivery, theauthorsexplore Written byworldexpertsinthefieldofnanotechnology Tel Aviv University, Israel Dan Peer Edited by by using unique approaches based on exquisite nanotechnology in vivobyusinguniqueapproachesbasedonexquisitenanotechnology $179.95 /£114.00 $179.95 /£114.00 $149.95 /£95.00

73 Biomaterials & Regenerative Medicine Textbook Vascularization

Biomaterials & Regenerative Medicine / Ceramics Glasses Robotic Surgery Regenerative Medicine Smart Materials, Robotic Structures, and Tissue Engineering and Artificial Muscles Edited by Mohsen Shahinpoor and Siavash Gheshmi Eric M. Brey University of Maine, Orono, USA Illinois Institute of Technology, Chicago, USA

This text focuses on robotic surgery and biomimetic This book presents the latest research and science on the artificial muscles and their possible engineering, industrial, process of vessel assembly, with an emphasis on methods medical, and science applications. It presents the fundamentals of surgical for controlling the process for therapeutic applications. It robots, including the design of their geometrical configurations, kinematics, has a strong orientation toward regenerative medicine and tissue engineering dynamics, and control. It also describes the designs of ophthalmic surgical robots applications with contributions from engineers, basic scientists, and biologists. and general laparoscopic surgical robots as well as applications of materials and The book provides the reader with an understanding of the process of how systems that can be manufactured or fabricated to act like biomimetic artificial blood vessels and methods for controlling this process are engineered in order to muscles, sensors, and actuators. develop treatments for various pathologies and surgical situations. Print ISBN: 978-981-4316-23-1 Print ISBN: 978-1-4665-8045-9 November 2014, 6 x 9, 210 pp. eBook ISBN: 978-1-4665-8046-6 Suggested Price: $179.95 / £114.00 August 2014, 7 x 10, 397 pp. Suggested Price: $149.95 / £95.00

Scaffolds for Tissue Engineering Biological Design, Materials, Advanced Materials and Fabrication for Joint Implants Edited by Giuseppe Pezzotti Claudio Migliaresi and Antonella Motta Kyoto Institute of Technology, Japan University of Trento, Italy Based on an interdisciplinary approach that directly This book illustrates design principles for scaffolds for bridges orthopedic concepts to surface science, this tissue engineering with particular relevance to the book details cutting-edge research in bioceramics biological requirements needed to control and drive science, physical chemistry, biomedical optics, and the biological cross-talk, and reviews materials and fabrication and validation nanomechanics. The book cites some of the more methods. The book is mainly addressed to graduate and post-graduate students, conventional spectroscopic characterization techniques—including Raman and who are approaching tissue engineering or experienced researchers who wish cathodoluminescence spectroscopy. These techniques have been used to unveil to have condensed but comprehensive information on materials, fabrication molecular scale phenomena of both chemical and mechanical origin occurring at techniques, biological principles, and design criteria. The contributors are among the sliding surfaces of bioceramic joints. These concepts are of critical importance the scientific leaders in their respective fields. to researchers as they are relevant to the development of new biomaterials. Print ISBN: 978-981-4463-20-1 Print ISBN: 978-981-4316-88-0 eBook ISBN: 978-981-4463-21-8 eBook ISBN: 978-981-4364-39-3 74 June 2014, 6 x 9, 698 pp. September 2013, 6 x 9, 626 pp. Suggested Price: $249.95 / £159.00 Suggested Price: $179.95 / £114.00

Usability Testing Nanoindentation of Brittle Solids of Medical Devices Arjun Dey ISRO Satellite Centre, Bangalore, Indian Space Research Second Edition Organisation Michael E. Wiklund, P.E., Jonathan Kendler, Anoop Kumar Mukhopadhyay and Allison Y. Strochlic CSIR-Central Glass and Ceramic Research Institute, Kolkata, West Bengal, India Since the publication of the first edition, the FDA and Glass and ceramics are brittle in nature, but are often other regulatory groups have modified their regulations used in electronics, space, defense, biomedical, and many and expectations regarding how medical device day-to-day applications, where mechanical disintegration manufacturers should approach usability testing. Reflecting these changes, this may cause total failure of the application. Evaluation and in-depth knowledge second edition provides updated guidance to medical device manufacturers of nanomechanical characterization helps to improve process parameters or and other interested readers. Key updates include new requirements, detailed may help identify the critical failure point. Therefore, it is important to measure instructions for linking usability test tasks to risk analysis results, and methods for mechanical properties such as hardness and Young’s modulus at the local analyzing root causes of use errors that occur during usability tests. The book’s microstructural length scale. This book presents a collection of recent research authors are well-known thought leaders in the medical device industry. findings of nanoindentation issues in brittle materials. Print ISBN: 978-1-4665-9588-0 Print ISBN: 978-1-4665-9690-0 April 2015, 6-1/8 x 9-1/4, 425 pp. eBook ISBN: 978-1-4665-9691-7 Suggested Price: $79.95 / £49.99 June 2014, 6-1/8 x 9-1/4, 452 pp. Suggested Price: $189.95 / £121.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: October 2014,6x9,300pp. Print ISBN:978-981-4463-40-9 technologies. development ofnovelcrystalline-semiconductor-based and thereby stimulatethe thorough perspectiveofmetal-inducedcrystallization a in thin-filmsolarcellsanddisplaytechnologies.Itaimstogivethereader to employ this process in various technologies, including andfurtherelucidateshow metal-induced crystallization ofthecurrentfundamentalunderstanding overview This bookprovidesthefirstcomprehensiveandin-depth and EricJ.Mittemeijer Zumin Wang, LarsP. H.Jeurgens, Edited by Fundamentals andApplications Metal-Induced Crystallization Suggested Price: August 2014,6x9,170pp. eBook ISBN:978-981-4463-44-7 Print ISBN:978-981-4463-43-0 bioceramics. describes thepotentialapplicationareasforthesenewchemicallybonded integration indifferentdentalandorthopaedicapplications.Thebookalso tissues, relationtootherbioceramicsandbiomaterials,nanostructural bioceramics, includingtheirprocessingaspects,properties,integrationwith ofthenanostructuralchemicallybonded an overview discusses theirgeneralandspecificproperties.Itpresents nanostructural chemicallybondedbioceramicsand This bookdescribesthenewbiomaterialsbasedon Doxa AB,Uppsala,Sweden Leif Hermansson Edited by Advances inChemicallyBondedCeramics Nanostructural Bioceramics Suggested Price: March 2014,6x9,322pp. eBook ISBN:978-981-4411-30-1 Print ISBN:978-981-4411-29-5 involved inglassscienceandtechnologyapplication. recent research advancesinthearea.Thisbookwillappealtoanyonewhois prominent expertsfromallovertheworld,andtherefore,bookpresents their applicationinintegratedoptics.Thechaptershavebeencontributedby on thestructuralandphysicalpropertiesofvariouschalcolgenideglasses ability ofvarioussystems,followedbyadiscussion on theglasses.Itstartswithareviewglass-forming chalcogenide glassscienceandvariousapplicationsbased ofthe This bookprovidesacomprehensiveoverview Australian NationalUniversity, Canberra Rong PingWang Edited by Advances andApplications Amorphous Chalcogenides $179.95 /£114.00 $129.95 /£82.00 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com Suggested Price: March 2015,6-1/8x9-1/4,272pp. Print ISBN:978-1-4822-5093-0 elastic modulus,andfracturetoughness. between MAPS and MISP as function of porosity crystallinity, adhesion, hardness, bioactive HAP coatings. The book also discusses advantages and disadvantages applicability ofthenewemergingplasmasprayingtechniquestocoatefficient in vivotrialforbonefracturehealingwhichgivesatotalcomprehensionand mechanical characterizationsanditschallenges,invitrodissolutionstudy characterization, developmentofMAPSandMIPS-HAPcoating,indepthpysico- describes thesynthesisofHAPpowderandits for bonefracturerepairandhealing.Itsystematically This bookexplorestheefficacyofHAPcoating Kolkata, West Bengal,India CSIR-Central GlassandCeramicResearch Institute, Anoop KumarMukhopadhyay Arjun Dey Hydroxyapatite Coatings Microplasma Sprayed Suggested Price: December 2013,6-1/8x9-1/4,267 pp. eBook ISBN:978-1-4665-9034-2 Print ISBN:978-1-4665-9032-8 of buildingmaterialsengineering. fire protection. It reflects the newest developments in the rapidly growing field (OSPC) aswellnovelpolymerandsilicate polymercoatingsforcorrosionand binder (RubCon)andsilicatepolymerconcretebasedonorgano-silicate examines twonewpolymers,namely, rubberconcretebasedonpolybutadiene durability, andenvironmentalimpactassociatedwithpolymerconcretes.Thetext explores thepresentstateoffield,includingapplications,characteristics, compounds basedonadvancedpolymerbinders.It experimental research onnovelconcretesandprotective This bookpresentstheresultsoftheoretical and Beilin Dmitry Migdal HaEmek,Israel Polymate Ltd-InternationalNanotechnologyResearch Center, Oleg Figovsky and Compounds Advanced PolymerConcretes Suggested Price: October 2013,6-1/8x9-1/4,351pp. eBook ISBN:978-1-4665-5731-4 Print ISBN:978-1-4665-5730-7 used toprovidepropertiessuchasanti-scratchandanti-corrosion. provide agasbarriertothesubstratefoilorlaminateandhowcoatingsare automotive andpackagingindustries.Itexplainshownanocompositecoatings of bulknanocompositematerials,itdescribestheirapplicationinareassuchasthe new tothefield.Thebooknotonlyexplainssynthesis researchers andprovidesbackground informationforthose advances innanocompositecoatingsforexperienced for thincoatingsonvarioussubstrates.Itcompilesrecent This workexplorestheuseofcompositenanotechnology The PetroleumInstitute,AbuDhabi,UnitedArabEmirates Vikas Mittal Edited by Polymer NanocompositeCoatings $179.95 /£114.00 $145.95 /£93.00 $177.95 /£113.00

75 Ceramics & Glasses / Coatings & Thin Films / Composite Materials Bio-Based Composites for Composites and High-Performance Materials Nanocomposites From Strategy to Industrial Application Edited by Edited by A. K. Haghi, Oluwatobi Samuel Oluwafemi, Josmin P. Jose, and Hanna J. Maria Wirasak Smitthipong, Rungsima Chollakup, and Michel Nardin Series: Advances in Materials Science This book provides a solid understanding of recent This timely text integrates disciplines such as materials developments in the field of composites and science, polymer chemistry, plant science, chemical nanocomposites. It explains the significance of the new engineering, and nanotechnology to provide comprehensive coverage of the fillers, such as graphene and carbon nanotubes in different matrix systems. It state of the art in bio-based composite materials. It discusses the raw materials also covers the application of these materials in biological and others fields. used in bio-based composites, basic design principles, properties, applications, This detailed study of nanocomposites and their structure, processing, and and life cycle assessments. The book also presents a strategic and policy-oriented

Composite Materials characterization is suitable for engineers from all walks of life. view of these composites, addressing the competing needs of plants used for food versus plants used for sustainable feedstock. Print ISBN: 978-1-926895-28-4 eBook ISBN: 978-1-4665-6876-1 Print ISBN: 978-1-4822-1448-2 March 2013, 6-1/8 x 9-1/4, 230 pp. October 2014, 6-1/8 x 9-1/4, 336 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $129.95 / £82.00

Textbook Computational Modeling Composite Materials of Polymer Composites Design and Applications, Third Edition A Study of Creep and Environmental Effects Daniel Gay Institut Clément Ader, University of Toulouse, France Samit Roy and J.N. Reddy Series: Computational Mechanics and Applied Analysis Mirroring the exponential growth and development of composites, this English-language Third Edition contains This book provides a better understanding of the all-new coverage of nano- and biocomposites and reflects theories associated with finite element models of recent manufacturing processes and applications in the elastic and viscoelastic response of polymers and polymer composites. It aerospace, automotive, naval, wind turbine, and sporting goods industries. covers computational modeling and life-prediction of polymers and polymeric Featuring a technical level that rises in difficulty as the text progresses, the book composites in aggressive environments. It begins with a review of mathematical provides numerous examples of the pre-sizing of composite parts, processed preliminaries, equations of anisotropic elasticity, and then presents finite element from industrial cases and reworked to highlight key information, as well as analysis of viscoelasticity and the diffusion process in polymers and polymeric includes test cases for the validation of computer software using finite elements. composites. The book provides a reference for engineers and scientists and can Figure slides are available upon qualifying course adoption. be used as a textbook in graduate courses. Print ISBN: 978-1-4665-8487-7 Print ISBN: 978-1-4665-8649-9 eBook ISBN: 978-1-4665-8489-1 eBook ISBN: 978-1-4665-8650-5 76 July 2014, 7 x 10, 635 pp. September 2013, 7 x 10, 300 pp. Suggested Price: $119.95 / £76.99 Suggested Price: $157.95 / £99.00

Composite Materials Defects and Damage in and Processing Composite Materials M. Balasubramanian and Structures IIT Madras, Chennai, India Rikard Benton Heslehurst An exploration of the processing of composite materials, University of New South Wales, Canberra, Australia this book covers fiber reinforcements, production of Containing a detailed list of defects and damage types, various fibers and properties, and the processing of this must-have reference examines defect criticality in polymer matrix, metal matrix, and ceramic matrix composite structures and recommends repair actions composites. It then discusses topics illustrating advanced to restore structural integrity. Relating defect detection composites, such as carbon-carbon composites and nanocomposites, processing methods to defect type, it reviews NDI processes for finding and identifying of polymer-clay nanocomposites, carbon nanotube-reinforced composites, defects in composite materials and discusses failure modes and mechanisms and nanoparticle-reinforced composites. The book also includes a chapter on of composites due to defects. Merging his experience in composite airframe practical instructions for processing composites. maintenance and repair with indispensable reports and articles, the author Print ISBN: 978-1-4398-7935-1 explains how defects and damage in composite materials and structures impact eBook ISBN: 978-1-4398-8054-8 component performance. October 2013, 6-1/8 x 9-1/4, 648 pp. Print ISBN: 978-1-4665-8047-3 Suggested Price: $145.95 / £93.00 eBook ISBN: 978-1-4665-8048-0 April 2014, 6-1/8 x 9-1/4, 214 pp. Suggested Price: $169.95 / £108.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 are availableuponqualifyingcourseadoption. been updated for the newest ANSYS version. A solutions manual and figure slides have examples 50+ all addition, In composites. in damage of modeling as areas been completelyrevisedtoincorporate advancesinthestateofartsuch instability, damage,anddelamination. This secondeditionofabestsellerhas analysis, includingthree-dimensionaleffects,viscoelasticity, edgeeffects,elastic composites withimplementation,thetextcoversmajoraspectsofadvanced ofadvanced mechanicsof analyze compositematerials.Combiningtheory Suggested Price: December 2013,7 x10,366pp. eBook ISBN:978-1-4822-2156-5 Print ISBN:978-1-4665-1689-2 This istheonlyfiniteelementanalysisbookonmarketusingANSYS Series: CompositeMaterials West Virginia University, Morgantown,USA Ever J.Barbero Second Edition Using ANSYS Composite Materials Finite ElementAnalysisof Textbook Suggested Price: April 2013,7x10,444pp. eBook ISBN:978-1-4665-1671-7 Print ISBN:978-1-4665-1661-8 qualifying courseadoption. software Abaqus™.Asolutionsmanualandfigureslidesareavailableupon valueproblemsusingthecommercialresulting boundary finiteelementanalysis a mathematicalrepresentationofthephysicalreality, andthesolutionof analysis ofcomposites,themechanicsneededtotranslatethoseconceptsinto by actuallysolvingproblems.Itexplainstheconceptsinvolvedindetailed toahands-onlevel composites. Unlikeothertexts,thisonetakesthetheory finite elementtools address practical problemsin the structuralanalysis of on advancedmechanicsofcompositematerials,thistextshowshowpowerful Developed fromtheauthor’s graduate-levelcourse Series: CompositeMaterials West Virginia University, Morgantown,USA Ever J.Barbero Using Abaqus™ Composite Materials Finite ElementAnalysisof Textbook Suggested Price: March 2014,6-1/8x9-1/4,379pp. eBook ISBN:978-1-4398-4859-3 Print ISBN:978-1-4398-4858-6 tests,andmore. tolerance tests,singlefibermatrixinterface thermoset resins,neatresintests,sandwichstructures,cureanalyses,damage issues. TheFourthEditionisrevisedtoincludemajoradditionsinprocessingof of laminatestingandlaminateresponses;examinescompositedurability methods, testprocedures,anddatareductionschemes;coversspecificaspects materials presentsprocessingtechniques,specimenpreparation,analysesoftest coefficients, andfracturestrengthdataforcomposite determining mechanical properties, thermalexpansion This practicaltreatmentofthebestavailablemethodsfor and R.ByronPipes Leif A.Carlsson,DonaldF. Adams, Fourth Edition Advanced CompositeMaterials Experimental Characterizationof $125.95 /£79.99 $125.95 /£79.99 $169.95 /£108.00 ®

For more informationand acompletelistof titles,visitusat www.crcpress.com ® to to Suggested Price: March 2013,6-1/8x9-1/4,351pp. eBook ISBN:978-1-4398-7762-3 Print ISBN:978-1-4398-7761-6 design guidelines. various designformulations.Italso,forthefirsttime,offersacompletesetof numerical analyses,andexperimentalinvestigations,whichcanbeappliedto for usingFRPdecksinbridgedesigns.Thebookcombinesanalyticalmodels, research bytheauthors,tofacilitatedevelopmentofstandardsandguidelines enhanced durability. information,basedprimarilyon Itcompilesthenecessary new constructionduetotheirreducedweight,lowermaintenancecosts,and increasingly implemented in rehabilitation projects and reinforced polymer(FRP)bridgedecks,whichhavebeen This bookpresentstheanalysisanddesignoffiber- Series: CompositeMaterials Julio F. Davalos,AnChen,andPizhongQiao Analysis andDesign Bridge Systems FRP DeckandSteelGirder Suggested Price: November 2013,6-1/8x9-1/4,419 pp. eBook ISBN:978-1-4665-7070-2 Print ISBN:978-1-4665-7069-6 from naturalresources. polymers anddiscussesthepresentstate andgrowingutilityofgreenmaterials information onmoreeco-friendlyandsustainablealternativestosynthetic green composites.Coveringvariouskindsofcellulosicbiofibers,thetextprovides materials, includingprocessingmethodsandpotentialapplicationsinbio-based the advancements made in the development of biorenewable resources-based of effects ofsynthetics.Thisbookdeliversanoverview friendly bio-basedmaterialsfreefromthetraditionalside in theemergenceofeconomicallyandenvironmentally Global awarenessofenvironmentalissueshasresulted Washington StateUniversity, Pullman,USA Vijay KumarThakur Edited by from NaturalResources Green Composites Suggested Price: November 2014,6x9,405pp. Print ISBN:978-1-77188-032-9 processing andsuccessfulutilizationforselectedapplications. onaparticularbiocompositematerialandits Each chaptergivesanoverview and processingofthebiocompositestobeusedforavarietyapplications. biocomposites procuredfromdiversenaturalresources andthepreparation this book focuses on the potential efficacy of different Keeping inmindtheadvantagesofbio-basedmaterials, Washington StateUniversity, Pullman,USA Vijay KumarThakurandMichael R.Kessler Edited by From KnowledgetoIndustrialApplications Biocomposites Green Biorenewable $157.95 /£99.00 $209.95 /£134.00 $149.95 /£95.00

77 Composite Materials The International Handbook Strengthening Design of of FRP Composites in Reinforced Concrete with FRP Civil Engineering Hayder A. Rasheed Kansas State University, Manhattan, USA Edited by Series: Composite Materials Manoochehr Zoghi California State University, Fresno, USA This textbook establishes the art and science of strengthening design of reinforced concrete with FRP The use of high-performance fiber reinforced polymer beyond the abstract nature of the design guidelines. It (FRP) composite materials has expanded beyond the addresses material characterization, flexural strengthening

Composite Materials / Corrosion aerospace and marine industries, into civil engineering and related disciplines. of beams and slabs, shear strengthening of beams, and confinement This handbook provides a complete primer on FRP composites, including strengthening of columns. It discusses the installation and inspection of FRP materials, manufacturing, life-cycle costs, and mechanics. It also focuses on as externally bonded or near-surface-mounted composite systems for concrete professional applications, such as hybrid FRP composite systems, composites for members. It provides innovative design aids based on ACI 440 code provisions, reinforcement, nondestructive testing and evaluation, and design philosophies end-of-chapter questions, references for further study, and a solutions manual and guidelines. It includes standards of practice from around the world, as well with qualifying course adoption. A solutions manual and figure slides are as helpful design charts, formulas, and tables for easy reference. available upon qualifying course adoption. Print ISBN: 978-0-8493-2013-2 Print ISBN: 978-1-4822-3558-6 eBook ISBN: 978-1-4200-0374-1 December 2014, 6-1/8 x 9-1/4, 242 pp. September 2013, 7 x 10, 706 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $177.95 / £113.00

Corrosion and Materials Nanomaterials and in the Oil and Gas Industries Nanotechnology for Composites Edited by Design, Simulation, and Applications Reza Javaherdashti, Chikezie Nwaoha, and Henry Tan Edited by A. K. Haghi, Sabu Thomas, Ali Pourhashemi, This book offers guidance to help you tackle corrosion Abbas Hamrang, and Ewa Klodzinska issues in the oil and gas industries. Engineers, scientists, and business managers from around the world explain the Engineered nanopolymer and nanoparticles are chemical causes of corrosion and describe strategies for exceptionally interesting from a fundamental research preventing, monitoring, and mitigating corrosion. They also discuss corrosion point of view. They open up new perspectives for various applications, such as hazards and risk, and highlight the need for companies to maintain their nano-transistors in circuits, field-emission displays, artificial muscles, or added infrastructure to remain competitive. Combining theory with practical, state- reinforcements in alloys. This informative book is an introduction to the physical of-the-art strategies and examples, this is an invaluable reference for anyone concepts needed for investigating carbon nanotubes and other one-dimensional involved in corrosion management and materials selection. solid-state systems. Written for a wide scientific readership, each chapter consists Print ISBN: 978-1-4665-5624-9 of an instructive approach to the topic and sustainable ideas for solutions. eBook ISBN: 978-1-4665-5625-6 Print ISBN: 978-1-77188-065-7 April 2013, 7 x 10, 721 pp. 78 November 2014, 6 x 9, 432 pp. Suggested Price: $209.95 / £134.00 Suggested Price: $149.95 / £95.00

Smart Composites Corrosion of Ceramic Materials Mechanics and Design Third Edition Edited by Ronald A. McCauley Rani Elhajjar, Valeria La Saponara, Rutgers, The State University of New Jersey, Piscataway, USA and Anastasia Muliana Series: Corrosion Technology Series: Composite Materials With an abundance of practical features and new This textbook addresses current progress in the mechanics information, this expanded and completely reorganized and design of smart composites and multifunctional third edition helps readers address corrosion problems structures. It covers characterization, analyses, and design and create the most corrosion-resistant systems possible. of various advanced composite material systems with an emphasis on the Reflecting the many changes in the field since the publication of the second coupled mechanical and non-mechanical properties. The book discusses smart edition, the book includes new chapters on corrosion by biological sources materials related to electrically conductive, magnetostrictive nanocomposites as well as corrosion of architectural materials. This edition also contains more and design of active fiber composites; smart structures with topics such as questions and examples, additional material on thermal and environmental piezoelectrically actuated bistable composites, wing morphing design using barrier coatings, an expanded chapter on composites, and new literature sources. macrofiber composites, and multifunctional layered composite beams; and Print ISBN: 978-1-4398-2022-3 recent advances regarding sensing and structural health monitoring. eBook ISBN: 978-1-4398-2023-0 Print ISBN: 978-1-4398-9591-7 January 2013, 6-1/8 x 9-1/4, 462 pp. eBook ISBN: 978-1-4398-9802-4 Suggested Price: $167.95 / £107.00 December 2013, 6-1/8 x 9-1/4, 430 pp. Suggested Price: $177.95 / £113.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2014,6x9,300pp. Print ISBN:978-981-4303-30-9 based SCs. that CBSCswillopenthedoortohigh-T different mechanismsandchancestohighT superconducting transition temperature (T provides highphononfrequency, highDebyetemperature,andchancesto (CNTs), andothers. Thesmallmassofcarbonatoms such asdiamond,graphite,graphene,carbonnanotubes advancement of carbon-based superconductors (CBSCs), This bookdescribesbasicphysicsandtherecent Aoyama GakuinUniversity, Kanagawa,Japan Junji Haruyama Edited by Towards High-Tc Superconductivity Carbon-based Superconductors Suggested Price: April 2015,6-1/8x9-1/4,200pp. Print ISBN:978-1-4665-9509-5 international standardsinthesubject. enabling theproductionofsuchmaps,arediscussedwithrespecttocurrent corrosion. Bestpracticesintestingtribocorrosionoveramulti-parameterspace, abrasion (andmicroscale-abrasion),fretting,andslidingwearinteractionswith corrosion mappingapproachesarecombined.Theauthoraddresseserosion, on tribocorrosionmapswherebothtribologyand highlights theworkdoneduringinpast20years stability diagramforhightemperatureoxidation.It for aqueouscorrosion,andthethermodynamic including wearphenomena,thePourbaixdiagram This bookdescribesvarioustribocorrosionprocesses Margaret Stack Materials Engineers Tribocorrosion for Suggested Price: October 2013,7x10,719pp. eBook ISBN:978-1-4398-1927-2 Print ISBN:978-1-4398-1926-5 how toprotectagainstdegradation,andadescriptionoftestingprocedures. characteristics of degradation for specific alloys of compositions, guidelines on gives thefundamentalprinciplesforeachclassofmaterial,followedbydetailed presents examplesofdegradationundervariousenvironmentalconditions.It of degradation.Thetextdiscussesfundamentaldegradationprocessesand buildings, machines,andcomponents—allofwhichexperiencesomeform impacts onabroadrangeofmaterialsusedfortheengineeringinfrastructure, and composites,thisbookcoverstheenvironmental From metalsandpolymerstoceramics,naturalmaterials, and RonaldM.Latanision Lloyd H.Hihara,RalphP.I. Adler, Edited by Engineering Materials of AdvancedandTraditional Environmental Degradation $149.95 /£95.00 $159.95 /£99.00 $157.95 /£99.00

c superconductivity, forexample,CuO2- For more informationand acompletelistof titles,visitusat www.crcpress.com c. Consequently, itishighlyexpected c). Individual materials also provide Liquid-Crystalline Materials Liquid-Crystalline Advances inPhotofunctional Dancing withLight Suggested Price: May 2015,6-1/8x9-1/4,450pp. Print ISBN:978-1-4822-4066-5 the areaofelectrondevices. electronics engineeringprograms,andresearchers andpractitionersworkingin is intendedforseniorundergraduateandgraduatecoursesinelectrical for BJTs, MOSFETs, andFinFETs alongwiththestatisticalMOSmodels.Thebook standardmodels semiconductor physics,andpresentstheadvancedindustry security, andentertainment.Thistextcoversbasic society includingcommunications,medical,military, unprecedented revolutioninmanyareasoftoday’s The siliconintegratedcircuits (ICs)constitutean Santa ClaraUniversity, California,USA Samar K.Saha Conventional Transistors andBeyond Integrated Circuit Design Compact Modelsfor Suggested Price: April 2013,6-1/8 x 9-1/4,373pp. eBook ISBN:978-1-4398-6990-1 Print ISBN:978-1-4398-6989-5 new materialsandtechnologiestoimprove supercapacitor performances. useful to readers in selecting existing materials and technologies and developing system design,andrelatedissuesforthe developmentofsupercapacitators willbe and their benefits towards current applications. The coverage of the materials, powersystems book alsoprovidesadeepanalysisoftheir integrationwithprimary developments inmaterialsscienceandengineeringforfabrication. The the fundamental sciences involved in ES operation and the technological ofelectrochemicalsupercapacitatorsAn overview (ES),thisbooksummarizes Series: ElectrochemicalEnergyStorageandConversion Vancouver, BritishColumbia,Canada National Research Council InstituteforFuelCellInnovation, Jiujun Zhang Victor Chabot University ofWaterloo, Canada Aiping Yu Fundamentals andApplications for EnergyStorageandDelivery Electrochemical Supercapacitors Suggested Price: September 2014,6x9,500pp. Print ISBN:978-981-4411-11-0 compound, polymer, cross-linkedelastomer, andblockcopolymer. in the form of low-molecular-weight of LCs,and their detailed performances step-by-step, includingthebasicknowledgeofLCs,photoresponsiveproperties the advancedlevelinphotoresponsiveLCmaterials.Thesubjectisintroduced to beyond displays.Thisbookintroducesreaderstothisfield,fromtheprimary- phototriggered molecularcooperativemotion,leadingtotheirnovelapplications phase transition,photocontrolledalignmentand photo-manipulate uniquefeaturessuchasphotoinduced photochromic moleculesintoLCmaterialsenablesoneto Recent progressinthisfieldindicatesthatintegrating Peking University, Beijing,China Haifeng Yu $159.95 /£99.00 $188.95 /£120.00 $149.95 /£95.00

79 Corrosion / Electronic, Magnetic, & Optical Materials Graphene Intelligent Integrated Systems Energy Storage and Devices, Technologies, and Architectures Conversion Applications Edited by Zhaoping Liu Simon Deleonibus Ningbo Institute of Material Technology and Engineering CEA-LETI, Grenoble, France (NIMTE), Chinese Academy of Sciences Series: Pan Stanford Series on Intelligent Nanosystems Xufeng Zhou Electronic, Magnetic, & Optical Materials This book gives a state-of-the-art overview by Series: Electrochemical Energy Storage and Conversion, 6 internationally recognized researchers of the architectures Suitable for readers from broad backgrounds, this of breakthrough devices required for future intelligent book describes the fundamentals and cutting-edge applications of graphene- integrated systems. The first section highlights Advanced Silicon-Based CMOS based materials for energy storage and conversion. It provides an overview of Technologies. New device and functional architectures are reviewed in chapters recent advancements in specific energy technologies, such as Li-ion batteries, on Tunneling Field-Effect Transistors and 3-D monolithic Integration, which the supercapacitors, fuel cells, and solar cells. It also considers the outlook of alternative materials could possibly use in the future. The way we can augment industrial applications in the near future. Offering a brief introduction to major silicon technologies is illustrated by the co-integration of new types of devices, graphene synthesis methods, the text details the latest academic and commercial such as molecular and resistive spintronics-based memories and smart sensors, research and developments, covering all potential avenues for graphene’s use in using nanoscale features co-integrated with silicon CMOS or above it. energy-related areas. Print ISBN: 978-981-4411-42-4 Print ISBN: 978-1-4822-0375-2 eBook ISBN: 978-981-4411-43-1 December 2014, 6-1/8 x 9-1/4, 318 pp. April 2014, 6 x 9, 516 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $149.95 / £95.00

Lithium-Ion Batteries Graphene-Based Materials Fundamentals and Applications Science and Technology Yuping Wu Subbiah Alwarappan and Ashok Kumar Fudan University, Shanghai, China University of South Florida, Tampa, USA Series: Electrochemical Energy Storage and Conversion

This book describes the different methods of graphene Currently only edited-style books on lithium-ion synthesis, characterization, and application in several batteries are available on the market. This is the first major research areas. It begins with a brief introduction authored book on the subject offering comprehensive to various carbon-based nanomaterials and categorizes and systematic coverage. This text provides an in- the different types of carbon-based nanomaterials. The depth discussion of the basics and history of lithium-ion batteries, and then authors then discuss important applications of graphene, including use as a introduces electrode materials, describing their structure, physical properties, tranducer for electrochemical sensing and biosensing and energy storage. electrochemical performance, preparation, and manufacturing technologies and Covers all aspects of graphene from synthesis to applications equipment. The book also covers the materials’ mechanisms of ionic conductivity Print ISBN: 978-1-4398-8427-0 and modification. Other materials including binders, conductive agents, and eBook ISBN: 978-1-4398-8445-4 solvents are also explored. October 2013, 6-1/8 x 9-1/4, 224 pp. Print ISBN: 978-1-4665-5733-8 80 Suggested Price: $145.95 / £93.00 March 2015, 6-1/8 x 9-1/4, 456 pp. Suggested Price: $169.95 / £108.00

Handbook of Nanomagnetism Luminescence Applications and Tools The Instrumental Key to the Edited by Future of Nanotechnology Rosa A. Lukaszew Edited by College of William and Mary, Williamsburg, Virginia, USA Adam M. Gilmore This unique handbook compiles and details cutting- HORIBA Jobin Yvon Inc., Edison, New Jersey, USA edge research in nanomagnetism and its applications The book encompasses the nanoscale semiconductor in spintronics, magneto-plasmonics, and nonlinear field by amalgamating a broad multidisciplinary arena magneto-optics. Fundamental aspects of magnetism including applications for energy conservation, materials relevant to nanodevices and new spin-transfer torque random-access memory performance enhancement, electronic circuitry, video displays, lighting, (STT-RAM), current-induced domain wall motion memory, and spin torque photovoltaics, quantum computing, memory, chemo- and biosensors, oscillators, as well as highly anisotropic materials and topics on magnetization pharmaceuticals and medical diagnostics inter alia. The first section presents damping are developed in detail in the book. New paradigms such as molecule- a comprehensive introductory overview of the photophysics, instrumentation based magnets (MBMs), which are a promisingly adaptive class of solids poised and experimental methodology of nanomaterial luminescence. In the second to open new frontiers of exploration, are also covered. and third sections of the book, invited experts highlight more specific advanced Print ISBN: 978-981-4613-04-0 research areas that have either shown potential for, or have already realized, March 2015, 6 x 9, 500 pp. significant impact on the day-to-day aspects of modern life and the world Suggested Price: $179.95 / £114.00 economy. Print ISBN: 978-981-4241-95-3 eBook ISBN: 978-981-4267-72-4 December 2013, 6 x 9, 404 pp. Suggested Price: $149.95 / £95.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2015,6-1/8x9-1/4,400pp. Print ISBN:978-1-4822-2310-1 metamaterial-based devices. engineers, and students intheresearch anddevelopment of innovative simulation, fabrication,andmeasuring procedures,thetextaidsdesigners, optics. Presentingnumerousstate-of-the-art examplesaccompaniedbydetailed properties, aswellthelatestadvancesinmetamaterialsandtransformation concepts, from microcosmic structures to macroscopic electromagnetic industries—this bookprovidesreaderswithasolidunderstandingofessential applications in the aerospace and communications and microwaveengineeringwithnext-generation of metamaterials—ahottopicinradar, antenna, Containing comprehensive,cutting-edgecoverage Zhong LeiMei,andXinMiYang Tie JunCui,Wen XuanTang, Wei XiangJiang, and Quasicrystals Noncrystals, Beyond Crystals, Metamaterials Suggested Price: September 2014,6x9,306pp. eBook ISBN:978-981-4411-97-4 Print ISBN:978-981-4411-96-7 biomedical usesandasultra-highmagneticrecordingmedia. techniques thatrevealtheoptimizedmagneticpropertiesofnanoparticlesfor properties ofnanoparticleassemblies.Itgathersexperimentalandcomputational This bookreviewsprominentresearch onthestaticanddynamicmagnetic magneticmaterials. development ofhigh-performance clarify thephysicsoftheseassembliesandtheirusein to understanding ofinterparticleinteractionsisnecessary functionalization ofmagneticnanoparticleassemblies.The A greatdealofscientificinteresthasbeenfocusedonthe Institute ofMaterialsScience,Athens,Greece Kalliopi N.Trohidou Edited by Magnetic NanoparticleAssemblies Suggested Price: October 2013,6-1/8x9-1/4,396pp. eBook ISBN:978-1-4665-9252-0 Print ISBN:978-1-4665-9251-3 Element methodsinseveralformulations,consideringnodalandedgeelements. employs theconceptspresentedinitsfirstpartandapplythemon3DFinite characterization withanemphasisonhysteresis.Thesecondpartofthebook into experimentalandnumericalmodelingrelatedtolossesmaterial finite elementsmethodconcepts.Thebookthenmoves basic electromagnetics,andprovidesarefresheronthe to materialsand introduction thorough It beginswitha characterization andfiniteelementmethodsapplications. informationonmaterial This bookprovidesthenecessary Universidade FederaldeSantaCatarina,Brazil João PedroA.BastosandNelsonSadowski 3D FiniteElementModeling Magnetic Materialsand $159.95 /£99.00 $149.95 /£95.00 $157.95 /£99.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Microwave Engineering Textbook Suggested Price: November 2014,6-1/8x9-1/4,383pp. Print ISBN:978-1-4822-1490-1 potential toshapethefutureofnanotechnology. text examinesemergingmaterialsanddevicearchitecture alternativeswiththe and academia, the structures. Containing contributions from experts in industry the latestdevelopmentsincarbonnanotubes,graphene,andiii-vdevice FD SOIdevicesandcandidatesforpost-CMOSnanoelectronics;describes making nanodevices.Itexploressiliconcompoundsandprocesses;discusses the fieldfromfundamentalscienceandmaterialpropertiestonovelwaysof the art of micro- and nanoelectronics, this book covers ofthestate Presenting acomprehensiveoverview Series: Devices,Circuits, and Systems,35 PDF Solutions,SanJose,California,USA Tomasz Brozek Edited by and Solutions Emerging DeviceChallenges Micro- andNanoelectronics Suggested Price: May 2013,6x9,178pp. eBook ISBN:978-1-4822-1574-8 Print ISBN:978-981-4364-36-2 can beusefulforpracticeinthenearfuture. needed. Thisbookdiscussesdevice(nanodevice)designandsimulation,which The largedemandofsmall-scaledevice,especially, withlightsignalprocessingis (optical gate),nanoscalecommunicationandnetworks,energystorage, etc. transportation, opticaltransistor, fastcalculation devices systems thatcanbeusedforatom/moleculetrappingand which can be integratedtoformthedevice,circuits, and within themicro-andnano-scaledevice(ringresonator), This book investigates the behavior of light (light pulse) King Mongkut’s InstituteofTechnology, Bangkok,Thailand Preecha Yupapin Devices, Circuits, andSystems Nanophotonics Suggested Price: March 2014,6-1/8x9-1/4, 800pp. eBook ISBN:978-1-4665-9143-1 Print ISBN:978-1-4665-9141-7 qualifying courseadoption. microwave engineering.Asolutionsmanualandfigureslidesareavailableupon lines, providing a comprehensive understanding of the underlying principles of wave propagationtoreflectionandrefraction,guidedwaves,transmission from numerical examples,problems,andreferences,thebookcoverseverything tubes, transistors,diodes,andparametricdevices.Completewithillustrations, integrated circuits, anddiscusses differentmicrowavecomponents,antennas, devices, cavityresonators,semiconductorandRF/microwave and processing—equalemphasis.Itdescribesferrite topics—including microwavegeneration,measurement, all facetsofmicrowaveengineering,butalsogives This encyclopedictextnotonlyencompassesnearly Aligarh MuslimUniversity, India Ahmad ShahidKhan Concepts andFundamentals $129.95 /£82.00 $69.95 /£44.99 $139.95 /£89.00

81 Electronic, Magnetic, & Optical Materials Nanoscale Energy Transport Organic Light-Emitting and Harvesting Materials and Devices A Computational Study Second Edition Edited by Edited by Zhang Gang Zhigang Rick Li Peking University, Beijing, China DuPont Company, Hockessin, Delaware, USA Electronic, Magnetic, & Optical Materials This book introduces current computational technology Organic light-emitting diodes (OLEDs) are emerging as and examines the applications of nano structures in the leading display technology. This book provides a renewable energy, and the associated research topics. It addresses the current single source of information covering all aspects of OLEDs. It deals with history, commonly used computational technologies, and their applications in study of fundamental physics, multilayer OLED architectures, organic light emitting nanoscale energy transport and conversion. The book will be useful to graduate- materials, manufacturing and performance measurement techniques, and level students who want to explore this new field of research. With content more. It also discusses the patent status of currently used materials, potential relevant to both academic and commercial viewpoints, the book will also interest applications, and the challenges facing future development, with a balance researchers and postgraduates as well as consultants in the renewable energy between academic and industrial points of view. This Second Edition has been industry. completely updated and revised. Print ISBN: 978-981-4463-02-7 Print ISBN: 978-1-4398-8223-8 October 2014, 6 x 9, 350 pp. April 2015, 7 x 10, 864 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $149.95 / £95.00

Physics and Chemistry Nanostructured Ceramic Oxides of Graphene for Supercapacitor Applications Graphene to Nanographene Edited by Edited by Avinash Balakrishnan and K.R.V. Subramanian Toshiaki Enoki and Tsuneya Ando When developing a high performance supercapacitor, Tokyo Institute of Technology, Japan it is generally desirable to design the geometry and From a chemistry aspect, graphene is the extrapolated morphology of supercapacitor electrodes with fully utilized extreme of condensed polycyclic hydrocarbon molecules surface area and well-defined pore structures, which can to infinite size. Here, the concept on aromaticity which organic chemists utilize lead to faster ion movement contacting the electroactive is applicable. Interesting issues appearing between physics and chemistry are materials and promote faradic redox reactions. This book proposes preparation pronounced in nano-sized graphene (nanographene), as we recognize the methodology of various one-dimensional metal oxide nanostructures used as importance of the shape of nanographene in understanding its electronic electrode overlays and methods by which the conductivity of the stoichiometric structure. In this book, the fundamental issues on the electronic, magnetic, metal oxide can be increased. and chemical properties of condensed polycyclic hyodrocarbon molecules, Print ISBN: 978-1-4665-7690-2 nanographene and graphene are comprehensively discussed. eBook ISBN: 978-1-4665-7691-9 Print ISBN: 978-981-4241-48-9 February 2014, 6-1/8 x 9-1/4, 209 pp. eBook ISBN: 978-981-4241-49-6 82 Suggested Price: $139.95 / £89.00 January 2013, 6 x 9, 476 pp. Suggested Price: $149.95 / £95.00

Nanostructured Semiconductors Polymer Electrolyte Fuel Cells From Basic Research to Applications Physical Principles of Materials Edited by and Operation Petra Granitzer and Klemens Rumpf Michael Eikerling Karl-Franzens-Universität, Graz, Austria Simon Fraser University, Vancouver, British Columbia, Canada This book focuses on nanostructured semiconductors, Andrei Kulikovsky their fabrication, and their application in various fields This book provides a systematic and profound account of such as optics, acoustics, and biomedicine. It presents a scientific challenges in fuel cell research. The introductory compendium of recent developments in nanostructured chapters bring readers up to date on the urgency and and hybrid materials and also contains a collection of principles and approaches implications of the global energy challenge, the prospects of electrochemical related to nano-size semiconductors. The text summarizes the recent work by energy conversion technologies, and the thermodynamic and electrochemical renowned scientists, emphasizing the synthesis by self-assembly or prestructuring principles underlying the operation of polymer electrolyte fuel cells. The book and characterization methods of such nanosize materials and also discusses the then presents challenges in fuel cell research as a systematic account of distinct potential applications of nanostructured semiconductors and hybrid systems. components, length scales, physicochemical processes, and scientific disciplines. The book also gives adequate coverage to the novel properties of nanostructured The main part of the book focuses on theory and modeling. and low-dimensional materials. Print ISBN: 978-1-4398-5405-1 Print ISBN: 978-981-4316-90-3 eBook ISBN: 978-1-4398-5406-8 eBook ISBN: 978-981-4411-10-3 September 2014, 6-1/8 x 9-1/4, 582 pp. March 2014, 6 x 9, 700 pp. Suggested Price: $169.95 / £108.00 Suggested Price: $149.95 / £95.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2014,6-1/8x9-1/4,371pp. eBook ISBN:978-1-4665-6403-9 Print ISBN:978-1-4665-6402-2 pricing control,andenvironmental/geo-political considerations. identification ofspectroscopicparameters,qualitycontrol,elementseparation, Coverage includesextraction,recycling,refinement, visualinspection, and criticalissuespertainingtominingprocessingofrareearthmaterials. a focusonphysicalandchemicalproperties,thebookaddresseshistory electrical, thermal, and opticalcharacteristics.Maintaining 17 rare earth materials (REMs). It defines their chemical, describes theuniquecharacteristicsandapplicationsof from disparatejournalarticles and databases, this book Bringing togetherinformationpreviouslyavailableonly Private Consultant,Cerritos,California,USA A.R. Jha Properties andApplications Rare EarthMaterials Suggested Price: October 2014,6-1/8x9-1/4,533pp. eBook ISBN:978-1-4822-5297-2 Print ISBN:978-1-4822-5296-5 investigation andsamplepreparation. components, thermodynamiccharacteristics,andmethodsforequilibrium type, possiblephasetransformationsandphysical–chemicalinteractionsofthe databasedescriptionincludesthediagram condensed phases.Eachquaternary industrially significantsystemspresentedintwo-dimensionalsectionsforthe II–VI semiconductorsystemswithfourcomponents.Itcriticallyevaluatesmany theoretical informationaboutphaserelationsbasedon compounds. Itillustratesup-to-dateexperimentaland systemsbasedonII–VIsemiconductor quaternary This bookcollectsdatapertainingtodiagramsof of NASUkraine,Kyiv V.Ye.Lashkaryov InstituteofSemiconductorPhysics Vasyl Tomashyk on II-VISemiconductors AlloysBased Quaternary Suggested Price: May 2013,7x10,462pp. eBook ISBN:978-1-4665-9374-9 Print ISBN:978-1-4665-9372-5 and ComputationwithMATLAB published textbook,ElectromagneticWaves, Materials, This isacondensedversionoftheauthor’s previously University ofMassachusetts,Lowell,USA Dikshitulu K.Kalluri Waves andMaterials Principles ofElectromagnetic Textbook adoption. adoption. manual, figures slides, and a text bank are available upon qualifying course are available upon qualifying course adoption. A solutions manual, instructor›s materials striking abalancebetweentheoreticalandpracticalaspects.Ancillary on plasmasforexposingthestudentstobroadareaofPlasmonicsandby «old-school» informationandmethodswiththeappropriateamountofmaterial approach tothesubjectofelectromagneticsbysupplementingquintessential students inelectromagneticwavesandmaterialscourses.Ittakesanintegrative courses, primarilyseniorundergraduateandgraduate $149.95 /£95.00 $249.95 /£159.00 $104.95 /£66.99

® . It focuses on lower-level . Itfocusesonlower-level

For more informationand acompletelistof titles,visitusat www.crcpress.com

Growth, Defects,Impurities,andNanocrystals Silicon, Germanium,andTheirAlloys Suggested Price: October 2013,6x9,484pp. eBook ISBN:978-981-4303-47-7 Print ISBN:978-981-4303-46-0 three onapplicationsofnanowiressiliconandsilicides. first threearebasedonprocessing,thenextproperties,andlast promising applications.Itcomprisesninechapters.The research methodsandpreparationtechniques,some analysis ofvariouspropertiessiliconnanocrystals, This bookcomprisestheoreticalandexperimental University ofCaliforniaatLosAngeles,USA Yu HuangandKing-NingTu Edited by Applications, Fabrication,andProperties Silicon andSilicideNanowires Suggested Price: August 2013,6-1/8x9-1/4,183pp. eBook ISBN:978-1-4665-9235-3 Print ISBN:978-1-4665-9234-6 and neuroncellcommunications. lasers fortreatmentofcancer, microsurgery, nano-antennauseinradiotherapy, for opticaldevices,includingmolecularmotorsdrugdiscovery, shortpulse optical gyroscopes,andspintransportnetworks.Theyalsoaddressapplications Chapters examineopticalspin,nano-antennas,meshnetworks,micro- using aconfigurationknownas PANDA ringresonator. proposes anewdesignforsmallscaleopticaldevice spins withinvariousmicro/nanodevicesandcircuits. It This bookpresentstheuseofopticalandelectronic Universiti Teknologi Malaysia, JohorBahru Jalil Ali Bangkok, Thailand King Mongkut’s InstituteofTechnology Ladkrabang, Preecha Yupapin Small ScaleOptics Suggested Price: December 2014,6-1/8x9-1/4,418pp. Print ISBN:978-1-4665-8664-2 characterization ofSiandGenanocrystals. the characterizationofmaterials,andrecentadvancesonpreparation in siliconaslight-emittingsources, modernspectroscopicalapproachesto orcritical.Italsocoversextendeddefects where improvementisnecessary and exploresgrowthtechnologiesofsiliconsilicon-germaniumalloys It discussesrecentadvancesinpointdefectknowledgesiliconandgermanium effects, potentialofSiandGenanotechnologies,materialscharacterization. Itfocusesongrowthproblems,criticaldefects,impurities Si andGenanocrystals. This bookemphasizesdefectsinsiliconandgermaniumprovidesareviewof University ofMilano-Bicocca,Italy Sergio Pizzini Gudrun Kissinger Edited by $149.95 /£95.00 $145.95 /£93.00 $169.95 /£108.00

83 Electronic, Magnetic, & Optical Materials Smart Materials Taxonomy Ternary Alloys Based on II-VI Victor Goldade, Serge Shil’ko, Semiconductor Compounds and Aleksander Neverov

Electronic, Magnetic, & Optical Materials / Fire Science Vasyl Tomashyk, Petro Feychuk, Smart materials have been categorized employing and Larysa Shcherbak taxonomical methods used in the classification of A guide for technologists and researchers at industrial and cybernetics systems. This approach has allowed the national laboratories, this book collects all available data systematization of the variety of smart materials on ternary II–VI–F semiconductor materials. It presents (both developed and conceptualized) as well the ternary phase diagrams for the systems and includes substantiation of the three-stage process of the data about phase equilibriums on the cross sections. materials’ making. This book proposes a phenomenological model describing Each ternary system database description contains the diagram type, possible smart materials. phase transformation and physical–chemical interaction of the components, Print ISBN: 978-1-4987-1619-2 equilibrium investigation methods, thermodynamic characteristics, and the April 2015, 6-1/8 x 9-1/4, 200 pp. sample preparation method. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-4398-9566-5 eBook ISBN: 978-1-4398-9567-2 July 2013, 6-1/8 x 9-1/4, 560 pp. Suggested Price: $209.95 / £134.00

Spintronics in Nanoscale Devices Edited by Eric R. Hedin and Yong S. Joe Ball State University, Muncie, Indiana, USA Zinc Oxide Nanostructures

By exploiting the novel properties of quantum dots Advances and Applications and nanoscale Aharonov–Bohm rings together with Edited by the electronic and magnetic properties of various Magnus Willander semiconductor materials and graphene, researchers have Linköping University, Norrköping, Sweden conducted numerous theoretical and computational modeling studies and experimental tests that show promising behavior for This book deals with one of the most hot nanomaterials spintronics applications. Spin polarization and spin-filtering capabilities and today, namely zinc oxide (ZnO) nanomaterials applied the ability to manipulate the electron spin state through external magnetic or to the above areas. In the book are described different electric fields have demonstrated the promise of workable nanoscale devices methods to grow ZnO nanostructures. Their optical and for computing and memory applications. This book provides researchers piezoelectrical properties are described as well as photo-toxicity. Applications to investigating this cutting-edge field with detailed background descriptions of LEDs, lasers, power generators and chemical sensors are discussed. Finally the spin-based effects and devices and their theoretical analysis in nanoelectronic growth on flexible substrates , particularly ZnO nanostructures and devices on circuits. paper substrates are described. Print ISBN: 978-981-4411-69-1 Print ISBN: 978-981-4411-33-2 eBook ISBN: 978-981-4411-70-7 eBook ISBN: 978-981-4411-34-9 August 2013, 6 x 9, 223 pp. July 2014, 6 x 9, 232 pp. Suggested Price: $149.95 / £95.00 84 Suggested Price: $149.95 / £95.00

Technology Computer The Design and Layout Aided Design of Fire Sprinkler Systems Simulation for VLSI MOSFET Third Edition Edited by Mark Bromann Chandan Kumar Sarkar Rally Fire Protection Services, Illinois, USA MOSFET and related high-speed semiconductor devices The sprinkler industry is constantly evolving because of are spearheading the drive toward smaller, faster, and low- new advancements in technology and the first edition power electronics. This work concentrates on technology needs to be revised and updated in conjunction with computer aided design (TCAD) and its integration into the IC fabrication the 2010 edition of NFPA 13. This most recent edition of the NFPA standard process flow. It presents modeling techniques and concepts involved with the has added requirements and recommendations, and a completely new code TCAD simulation of MOSFET devices. The book describes basic concepts and numbering system. Technological advances in the fire sprinkler industry will be background related to popular commercial TCAD software as well as recent addressed in the third edition. These include the recently adopted computerized technologies to improve device performance. dry-pipe system calculations for water system delivery, and the (accompanying) system test manifold schedule. Print ISBN: 978-1-4665-1265-8 eBook ISBN: 978-1-4665-1266-5 Print ISBN: 978-1-4665-8079-4 May 2013, 6-1/8 x 9-1/4, 462 pp. November 2015, 7 x 10, 424 pp., Soft Cover Suggested Price: $167.95 / £107.00 Suggested Price: $169.95 / £108.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2015,6-1/8x9-1/4,160pp. Print ISBN:978-1-4822-4655-1 and firetestingtosupportdesigndevelopmentorevaluation. and structuralfireresistance,addressingcomputationaldesignuncertainty, protect peoplefromfire,designofdetectionsystems,smokecontrolsystems and buildinglifecyclemanagement.Topics addressedinclude:designingto fire scenarios,trialdesigndevelopmentandanalysis, risk-based analysistechniques,developmentofdesign designprocess,deterministicand performance-based environment. Italsoprovidesanunderstandingofthe used tosolvefireprotectionproblemsinthebuilt This bookdemonstrateshowfiresciencecanbe Morgan J.HurleyandEricR.Rosenbaum Fire SafetyDesign Performance-Based Suggested Price: 2014,6-1/8x9-1/4,279pp. February eBook ISBN:978-1-4822-2123-7 Print ISBN:978-1-4822-2122-0 planning. standards, andinformationaboutemergencyresponseschoolfiresafety inspection; and includes learning objectives, case studies, updated codes and describes commonly installed fire detection systems and their maintenance and identifies safetyorganizationsandavailableresources programs; forfireservice equipment; discussestheidentificationandcontrolofhazardousmaterials; safety managementprogram;explainsthetypesandfunctionsoffirecontrol handbook presentsthekeyelementsofaneffectivefire professionals, thethirdeditionofthispractical A must-haveguideforcurrentandfuturesafety West Virginia University, Morgantown,USA Daniel E.Della-Giustina Third Edition Handbook Fire SafetyManagement Suggested Price: December 2013,6-1/8x9-1/4,452pp. eBook ISBN:978-1-4665-8548-5 Print ISBN:978-1-4665-8547-8 plastics andglass. calculations, andlessstandardmaterialssuchasconcretefilledtubes,masonry, aluminium. Thisthirdeditionhassignificantupdatesofmaterialsproperties, materials suchasconcrete,steel,compositesteel-concrete,timber, and masonry detailed designadvice,togetherwiththebackgroundformainstructural temperatures. FocusingonthefiresectionsofEurocodes,bookprovides fires throughtothepropertiesofvariousengineeringmaterialsatelevated control,thebehaviorofnatural touches onregulatory This thirdeditioncoversdesignconcernsandphilosophies, University ofPlymouth,UK Long-Yuan Li John A.Purkiss Third Edition of Structures Fire SafetyEngineeringDesign $69.95 /£44.99 $89.95 /£57.99 $167.95 /£107.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: December 2014,6-1/8x9-1/4,501pp. Print ISBN:978-1-4665-5444-3 manual andfigureslidesareavailableuponqualifyingcourseadoption. A solutionsmanualisavailableuponqualifyingcourseadoption. knitting, warpbraiding,nonwovens,triaxial,multiaxialand3Dfabrics. such aswinding,warping,sizing,wovenfabricconstruction,weaving,weft each stageoftheformationdifferenttypesfabrics.Thebookcoverstopics undergraduate level textbook focuses on diverse technical principles involved at or evenpartsofahumanbody. Thisjunior/senior a spacecraft,anautomobile,geotechnicalstructure out elegantsolutionofproblems,beitindesigning used byengineersofdifferentdisciplinesforworking Textile fabricsofvariousstructuresarebeingincreasingly Indian InstituteofTechnology, Delhi,India Prabir KumarBanerjee Principles ofFabricFormation Textbook Suggested Price: August 2013,6-1/8x9-1/4,406pp. eBook ISBN:978-1-4665-6650-7 Print ISBN:978-1-4665-6649-1 and life. techniques, testing,andvariousfactorsinfluencingtheproductperformance textile productdevelopmentsuchasrawmaterial,properties,manufacturing techniques, finishing,andtesting.Itoutlinesthevariousaspectsofindustrial of propertyrequirement,fibersused,andmanufacturing oftheproductinterms book providesabroadoverview on howtoapplythesetextilesinothertradesectors.This application ofthesetextileswithadviceandsuggestions textiles, coveringthelatesttrendsindevelopmentand This bookprovidesanencyclopedicreviewofindustrial R. SenthilKumar Applications Textiles forIndustrial Suggested Price: September 2014,7x10,416pp. eBook ISBN:978-1-4822-0837-5 Print ISBN:978-1-4822-0836-8 covered inadetailedmannerwithchartsanddatawherevernecessary. process controlandqualityineachdepartmentare properties. The influence of machine components on the scientificmethodadoptedtooptimizerawmaterial a vital role in process control of spinning. It describes department. Rawmaterialevaluationandselectionplays of processmanagementfrommixingtowinding This bookgivesabroadoutlookonvariousaspects R. SenthilKumar Process ManagementinSpinning $149.95 /£95.00 $132.95 /£85.00 $129.95 /£82.00

85 Fire Science / Industrial Textiles Analysis and Performance of High-Resolution XAS/XES Engineering Materials Analyzing Electronic Structures Key Research and Development of Catalysts Edited by Edited by Gennady E. Zaikov Jacinto Sa Moscow State Academy of Fine Chemical Technology, Russia Paul Scherrer Institute, Switzerland and Institute of Physical Chemistry, Polish Academy of Sciences, Warsaw This new book facilitates the study of problematic

Materials Characterization & Testing This book covers recent developments in X-ray light chemicals in such applications as chemical fate sources, detectors, crystal spectrometers, and photon- modeling, chemical process design, and experimental design. It provides in-photon-out core level spectroscopy techniques. Providing a comprehensive a valuable overview of current chemical processes, products, and practices overview of this exciting field, the text addresses photon-in-photon-out core and analyzes theories to formulate and prove physicochemical principles. It level spectroscopy applications for the study of catalytic systems, highlighting addresses the production and application of polymers, including chemical, hard X-ray measurements. Complete with guidelines for the use of this type physicochemical, and purely physical methods of examination. The research of spectroscopy, it describes the advantages and disadvantages of each found in this book will aid scientists and researchers in developing improved spectrometer developed to perform core level X-ray spectroscopy, detailing engineering materials. The book’s coverage of key developments can be applied methods to elucidate aspects of catalysts under working conditions, such as in industrial chemistry, biochemistry, and materials science. active sites and molecules adsorption. Print ISBN: 978-1-77188-085-5 Print ISBN: 978-1-4665-9298-8 March 2015, 6 x 9, 365 pp. eBook ISBN: 978-1-4665-9299-5 Suggested Price: $149.95 / £95.00 July 2014, 6-1/8 x 9-1/4, 247 pp. Suggested Price: $169.95 / £108.00 Biomineralization Sourcebook Characterization of Biominerals Ion Exchange and Solvent and Biomimetic Materials Extraction Edited by Volume 21, Supramolecular Aspects Elaine DiMasi of Solvent Extraction National Synchrotron Light Source, Upton, New York, USA Edited by Laurie B. Gower Bruce A Moyer University of Florida, Gainesville, USA Oak Ridge National Laboratory, Tennesee, USA This handbook provides a comprehensive account of materials science Ion Exchange and Solvent Extraction Series approaches to characterization of biominerals and biomimetic model systems. It With contributions by internationally recognized specialists from different fields, covers state-of-the-art in the characterization of atomic and molecular structure, this volume provides a comprehensive look at the state of the science underlying including the latest in diffraction, scattering, and spectroscopy, in addition to solvent extraction (SX) and the application of supramolecular chemistry (SC). It methods for imaging morphology and interfaces. It also looks at computational identifies how supramolecular behavior occurs and is studied in the context of approaches and probes for examining energetics and forces in assembly. The SX and how SC is influencing the direction of SX. This volume examines how final section focuses on mechanical function and measurement methodology as principles of SC are being used in advancing the design of new highly selective well as studies of live cells and whole organ. SX systems and for understanding aggregation phenomena in SX systems. Print ISBN: 978-1-4665-1835-3 Print ISBN: 978-1-4822-0431-5 eBook ISBN: 978-1-4665-1837-7 86 eBook ISBN: 978-1-4822-0436-0 February 2014, 8-1/2 x 11, 420 pp. December 2013, 6 x 9, 293 pp. Suggested Price: $169.95 / £108.00 Suggested Price: $177.95 / £113.00

High Temperature Materials Materials Design Using and Mechanisms Computational Intelligence Edited by Techniques Yoseph Bar-Cohen Shubhabrata Datta Jet Propulsion Laboratory, Pasadena, California, USA Bankura Unnayani Institute of Engineering, Banjura, West Bengal, India Addressing the growing interest in high-temperature technologies, this book covers technology related to Several statistical techniques are used for the design energy, space, aerospace, electronics, and other areas. of materials through extraction of knowledge from While some applications involve the use of materials at existing data banks. These approaches are getting high temperatures, others require materials processed at high temperatures for more attention with the application of computational intelligence techniques. use at room temperature. Reflecting the multidisciplinary nature of the subject, This book illustrates the alternative but effective methods of designing materials, the chapters bring as broad a perspective to the field as possible. The book where models are developed through capturing the inherent correlations among addresses the related science and engineering disciplines, including chemistry, the variables on the basis of available imprecise knowledge in the form of rules or material science, electrical and mechanical engineering, metallurgy, and physics. database, as well as through the extraction of knowledge from experimental or industrial database, and using optimization tools. Print ISBN: 978-1-4665-6645-3 eBook ISBN: 978-1-4665-6646-0 Print ISBN: 978-1-4822-3832-7 March 2014, 7 x 10, 551 pp. June 2015, 6-1/8 x 9-1/4, 220 pp. Suggested Price: $189.95 / £121.00 Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2013,8-1/2x11,457pp.,Soft Cover eBook ISBN:978-1-4665-8466-2 Print ISBN:978-1-4398-7863-7 available uponqualifyingcourseadoption. trade-offs andthereasonsbehindcommon rulesofthumb.Figureslidesare interpreting XAFSexperimentsandresults.Ithelpsyouunderstandreal-world and engaging book gives you insight on implementing XAFS spectroscopy and this techniqueforthe first timeorlooking tohoneyourcraft,thisinnovative without distractingfromthemainnarrative.Whetheryouareencountering to-follow illustrationsintroducemultipleviewpoints range ofdisciplines.Cartooncharactersandeasy- for bothnovicesandseasonedpractitionersfroma x-ray absorptionfine-structure(XAFS)spectroscopy This textprovidesapractical,thoroughguideto Sarah LawrenceCollege,Bronxville,NewYork, USA Scott Calvin XAFS forEveryone Textbook Suggested Price: April 2013,7x10,1040pp. eBook ISBN:978-1-4665-5169-5 Print ISBN:978-1-4665-5168-8 and seeds. from silicas,nanomaterials,andnanocompositestobiomaterials,cells,tissues, reactions, catalysis,andphasetransitions—inobjectsofincreasingcomplexity, phenomena—suchasdiffusion,sorption,dissolution,solvation,surface interfacial (SAXS) andwide-angle(WAXS) x-rayscattering. ItdescribesNMRforexamining including adsorption,DSC,TSDC,DRS,FTIR,opticalmicroscopy, andsmall-angle of NMR to a large variety of useful materials with results from other techniques methods anddescribescomparestheapplication This bookexploresimportantnewNMRspectroscopic Science,154 Series: Surfactant of SciencesUkraine,Kiev ofNationalAcademy Chemistry Chuiko InstituteofSurface Vladimir M.Gun’koandV. Turov Phenomena Studies ofInterfacial Nuclear MagneticResonance Suggested Price: September 2013,7x10,578pp. eBook ISBN:978-1-4665-9244-5 Print ISBN:978-1-4665-9243-8 material mechanics,andmore. different loadingsandcontainsresearch resultsonthinfilmmechanics,smart materials. Italsodiscussesthemacroandmicrofailuremechanismunder metal structuralmaterials,nonmetalandvariousfunctional mechanics, andphysics.Itdetailsthemacro-micro-mechanicalpropertiesof properties andfracturemechanicsinmaterialsscience, ofmechanical The bookprovidesacompleteoverview the highestawardgiventoscientifictextbooksinChina. been designatedanationalplanneduniversitytextbook, This isanEnglishtranslationofaChinesetextbookthathas Series: AdvancesinMaterialsScienceandEngineering Yichun Zhou,LiYang, andYongli Huang Properties ofMaterials Micro- andMacromechanical $104.95 /£66.99 $167.95 /£107.00 $199.95 /£127.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: September 2014,6-1/8x9-1/4,311pp. eBook ISBN:978-1-4398-3945-4 Print ISBN:978-1-4398-3944-7 applied tothetextileindustry. andexplainshowtheycanbe presents thetwelveprinciplesofgreenchemistry economic, and social costs ofthesemethods.Throughout the book, author presents currentmethodsoftreatingtextiles,exploring,theenvironmental, power that affect the final results of plasma treatments. An opening chapter such asthenatureofplasmagas,gasflowrate,systempressure,anddischarge ofatextileandplasmaspecies.Thetextaddressesfactors between thesurface book highlightsthebenefitsofgeneratingplasmaandreactionmechanisms discusses how plasma treatment has been used to modify textile properties. The andsustainability,Focusing ongreenchemistry thisbook Series: Sustainability The HongKongPolytechnicUniversity Chi-wai Kan Sustainable Technology Plasma Treatment asa for Textiles A NovelGreenTreatment Suggested Price: March 2015,6x9,350pp. Print ISBN:978-1-77188-079-4 book presentsleading-edgeresearch fromaroundtheworld. be usefulforscientistsaswellgraduate studentsandengineers.Thisnew andphysics ofengineeringmaterialswithabroadperspectivethatwill chemistry The collectionoftopicsinthisvolumereflectsthediversityrecentadvances in Contributions rangefromnewmethodstonovelapplicationsofexistingmethods. potential forapplicationsinseveraldisciplinesofengineeringandscience. andphysicsofengineering materialsthathave methodologies inthechemistry This newvolumefocusesonmodernanalytic and Vatin NikolaiIvanovich Alexandr A.Berlin,RomanJoswik, Edited by Modern AnalyticalMethodologies Volume One of EngineeringMaterials, andPhysics The Chemistry Suggested Price: November 2013,6x9,514pp. eBook ISBN:978-1-4822-1830-5 Print ISBN:978-1-926895-60-4 scientists andengineers. on the most technologically important materials being utilized and developed by chemical originsofdifferentmaterialproperties,thisimportantvolumefocuses bonding andatomicorderpresentinthematerial.Emphasizingphysical and propertiesofawiderangesolidsonthebasislocalchemical Authors ofeachchapteruseafundamentalapproachtodefinethestructure concepts, properties,andapplicationsofcomplexmaterials. This bookoffersacomprehensivepresentationofthe and ZbigniewWertejuk Maria Rajkiewicz,Wiktor Tyszkiewicz, Edited by Concepts andApplications Complex Materials andPhysicsof Chemistry $149.95 /£95.00 $149.95 /£95.00 $149.95 /£95.00

87 Materials Characterization & Testing / Materials Chemistry The Chemistry and Physics of The Fractal Physical Chemistry Engineering Materials, of Polymer Solutions and Melts Volume Two Edited by Limitations, Properties, and Materials G. V. Kozlov, I. V. Doblin, and Gennady E. Zaikov Edited by This book provides an important structural analysis of Alexandr A. Berlin, Roman Joswik, polymer solutions and melts, using fractal analysis. The book and Vatin Nikolai Ivanovich covers the theoretical fundamentals of macromolecules fractal analysis. It then goes on to discuss the fractal physics This new volume focuses on the limitations, properties, of polymer solutions and the fractal physics of melts. The and models in the chemistry and physics of engineering materials that have intended audience of the book includes specialists in chemistry and physics of potential for applications in several disciplines of engineering and science. polymer synthesis and those in the field of polymers and polymer composites Contributions range from new methods to novel applications of existing methods. processing. The collection of topics in this volume reflects the diversity of recent advances in Materials Chemistry Print ISBN: 978-1-926895-81-9 chemistry and physics of engineering materials with a broad perspective that will eBook ISBN: 978-1-4822-3083-3 be useful for scientists as well as for graduate students and engineers. This new December 2013, 6 x 9, 334 pp. book presents leading-edge research from around the world. Suggested Price: $149.95 / £95.00 Print ISBN: 978-1-77188-080-0 March 2015, 6 x 9, 401 pp. Suggested Price: $149.95 / £95.00

Functional Materials Properties, Performance, and Evaluation Engineering Materials Edited by Applied Research and Evaluation Methods Ewa Klodzinska Edited by Institute for Engineering of Polymer Materials and Dyes, Torun, Poland Ali Pourhashemi Series: AAP Research Notes on Chemistry Christian Brothers University, Memphis, Tennessee, USA

This book covers many important aspects of applied research Through advanced characterization and new fabrication and evaluation methods in chemical engineering and techniques, the physics, chemistry, and structure of materials science that are important in chemical technology functional materials have become a central focus of investigation in materials and in the design of chemical and polymeric products. This science, chemistry, physics, and engineering. This book presents a detailed book gives readers a deeper understanding of physical and chemical phenomena overview of recent research developments on functional materials, including that occur at surfaces and interfaces. The link between interfacial behavior and nanomaterials, synthesis, characterization, and applications. A series of chapters the performance of products and chemical processes is important. Helping to fill provides state-of-the-art information on structures and performance of polymer the gap between theory and practice, this book explains the major concepts of composites. new advances in high-performance materials and their applications. Print ISBN: 978-1-77188-037-4 Print ISBN: 978-1-77188-043-5 October 2014, 6 x 9, 302 pp. 88 October 2014, 6 x 9, 315 pp. Suggested Price: $129.95 / £82.00 Suggested Price: $139.95 / £89.00

Textbook Inorganic-Whisker-Reinforced Foundations of Crystallography Polymer Composites with Computer Applications Synthesis, Properties and Applications Second Edition Qiuju Sun Maureen M. Julian A comprehensive treatment of inorganic microcrystalline Virginia Polytechnic Institute and State University, fibers or whiskers, a particular polymer composite Blacksburg, USA filler, this book covers inorganic whisker synthesis, This book presents the fundamentals of crystallography surface modification, application in the reinforcement to students studying the solid state in chemistry, physics, materials science, of polymer-matrix composites, and the analysis of resulting filled polymer geological sciences, and engineering. Computers are an essential part of composites. The author also discusses the new generation of inorganic whiskers crystallography, and appropriate computer-based exercises are integrated into developed within the last decade: potassium titanate whiskers, aluminum borate this book for self-study. The material is presented in a logical order with the whiskers and calcium carbonate whiskers, with the last being used as the primary goal of understanding not only how atoms are arranged in crystals, but how case study. crystal systems are related to each other. The theoretical material is developed Print ISBN: 978-1-4987-0067-2 extensively in two dimensions. An overview and some detailed examples are May 2015, 6-1/8 x 9-1/4, 288 pp. given in three dimensions. A solutions manual and figure slides are available Suggested Price: $149.95 / £95.00 upon qualifying course adoption. Print ISBN: 978-1-4665-5291-3 eBook ISBN: 978-1-4665-5293-7 October 2014, 7 x 10, 680 pp., Pack - Book and Ebook Suggested Price: $99.95 / £63.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2015,6x9,323pp. February Print ISBN:978-1-77188-087-9 nanostructured materials. investigations,andnanochemistry, andinterface surface nanomaterials, and The chaptersaredividedintothree major sections:computationalmodeling, Nonlinear kineticappearancesandtheir applicationsarehighlightedaswell. well asnewinformationonthemodeling ofprocessesandquantumcalculations. modification, includingsupersmallquantities ofmetal/carbonnanocompositesas and methodsofthetreatmentpolymericmaterialsalsocoversmaterial combustion andexplosionprocesses.Ithighlightsnewtrendsinprocesses It highlightsthedevelopmentofnanomaterialsaswellinvestigation of quantum chemistry, andchemicalphysicsprocesses. research andnewtrendsinnanomaterials,mesoscopy, This importantbookpresentsavaluablecollectionofnew andMesoscopicPhysics Series: Chemistry Gennady E.Zaikov, andA.K.Haghi M. A.Korepanov, A.M.Lipanov, Edited by and Modeling Multifunctional Materials Suggested Price: June 2015,6-1/8x9-1/4,400pp.,SoftCover Print ISBN:978-1-4822-4961-3 program. 10,000 scientificandpeer-reviewedpublicationsreferencedtheMaterialsStudio fortheirmolecularmodelingapplications,itthelast5yearsover and industry and toolsintheMaterialsStudiosoftwaresuiteadoptedwidelybyacademia help studentsandresearchers alikeintheirapplicationofmodelingtechniques the structure,chemicalprocesses,andpropertiesofmaterials.Thisbookwill graphics visualizationforsimulating and predicting techniqueswith combines computationalchemistry development, molecularmodelingisamethodthat Increasingly usefulinmaterialsresearch and Cambridge,UK Accelrys, Marc Meunier Ruth H.Howard with MaterialsStudio Molecular Modelling Suggested Price: April 2015,6-1/8x9-1/4,350pp. Print ISBN:978-1-4822-4595-0 science indailylife. The bookfocusesonthelatestdevelopmentsinapplicationofmaterials communication, agriculture,bio-materials,finechemicalsandpharmaceuticals. materials invariousfieldssuchassolidstate,electronics,energy, environment, science,andmaterials.Thebookgivesinformationontheapplicationof surface researchinterdisciplinary intheareaofchemistry, properties. Thebookdiscussesthecutting-edge materials withenhancedelectronicand biomedical and characterizationofpotentiallyusefulmolecular The fieldofmolecularresearch looksatthepreparation and B.L.V. Prasad Sanjay Malhotra,JordiFraxedas,AmitavaPatra, Edited by Molecular Materials $139.95 /£89.00 $129.95 /£82.00 $149.95 /£95.00

® For more informationand acompletelistof titles,visitusat www.crcpress.com

of ClassicalMaterials Physics andChemistry Suggested Price: 2013,6-1/8x9-1/4,384pp. January eBook ISBN:978-1-4398-9207-7 Print ISBN:978-1-4398-9205-3 advances intheirapplicationstodate. porous materials,suchasmetalsandmetaloxides,theimportant materials—such asporousorganicandmetal-organicframeworks—tohard in thesynthesisofnanoporousmaterialsabroadrangefromsoftporous conversion, drugdelivery, thekeydevelopments andmore.Thisbooksurveys molecular adsorption/storageandseparation,sensing,catalysis,energystorage/ pore sizes, and functional sites, they show a great diversity of applications such as areas,well-defined materials possess high specific surface has undergoneaccelerateddevelopments.Asthese In thepasttwodecades,fieldofnanoporousmaterials Technology (AIST)andKobeUniversity, Japan National InstituteofAdvancedIndustrialScienceand Qiang Xu Edited by Synthesis andApplications Nanoporous Materials Suggested Price: 2013,7x 10, 586pp. February eBook ISBN:978-1-4665-0523-0 Print ISBN:978-1-4665-0522-3 researchers, industrialpractitioners,anduniversityeducators. expert informationforawiderange of readers,includingadvancedstudents, radiation synthesisofmaterialsand damage,providingthoroughand and ionbeams).Thebookpresentscontributionsfromleadersintheareas of (alpha particles,betagammarays,x-rays,andneutron,proton, (including nanomaterials)andchemicalcompoundsusingionizingradiation It isdevotedtothepreparationofvarioustypesmaterials describes methods based on the use of ionizingradiation. materials, composites,andchemicalcompounds, This bookpresentsthestateofartsynthesis and UbaldoOrtizMendez Boris I.Kharisov, OxanaV. Kharissova, Edited by and Compounds Radiation SynthesisofMaterials Suggested Price: October 2014,6x9,325pp. Print ISBN:978-1-77188-045-9 scientists andengineers. most technologicallyimportantmaterialsbeingutilizedanddevelopedby origins ofdifferentmaterialproperties,thisimportantvolumefocusesonthe and atomicorderpresentinthematerial.Emphasizingphysicalchemical properties ofawiderangesolidsonthebasislocalchemicalbonding materials. Theauthorsuseafundamentalapproachtodefinethestructureand It alsoprovidesthefirstunifiedtreatmentforbroadsubjectofclassical concepts, properties,andapplicationsofclassicalmaterials. This bookprovidesacomprehensivepresentationofthe Torun, Poland Institute forEngineeringofPolymerMaterialsandDyes, Ewa Klodzinska Edited by Applied Research andConcepts $132.95 /£85.00 $209.95 /£134.00 $139.95 /£89.00

89 Materials Chemistry Additive Manufacturing Drills Innovations, Advances, and Applications Science and Technology Edited by of Advanced Operations T.S. Srivatsan Viktor P. Astakhov University of Akron, Ohio, USA Production Service Management Inc, Michigan, USA T.S. Sudarshan Series: Manufacturing Design and Technology This book presents an overview of recent and The weakest link in the design of high-efficiency emerging Additive manufacturing (AM) techniques drilling operations is the readiness of cutting tool users/ and their applications in such industries as aerospace, machining operation designer/planners and cutting tool automotive, and biomedical. Several of the processes developed using various manufacturers plus the lack of relevant research works on the modern hole materials ranging from metals to plastics, composites to human tissue are making operations. This book addresses the most important issues in drilling explained. The chapters will help provide systematic solution for the selection operations, and is designed to familiarize application specialists with properly

Materials Processing and design of a process most appropriate for AM. The book also provides an easy defined basic concepts, terminology, and essentials of drilling. Materials guide to reading and understanding emerging trends in AM while concurrently common for making drilling tools are considered from the point of the cutting appreciating its importance for both existing and emerging applications. tool design and implementation to deliver an unprecedented depth of scientific and technical explanation needed for proper manufacturing and selection of a Print ISBN: 978-1-4987-1477-8 tool material for any given application. May 2015, 6-1/8 x 9-1/4, 344 pp. Suggested Price: $159.95 / £99.00 Print ISBN: 978-1-4665-8434-1 eBook ISBN: 978-1-4665-8435-8 April 2014, 7 x 10, 888 pp. Suggested Price: $159.95 / £99.00

Elastic and Plastic Deformation Additive Manufacturing of Carbon Nanotubes Amit Bandyopadhyay and Susmita Bose School of Mechanical and Materials Engineering, Edited by Washington State University, Pullman, USA Hiroyuki Shima and Motohiro Sato Conceptually, 3D printing or layered manufacturing Hokkaido University, Sapporo, Japan is a way to build parts without using any part-specific Carbon nanotubes offer huge potential in so many fields tooling or dies from the computer aided design (CAD) due in part to their significant mechanical properties, file of the part. Today most engineered devices are including extraordinary rigidity, resilience, toughness, and 3D printed first to check for their shape, size, and flexibility. Mechanical deformation of carbon nanotubes is functionality before large-scale production. This book known to cause considerable changes in their physical and chemical properties covers 3D printing technologies to their applications in different industries. The through the nontrivial structure-property correlation. A strong understanding book is divided into two main parts—3D printing technologies and application of their deformation mechanism and available geometry is, therefore, crucial of 3D printing technologies. to developing nanotube-based applications. This book concentrates on the Print ISBN: 978-1-4822-2359-0 remarkable mechanical properties of carbon nanotubes, covering theoretical and April 2015, 6-1/8 x 9-1/4, 320 pp. experimental progresses from the last decade. 90 Suggested Price: $169.95 / £108.00 Print ISBN: 978-981-4310-75-8 eBook ISBN: 978-981-4364-15-7 September 2013, 6 x 9, 272 pp. Suggested Price: $149.95 / £95.00

Carbon Nanomaterials Textbook Second Edition Fundamentals of Edited by Machining Processes Yury Gogotsi and Volker Presser Conventional and Nonconventional Drexel University, Philadelphia, Pennsylvania, USA Processes, Second Edition Series: Advanced Materials and Technologies Hassan Abdel-Gawad El-Hofy This book provides information on synthesis, properties, and applications of carbon nanomaterials. With novel This textbook provides fundamental theoretical analysis of materials, such as graphene (atomically flat carbon) machining by cutting, abrasion, erosion, and combined or carbon onions (carbon nanospheres), the family of carbon nanomaterials is processes. The author presents the principles and theories of material removal rapidly growing. This book provides a state-of-the-art overview and in-depth and applications for conventional and nonconventional machining processes, analysis of the most important carbon nanomaterials. Each chapter is written discusses the role of machining variables in the technological characteristics of by a leading expert in the field which ensures that both, a review on the subject each process, and provides treatment of current technologies in high speed along with emerging perspectives are provided to the reader. machining and micromachining. The book includes machining data, solved examples, and review questions. Completely revised, it includes new figures and Print ISBN: 978-1-4398-9781-2 problems along with two new chapters: Machinability of Engineering Materials eBook ISBN: 978-1-4665-0242-0 and Selection of a Machining Process. A solutions manual and figure slides are October 2013, 7 x 10, 529 pp. available upon qualifying course adoption. Suggested Price: $177.95 / £113.00 Print ISBN: 978-1-4665-7702-2 eBook ISBN: 978-1-4665-9750-1 August 2013, 6-1/8 x 9-1/4, 562 pp. Suggested Price: $125.95 / £79.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: August 2014,6-1/8x9-1/4,472pp. eBook ISBN:978-1-4398-4639-1 Print ISBN:978-1-4398-4638-4 ion implantation,nuclearenergy, biology, and art/archaeology. applications, lookingatthebroadrangeofpotentialusesinthinfilmreactions, induced x-rayemission,andnuclearreactionanalysis.Thesecondpartturns to backscattering,channeling,elasticrecoil detection, particle Rutherford the fundamentalsofionbeamanalysis,includingkinematics,stopping, of materialscharacterization.Itstartswithcoverage fundamentals and applications of ion beam methods as IBAofart/archaeological objects.Itfocusesonthe beams asappliedtotheanalysisofmaterials,well This bookexplainsthebasiccharacteristicsofion and Yongqiang Wang Michael Nastasi,JamesW. Mayer, Fundamentals andApplications Ion BeamAnalysis Suggested Price: July 2014,6-1/8x9-1/4,432pp. eBook ISBN:978-1-4398-7683-1 Print ISBN:978-1-4398-7682-4 and detectiondevices,commentingonfuturetrendsapplications. use of hierarchical micro/nanostructured materials in environmental remediation micro/nanostructured arrays.Initscutting-edgecoverage,thetextexplores ofthe enhanced Ramanscattering(SERS)effects,andgas-sensingperformances wettability,their devices,andexaminethesurface opticalproperties,surface- for the fabrication of hierarchical micro/nanostructured object arrays and describestrategies enhanced adsorptionandphotocatalyticperformances, powders. Itthenproceedstoaddressstructurally of massproductionforhierarchical micro/nanostructured This bookbeginswithadetaileddiscussionofthemethods Series: AdvancesinMaterialsScienceandEngineering Weiping Cai,GuotaoDuan,andYue Li Fabrication, Properties,andApplications Nanostructured Materials Hierarchical Micro/ Suggested Price: August 2014,7-1/2x9-1/2,616pp. Print ISBN:978-1-4822-5443-3 on ManufacturingTools andWorkshop Applications. and designconsiderationsinjoiningprocesses.Itconcludeswithanewchapter ofmetalcutting,machiningoperations, materials, solidstokewelding,thetheory as wellwelding.Additionaltopicsincludeformingoperation,cuttingtool conventional materials. The book covers the processes of castingand jointing ferrous materials and their heat treatment and thenmoves on to discuss non- properties. Itbeginsbydiscussingferrousandnon- comprehensive introductiontomaterialsandtheir a thoroughupdateandcontinuestoprovide This neweditionofabestsellerhasgonethrough Netaji SubhasInstituteofTechnology, NewDelhi,India D.K. Singh 3rd Edition Manufacturing Engineering Fundamentals of $129.95 /£82.00 $179.95 /£114.00 $99.95 /£63.99

For more informationand acompletelistof titles,visitusat www.crcpress.com Environment Metals, Materialsand Microbiology forMinerals, Suggested Price: June 2015,6-1/8x9-1/4,288pp. Print ISBN:978-1-4987-1175-3 expanding thetechnologytopotentialuses,suchasnanophotonics. new arearelatestomorefamiliarwork.Italsoexploresthechallengesinvolvedin ofthetechnology,beams. Thebookpresentsahistory underscoringhowthis professionals in science and engineering understand the new field of cluster ion area, thisbookhelpsbothnewcomersandpracticing nanoscale processing.Written byapioneerinthis processing hasemergedasafundamentaltoolfor In thelast20years,gasclusterionbeam(GCIB) Kyoto University, Japan Isao Yamada History, Technology, andApplications by ClusterIonBeams Materials Processing Suggested Price: December 2013,6-1/8 x9-1/4,600pp. eBook ISBN:978-1-4665-1253-5 Print ISBN:978-1-4665-1250-4 science andengineeringformaterials fabrication. in various fuel cell operations and the technological developments in material future development. Thebookalsodescribesthefundamentalsciencesinvolved and concludeseachchapter withchallengespresentlyfacedthe outlookfor materials microstructure withrespecttothefuelcellsystems and applications activity,cells. Itdescribestherelationshipamongperformance, stability, and cells, low-temperatureprotonexchangemembranefuelandmicrobial fuel and advancedmaterialsinfuelcells,includinghigh-temperaturesolidoxide fuel The bookdiscussesrecentdevelopmentsinnanostructured Series: AdvancesinMaterialsScienceandEngineering Sun Yat-sen University, Guangzhou,China Pei KangShen Curtin University, Bentley, Western Australia San PingJiang Edited by Materials forFuelCells Nanostructured andAdvanced Suggested Price: 2015,6-1/8x9-1/4,624pp. February Print ISBN:978-1-4822-5729-8 of finished products. Figure slidesare availableupon qualifying course adoption. the miningindustriesfromcoredeepgroundsampleprocessingtopreservation chapters emphasizestheimportanceofmicrobesinenvironmentalremediation metal extraction,andmaterialsynthesis.Amajorpartofthisbookmany existence insuchaturgidenvironment,theirapplicationsthemineralsector, of biologyinthemetalworld,variousphysiologicalaspectsbehindtheir and theinorganicworld.Thebookstudiesgenesis some explored,andyettobe,amongstbiology relationship, This bookdisseminatestheinterdisciplinary Abhilash, B.D.Pandey, andK.A.Natarajan Edited by $129.95 /£82.00 $209.95 /£134.00 $199.95 /£127.00

91 Materials Processing Precision Manufacturing Materials Science Technologies and Engineering Edited by Volumes 1 and 2 Prashant Kumar Edited by Jawaharlal Nehru Centre for Advanced Scientific Research, Bangalore, India Abbas Hamrang, Gennady E. Zaikov,

Materials Processing / Properties Series: Advances in Materials Science and Engineering A.K. Haghi, and E. Klodzinska

This book gives an overview of current innovations in This book brings together research contributions materials manufacturing techniques. It reveals novel from eminent experts on subjects that have gained techniques for material manipulation that are economic as well as effective. prominence in material and chemical engineering and science. It presents the Applications include crystallization of materials, fabrication of nano/micro last developments along with case studies, explanatory notes, and schematics shapes, materials modifications, wettability of surfaces is important when one for clarity and enhanced understanding. The book includes new research and is interested in studying atomically thin layer coating on surfaces, directional studies, including on new research on the efficiency of gas purification, the growth features can give rise to anisotropic properties in materials which are transport properties of films of chitosan-amikacin, operating conditions of useful for electronic, magnetic, magnetoelectric, optical, and optoelectronic clearing of gas in a rotoklon, properties and characteristics of varies materials and applications. compounds, and more. Print ISBN: 978-1-4665-1382-2 Print ISBN: 978-1-77188-054-1 June 2015, 6-1/8 x 9-1/4, 376 pp. September 2014, 6-1/8 x 9-1/4, 702 pp. Suggested Price: $199.95 / £127.00 Suggested Price: $249.95 / £159.00

Process Techniques for Materials Science and Engineering High-Performance Engineering, Volume II Materials Physiochemical Concepts, Properties, Tim Oberle and Treatments Sealed Air Corporation, Saddle Brook, New Jersey, USA Edited by With processed materials, subtle variations in the Gennady E. Zaikov, A.K. Haghi, and E. Klodzinska production process can affect the performance of This book brings together research contributions individual batches, for better or for worse. This book from eminent experts on subjects that have gained explores R&D strategies for developing products when the prominence in material and chemical engineering and science. It presents the properties are highly dependent on processing variables. It also offers practical last developments along with case studies, explanatory notes, and schematics advice on how to foster creativity, avoid the inevitable scale-up problems, get for clarity and enhanced understanding. The book includes new research and the most out of expensive trial work in a plant environment, and find systems studies, including on new research on the efficiency of gas purification, the solutions to customer problems. Hundreds of real-world examples illustrate transport properties of films of chitosan-amikacin, operating conditions of successes and failures in materials development. clearing of gas in a rotoklon, properties and characteristics of varies materials and Print ISBN: 978-1-4665-8188-3 compounds, and more. eBook ISBN: 978-1-4665-8189-0 Print ISBN: 978-1-77188-009-1 June 2013, 6-1/8 x 9-1/4, 493 pp., Soft Cover eBook ISBN: 978-1-4822-4093-1 92 Suggested Price: $94.95 / £59.99 May 2014, 6 x 9, 394 pp. Suggested Price: $129.95 / £82.00

Combustion for Material Synthesis Nanosilicon Alexander S. Rogachev and Alexander S. Mukasyan Properties, Synthesis, Applications, This book summarizes the state of the art in combustion synthesis, from the Methods of Analysis and Control fundamental and technological points of view. The authors discuss a wide A.A. Ischenko, G.V. Fetisov, and L.A. Aslalnov range of topics including theory, phenomenology, properties of the product synthesized, and methods for large-scale materials production. Focus is given This book focuses on methods for producing nanosilicon, to the mechanisms of structural transformation at the micro-, nano- and atomic its electronic and optical properties, research methods levels, which take place in the unique conditions of the combustion wave. It is a to characterize its spectral and structural properties, first attempt to summarize and critically review in one monograph mechanisms and its possible applications. The book covers the basic for a variety of solid–solid and gas–solid systems. properties of semiconductors, gives special attention to the photoluminescence of silicon nanoparticles, and describes methods used for Print ISBN: 978-1-4822-3951-5 studying and controlling the structure and properties of nanocrystalline silicon. December 2014, 6-1/8 x 9-1/4, 408 pp. It also explores the practical applications of nanocrystalline silicon, including the Suggested Price: $139.95 / £89.00 use of nanoparticles in sunscreens. Print ISBN: 978-1-4665-9422-7 eBook ISBN: 978-1-4665-9423-4 July 2014, 6-1/8 x 9-1/4, 744 pp. Suggested Price: $159.95 / £99.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2014,6x9,280pp. Print ISBN:978-1-77188-052-7 of aninstructiveapproachtothetopic andsustainableideasforsolutions. solid-state systems. Written for a wide scientific readership, each chapter consists concepts neededforinvestigatingcarbonnanotubesandotherone-dimensional edge research inthisdynamicfield,volumeisanintroductiontothephysical scientists aswellforgraduatestudentsandengineers.Presentingleading- nanotubes fromabroadperspectivethatwillbeusefulfor This bookpresentsthediversityofrecentadvancesincarbon Mahatma GandhiUniversity, Kottayam,India Sabu Thomas University ofOttawa,Canada A.K. Haghi Strategies forEngineers Theoretical ConceptsandResearch Carbon Nanotubes Suggested Price: May 2015,6-1/8x9-1/4,300pp. Print ISBN:978-1-4822-3829-7 people fromblastandballisticattack. scientists, anddefensepersonneloutlinesthetechniquesusedtoprotect engineers, officers,publicservants, ballistics. Thisbookisaimedatserving armour, metalsforarmourapplications,compositesystems,andwound of stresswavesandshockwaves,ceramicsforarmourapplications,transparent the modern threat, the material science, an overview of The book provides an introduction, overview a specialfocusonpersonnelandvehicleprotection. This textcoversthesciencebehindarmourdesignwith The UniversityofNewSouthWales, Canberra,Australia Paul J.Hazell and BallisticAttack Protecting AgainstBlast Armour Suggested Price: 2015,6-1/8x9-1/4,256pp. February Print ISBN:978-1-4822-2218-0 structures, andmachines. wide arrayofengineeringfields,includingpowersystems,metallurgy, mining, strength are demonstrated in the chapters. A wide range of actual cases span a to date.Calculationofengineeringcasesandestimationsystemstress demonstrates the main methodologies that have evolved from the 1970s andtheactualconductsoffailurecases.Thebook analysis theory This bookfillsthegapbetweentraditionalfailure and Yee-Shiuan Wong Eng-Hwa Yap, Jong-BoonOoi, Kok-Cheong Wong, Jee-HouHo,XinWang, Hock-Chye Qua,Ching-SeongTan, andPractice Theory Failure Analysis Applied Engineering $129.95 /£82.00 $139.95 /£89.00 $149.95 /£82.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Chemical Technology Suggested Price: 2015,6x9,350pp. January Print ISBN:978-1-77188-074-9 natureofthefield. the bookhighlightsdiverseandmultidisciplinary processing, morphology, andapplications, structure,properties,performance, and nanocompositesalongwiththeirapplicationsintechnology. Discussingthe science presentnewresearch on compositematerials,blends, carbon nanotubes, prominent researchers inthefieldsofphysics,chemistry, andengineering and mechanicalpropertiesofchemicalengineeringmaterials.Chaptersfrom This newresearch bookexploresanddiscussesarangeoftopicsonthephysical Piastow, Poland Institute forEngineeringofPolymerMaterialsandDyes, Maria Rajkiewicz Edited by and Methodologies ResearchInterdisciplinary Engineering Materials Chemical andApplied Suggested Price: November 2014,6-1/8x9-1/4,636 pp. Print ISBN:978-1-4822-5797-7 emerging engineeringmaterialswiththe inclusionofrecenttopics. became possibleduetodevelopmentsinmaterialsscience.Thisbookintroduces steeltoferritesinelectricalengineeringaresome illustrationswhich ordinary stainless steel(DSS)inmechanicalengineering,woodtoferroelectrics, and polymer reinforced concrete (PRC) in civilengineering, pure metals to duplex large scale microchips (VLSC), cement concrete (CC) to in electronicsengineeringfromvacuumvalvestovery probable light-basedcomputersinthefuture,changes Rapid advancementinelectron-basedcomputersor Allahabad, India Motilal NehruNationalInstituteofTechnology, K.M. Gupta Research, Applicationsand Advances Engineering Materials Suggested Price: November 2014,6x9,293pp. Print ISBN:978-1-77188-051-0 coverage ofcriticalsupportingtopics. sectors butalsoprovidesbroad science and technologyfor important industry others inrelatedindustriesandactivities.Itprovidesnotonlytheunderlying to of individuals,fromthosewhoaredirectlyinvolvedinthechemicalindustry aspectrum current chemicalprocesses,products,andpractices.Thebookserves andmyriaddetailson changing fields.Thisbookoffersavaluableoverview and materialssciencewhichdemonstratekeydevelopmentsintheserapidly the various branches of industrial chemistry, biochemistry, This collection presents abroad spectrum ofchapters in and A.K.Haghi Nekane Guarrotxena,GennadyE.Zaikov, Edited by andMaterialsScience Chemistry Key DevelopmentsinApplied $149.95 /£95.00 $149.95 /£95.00 $129.95 /£82.00

93 Materials Strength & Mechanics Heat Transfer Aspects of Materials Behavior Manufacturing Processes Research Methodology Advances in Numerical Heat Transfer and Mathematical Models Volume V Edited by Edited by Mihai Ciocoiu Gheorghe Asachi Technical University of Iasi, Romania W. J. Minkowycz University of Illinois at Chicago, USA The development of advanced materials has become Ephraim M. Sparrow extremely important in the last decade, being widely University of Minnesota, Minneapolis, USA used in academic and industrial research. This book Materials Strength & Mechanics Series in Computational and Physical Processes in Mechanics and Thermal Sciences examines the potential of advanced materials and nanotechnology to improve fiber science from fibril to fabric mode, to create better materials and products for This book deals with certain aspects of material science, particularly with the a variety of aspects. With chapters written by eminent scientists, the book offers release of thermal energy associated with bond breaking. It clearly establishes valuable information for academics, researchers, and engineering professionals. the connection between heat transfer rates and product quality. The editors A combined theoretical and technical approach is utilized to illuminate the then sharply draw the thermal distinctions between the various categories of concept of advanced material for diverse application to electronic devices, welding processes, and demonstrate how these distinctions are translated into medical implants, energy transducers, sensors and actuators, and more. simulation model uniqueness. The book discusses the incorporation of radiative heat transfer processes into the simulation model. Print ISBN: 978-1-77188-075-6 February 2015, 6 x 9, 435 pp. Print ISBN: 978-1-4822-5019-0 Suggested Price: $149.95 / £95.00 May 2015, 6-1/8 x 9-1/4, 348 pp. Suggested Price: $149.95 / £95.00

Materials Science and Integrated Reliability Engineering. Volume I Condition Monitoring Physical Process, Methods, and Models and Maintenance of Equipment Edited by John Osarenren Abbas Hamrang Independent Polymer Consultant, Manchester, UK This text highlights the solutions to the common failures and reliability of equipment in major industries, This volume highlights the latest developments and through an integrated reliability condition monitoring, trends in advanced non-classical materials and structures. and maintenance with a technological inheritance It presents the developments of advanced materials and respective tools to model-based program. It relates all operating conditions characterize and predict the material properties and behavior. It also includes of a critical cylindrical equipment part (shaft) throughout its life cycle, starting original, theoretical, and important experimental results that use non-routine from design through manufacturing to actual equipment service application. methodologies often unfamiliar to the usual readers. The chapters on novel The mathematical relationship of a desired operating manufacturing process and applications of more familiar experimental techniques and analyses of composite work-piece conditions is developed as a system multivariate quality model that problems underline the need for new experimental approaches. relates with its part failure mechanism. Print ISBN: 978-1-77188-000-8 Print ISBN: 978-1-4822-4940-8 eBook ISBN: 978-1-4822-3937-9 94 February 2015, 6-1/8 x 9-1/4, 496 pp. June 2014, 6 x 9, 308 pp. Suggested Price: $159.95 / £99.00 Suggested Price: $129.95 / £82.00

Textbook Melt-Quenched Nanocrystals Materials and Process Selection A.M. Glezer I.P. Bardin State Science Research Institute of Ferrous for Engineering Design Metallurgy, Russia Third Edition I.E. Permyakova Moscow State University of Instrumental Engineering Mahmoud M. Farag and Information Science, Russia The American University in Cairo, Egypt Melt quenching provides new opportunities for producing Since the publication of the second edition, changes have advanced materials with a unique combination of occurred in the fields of materials and manufacturing. properties. This book presents a detailed and systematic Industries place more emphasis on manufacturing products and goods locally, analysis of the nanostructured state formed in the process of melt quenching nanostructured and smart materials appear more frequently in products, and and subsequent thermal and deformation effects. It covers the metallurgical more emphasis is placed on how products affect the environment. In addition, and mechanical properties of nanomaterials, focusing particularly on properties there has been a change in how the subjects of materials and manufacturing derived from nanocrystals and their agglomeration. The text introduces four are taught. This third edition of a bestseller has been comprehensively revised different types of nanocrystals, each having different structures and properties. and reorganized to reflect these changes. It also includes more real-world case Their possible uses are extensive, with applications from coatings to biological studies. A solutions manual and figure slides are available upon qualifying course compatibility. adoption. Print ISBN: 978-1-4665-9414-2 Print ISBN: 978-1-4665-6409-1 eBook ISBN: 978-1-4665-9415-9 eBook ISBN: 978-1-4822-1643-1 June 2013, 6-1/8 x 9-1/4, 369 pp. November 2013, 6-1/8 x 9-1/4, 538 pp., Soft Cover Suggested Price: $145.95 / £93.00 Suggested Price: $104.95 / £66.99

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: August 2014,6-1/8x9-1/4,750pp. Print ISBN:978-1-4822-4245-4 and usesarediscussed. microscopic statisticalapproach.Many specialmaterialsystems,theirproperties, book focusonthemacroscopicpoint ofview, withapassingreferencetothe some non-equilibriumeffectsrelevanttomaterialscientists.Thecontentsof this by thescientificandengineeringcommunity. However, italsotouchesupon thermodynamics, withanemphasisonreactivitiesofmetalsandmaterialsused of metallurgy. Itprimarilydealswithequilibrium examine theireffectiveapplicationsinvariousaspects of thermodynamics-relatedfundamentalsandto This textbookisdesignedtoimproveknowledge Indian InstituteofTechnology Kharagpur, West Bengal S.K. RoyandBose Thermodynamics Principles ofMetallurgical Textbook Suggested Price: October 2014,6x9,375pp. Print ISBN:978-1-77188-056-5 focus onthedesignofmaterialsandcompositesforsustainability. natural nanotubes.Itwillalsobeusefulforthosecompaniesorresearchers that mainly forpostgraduatestudentsandresearchers workingontheapplicationof natural nanotubes,particularlyhalloysitenanotubes.Thebookwillbeuseful of differentnaturalnanotubes.Itisthefirstcomprehensivebooktodiscuss minerology, geology, andthecharacteristicsapplication The bookprovidesawideintroductiononhistory, University ofAdelaide,Australia G. JockChurchman Monash University, Selangor, Malaysia Pooria Pasbakhsh Edited by Properties andApplications Natural MineralNanotubes Suggested Price: October 2013,6x9,462pp. eBook ISBN:978-981-4364-23-2 Print ISBN:978-981-4316-40-8 structures. the hexagonalandspinelcrystal and other metals andmetal oxidestogetherwithcathode materials ofolivine, development. TheyincludenanostructuredanodematerialsbasedonSi,Ge,Sn, cathode materials,somealreadyusedincommercial batteriesandothersstillin the chaptersdiscussstate-of-the-artresearch onnanostructuredanodeand ion application.With contributionsfromrenownedscientistsandtechnologists, and technologyofnanostructuredmaterialsforlithium- This bookcoversthemostrecentadvancesinscience California InstituteofTechnology, Pasadena,USA Rachid Yazami Edited by Fundamentals andApplications Lithium-Ion Batteries Nanomaterials for $119.95 /£76.99 $149.95 /£95.00 $149.95 /£95.00

For more informationand acompletelistof titles,visitusat www.crcpress.com Suggested Price: December 2014,6-1/8x9-1/4,450pp. Print ISBN:978-1-4822-5145-6 and nanoparticles. organic matrixandmethodsoffinecleaninggasescontaminatedwithmicro- applications includingproductionofcompositesnanodispersemetalsinan disperse condensates,andflowinthinfilmstheirdecay. Thebookdescribes vapours onsolidsubstratesinthepresenceofimpuritieswithformation vapours invacuum,heterogeneouscondensationofmetal condensation ofmetalvapoursinexpansion properties. Specialattentionisgiventohomogeneous leading to the formation of disperse materials and their This work covers the physical processes and phenomena Kutateladze InstituteofThermodynamics,Novosibirsk,Russia A.A. BochkarevandV.I. Polyakova and NanodispersedSystems Processes ofFormationMicro- Suggested Price: December 2014,6-1/8x9-1/4,400 pp. Print ISBN:978-1-4665-9502-6 terms ofcooperationandsynergy, recentprogress inthisfield. anditsurveys in book introducesbasicconceptsandexamplesofsupramolecularchemistry devices in waysthatcannotbe achieved byconventional single molecules.This systems couldbedevelopedtoamplifythefunctionsandintegrationofmolecular other relatedmaterialssciences.Synergisticsupramolecular chemistry, polymerchemistry, medicinalchemistry, and in organicchemistry, inorganicchemistry, biological significant attentionfrommanyresearchers engaged Cooperative andsynergisticchemicaleventshaveattracted Tatsuya Nabeshima Edited by Supramolecular Chemistry Synergy in Suggested Price: August 2014,7x9,772pp. Print ISBN:978-1-4822-5998-8 problems, andrepresentativediagrams. and student-friendlymanner, the bookincludesnumerousquestions,solved springs, columnsandstruts,thickthincylinders.Written inaclear and bending,torsion,deflection,strainenergyaswellclosed-coilhelical materials, coveringstressesandstrains,shearforce provides comprehensivecoverageofthestrength engineering, thissimpleandeasy-to-understandtext Ideal forundergraduatestudents fromallbranchesof Bandra, Mumbai,India Fr. ConceicaoRodriguesCollegeofEngineering, T. S.Venkatesh Second Edition Strength ofMaterials $179.95 /£114.00 $149.95 /£95.00 $159.95 /£99.00

95 Materials Strength & Mechanics Aluminum Recycling Control for Aluminum Second Edition Production and Other Mark E. Schlesinger Processing Industries Missouri University of Science and Technology, Rollo, USA Mark P. Taylor, John J.J. Chen, What makes this book unique is a specific focus on and Brent Richmond Young aluminum recovery, rather than just recycling in general. The book is a synthesis of new control thinking with process It also offers an integrated discussion of scrap recovery variability understanding. The diagnosis of abnormalities and re-melting operations and includes economic as well and the resolution of their causes are demonstrated for as technical elements of recycling. This second edition aluminum production plants, and a compendium of symptom/cause/correction features more information on aluminum scrap pricing and the economics responses is included for aluminum plant operators. Most narrated examples also of recycling, the analysis of dross processing methods currently in use by the demonstrate the interaction between human behavior and control, requiring a industry, and drosses produced. The book has been updated throughout to more scientific, questioning approach to the management of production. This include the most up-to-date information. approach is drawn from the authors’ more than 25 years of experience, not only Print ISBN: 978-1-4665-7024-5 in metals plants but also in petrochemical and in food processing plants. Readers Metals & Alloys eBook ISBN: 978-1-4665-7025-2 get a view into the human aspect of accidents and the problems of production. December 2013, 6-1/8 x 9-1/4, 282 pp. Print ISBN: 978-1-4665-1469-0 Suggested Price: $199.95 / £127.00 eBook ISBN: 978-1-4665-1470-6 October 2013, 6-1/8 x 9-1/4, 252 pp. Suggested Price: $177.95 / £113.00

Textbook An Introduction to Ceramics Industrial Brazing Practice and Refractories Second Edition A. O. Surendranathan Philip Roberts Delphi Brazing Consultants, Cheshire, UK This book covers the fundamental aspects of ceramics and refractories. All refractories are ceramics, but all ceramics Written by an expert with more than 50 years of are not refractories. The book classifies and describes these experience, this book helps you develop best-practice materials, and examines their availability in nature. It solutions to any brazing problems you may encounter. examines the availability of these materials in nature, how It reveals the six simple rules of brazing that form the they are extracted from nature, how some of these materials are synthesized, bedrock of problem-solving procedures. It also explains and explains their structure–property correlation. It also addresses how they how to conduct a process audit, from identifying service conditions, to selecting are designed for various applications and more. Figure slides are available upon materials and design, to assessing the process. Packed with useful flowcharts and qualifying course adoption. tables, this second edition covers new ISO specifications, alloy and flux codes, production developments, technologies, and more. Print ISBN: 978-1-4822-2044-5 December 2014, 6-1/8 x 9-1/4, 520 pp. Print ISBN: 978-1-4665-6774-0 Suggested Price: $119.95 / £76.99 eBook ISBN: 978-1-4665-6775-7 March 2013, 6-1/8 x 9-1/4, 460 pp. 96 Suggested Price: $231.00 / £147.00

The Color of Metal Compounds Laser Shock Peening Second Edition and Related Phenomena Adam Bartecki, John Burgess, and Krzysztof Kurzak Edited by Jose L. Ocana This book focuses on the relation between the color E.T.S. Ingenieros Industriales, Madrid, Spain and the structure of materials in the case of transition metal ions. This second edition reflects the growing Janez Grum University of Ljubljana, Studenic, Slovenia interest in color problems observed in various areas of science and technology. The text includes new chapters This authoritative book provides the latest knowledge addressing experimental studies and ligand-field based on laser shock peening (LSP) techniques, with chapters predictions on the color of 3D metal compounds and the use of metals and written by internationally renowned experts on the subject. The text looks at metal compounds as colored nanoobjects. It also features the use of computer- fundamentals and basic phenomena, laser sources, experimental characterization derived data. In addition, the authors expand information on color in inorganic and implementation, numerical simulation, and current developments and chemistry as well as the color of lanthanide and actinide ions and compounds. applications in the aeronautical, space, defense, nuclear, energy, automotive, Print ISBN: 978-1-4398-3900-3 and biomedical fields. It describes induced microstructural/tensional effects on October 2015, 6-1/8 x 9-1/4, 392 pp. LSP-treated materials, explores residual stresses induced by LSP treatments, Suggested Price: $149.95 / £95.00 compares LSP to other metal hardening techniques, and discusses novel, related processes, among other topics. Print ISBN: 978-1-4822-2298-2 June 2015, 6-1/8 x 9-1/4, 288 pp. Suggested Price: $189.95 / £121.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: August 2014,6-1/8 x9-1/4,346pp. eBook ISBN:978-1-4665-7799-2 Print ISBN:978-1-4665-7798-5 technology. the book presents guidelines for practical use and further development of the full-scale industrialimplementations.Offering acomprehensivehistoricalreview, to results obtained over the past two decadeson different scales, from laboratory billets withnondendriticstructure. It includessignificantupdatesreflecting of solidphases,andsemi-solid processing refinement, refinementofprimary It containsnewchaptersoncompositesandnanocomposites,ultrasonicgrain applications ofultrasonicmeltprocessingindifferentlight-metaltechnologies. This Series: AdvancesinMetallicAlloys Brunel University, Uxbridge,UK G.Eskin Dmitry All-Russia InstituteofLightAlloys,Moscow Georgy I.Eskin Second Edition Light AlloyMelts Ultrasonic Treatment of Suggested Price: March 2015,6-1/8x9-1/4, 230pp. Print ISBN:978-1-4665-1186-6 reinforcements aswell strategies forachievingdesirableproperties. structure,alloyingelements,grainsizeand on theeffectofprocessing,crystal systems, mechanicalbehavior, oxidationbehavior, andapplications.Itfocuses structures and slip developments, the text covers methods of processing, crystal structural applications.Providingacriticalliteraturereviewalongwithhighlighted group of silicides and aluminides, which have received significant attention for resistance toenvironmentaldegradationofaselected to structure,processing,mechanicalproperties,and as well as the results of decades of research related This monographisbasedonthefundamentalaspects IIT KharagpurResearch MonographSeries Rahul Mitra Edited by Intermetallic MatrixComposites Structural Intermetallicsand Suggested Price: October 2014,6-1/8x9-1/4,602pp. Print ISBN:978-1-4665-0618-3 slides areavailableuponqualifyingcourseadoption. provides adiscussionofupdatedLagrangianandEulerianformulations.Figure relations, fracture,anisotropy, andcontactproblems.Inadditionthetextalso plastic deformation.Thisbookincludestopicssuchasstress,strain,constitutive Fundamentals andApplicationsplacesemphasisonthefundamentalsofelastic- material mayreturntoitsoriginalstate or retain somedeformation.Plasticity: application ofaload.Whentheloadisremoved,solid All materials undergo some deformation under the Indian InstituteofTechnology, Guwahati,India U.S. Dixit IIT, Kanpur, India P.M. Dixit Fundamentals andApplications Plasticity Textbook emphasizes the fundamentals, mechanisms, and Second Editionemphasizesthefundamentals,mechanisms,and $249.95 /£159.00 $169.95 /£108.00 $139.95 /£89.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

for AerospaceApplications Advanced Nanomaterials Suggested Price: June 2014,6-1/8x9-1/4,402pp. eBook ISBN:978-1-4822-3102-1 Print ISBN:978-1-926895-79-6 device designing. andbiotechnologybehindthefabrication discusses thephysics,chemistry energy, electronics,andagriculture.Inadditiontoengineeringaspects,thebook emerging developmentsinnanotechnologyareasasdiversemedicine, synthesis, characterization,andapplications. It alsopresents of scientists. It covers nanomaterials with emphasis on this bookshowcasestheresearch ofaninternationalroster A collectionofhighlyselected,peer-reviewedchapters, A. ManuelStephan,andB.Raneesh Sabu Thomas,NandakumarKalarikkal, Edited by Synthesis, Properties,andApplications Advanced Nanomaterials Suggested Price: August 2013,7x10,436pp. eBook ISBN:978-1-4665-8596-6 Print ISBN:978-1-4665-8595-9 topics. and silvernanoparticlestoxicitytesting andbioapplications,amongmanyother tumor treatment, nanoparticlesfor the treatmentof solid tumors and metastasis, for thecontrolledreleaseofdrugs.They alsoexplorenanomedicineinbrain membranes forcellencapsulationtherapy, andinorganicnanoparticlematerials adjuvant, bioceramicnanomaterialsinmedicalapplications,nanoporous Renowned internationalresearchers discussnanoemulsionsasavaccine In particular, thebookfocuses on nanomaterialsforbiomedicalapplications. in leadingresearch laboratoriesaroundtheworld. bioengineered nanomaterialscurrentlybeingdeveloped This bookpresentsin-depthinformationon Linköping University, Sweden Ashutosh Tiwari University ofHawaiiatManoa,Honolulu,USA Atul Tiwari Edited by Bioengineered Nanomaterials Suggested Price: July 2014,6x9,394pp. eBook ISBN:978-981-4463-19-5 Print ISBN:978-981-4463-18-8 nanomaterials. field, thebookexaminesrecentresearch, development,andapplicationsof electromagnetic shielding.With chaptersbyexpertsattheforefrontof lithium-ion batteries,robustlightweightmaterials,nanoelectronics,and in sensors,lifesupportsystems,regenerativefuelcells, This bookpresentstheapplicationsofnanomaterials NASA GlennResearch Center, Cleveland,Ohio,USA Félix Miranda University ofPuertoRicoatRíoPiedras,SanJuan,USA Carlos R.Cabrera Edited by $149.95 /£95.00 $188.95 /£120.00 $149.95 /£95.00

97 Metals & Alloys / Nanomaterials Biosensors Based on Carbon-Based Electronics Nanomaterials and Nanodevices Transistors and Interconnects Edited by at the Nanoscale Jun Li Ashok Srivastava, Jose Mauricio Marulanda, Kansas State University, Manhattan, USA Yao Xu, and Ashwani Sharma Nianqiang Wu West Virginia University, Morgantown, USA This book deals with the theoretical description of photonic structures available in nature, and the physics Series: Nanomaterials and their Applications and applications of biomimetic structures prepared in Linking leading interdisciplinary research, this book the laboratory. Experimental synthesis of biomimetic provides a comprehensive source for key advancements and future trends in structures focuses on plasma processing, although other methods can also be nanostructured biosensor development. It describes the concepts, principles, adopted. In the book, anti-reflection properties of moth eye- or cicada wing-type materials, device fabrications, functions, system integrations, and applications nanostructured materials on semiconductor surfaces are discussed with emphasis of various biosensors based on signal transduction mechanisms; explains how on plasma fabrication procedures. This book focuses on plasma processing of to utilize the unique properties of nanomaterials to construct nanostructured biomimetic nanostructures and, therefore, is different from the other available

Nanomaterials biosensors to achieve enhanced performance; includes examples of biosensors books of similar nature that are more general. based on both typical and emerging nanomaterials; and inspires new ideas for Print ISBN: 978-981-4613-10-1 tackling multiscale and multidisciplinary issues in the development of high- March 2015, 6 x 9, 500 pp. performance biosensors. Suggested Price: $149.95 / £95.00 Print ISBN: 978-1-4665-5151-0 eBook ISBN: 978-1-4665-5152-7 December 2013, 7 x 10, 517 pp. Suggested Price: $167.95 / £107.00 Controlled Release Systems Advances in Nanobottles and Active Nanoparticles Cadmium Telluride Edited by Quantum Dots Alex van Herk, Jacqueline Forcada, Advances and Applications and Giorgia Pastorin Edited by This book focuses on responsive nanoparticles and brings together two interesting areas: nanoparticles and John Donegan and Yury Rakovich Trinity College Dublin, Ireland responsive polymers. The concept of the book is that of a systematic approach from nanoparticles synthesis via responsive polymers to nanobottles. The second Among nanomaterials, CdTe holds special technological part of the book presents contributions from experts in the field and provides a importance as the only known II–VI material that can form state-of-the-art overview of the field. conventional p–n junctions. This makes CdTe very important for the development Print ISBN: 978-981-4613-21-7 of novel optoelectronic devices such as light-emitting diodes, solar cells, and March 2015, 6 x 9, 250 pp. lasers. This book focuses on CdTe quantum dots and addresses their synthesis, Suggested Price: $149.95 / £95.00 assembly, optical properties, and applications in biology and medicine. It makes for a very informative reading for anyone involved in nanotechnology and will 98 also benefit those scientists who are looking for a comprehensive account on the current state of quantum dot–related research. Print ISBN: 978-981-4316-05-7 eBook ISBN: 978-981-4316-09-5 Graphene, Carbon Nanotubes, December 2013, 6 x 9, 248 pp. and Nanostructures Suggested Price: $149.95 / £95.00 Techniques and Applications Edited by James E. Morris Portland State University, Oregon, USA Carbon Nanotube and Graphene Krzysztof Iniewski CMOS Emerging Technologies Research, Inc., Nanoribbon Interconnects Vancouver, British Columbia, Canada Debaprasad Das and Hafizur Rahaman Series: Devices, Circuits, and Systems This book presents a detailed analysis and modeling of This one-stop reference assembles cutting-edge research in nanofabrication carbon nanotube and graphene nanoribbon interconnects. technology and explores myriad applications that the technology has enabled. It first discusses the theory and basics of both carbon It examines the historical evolution and emerging trends of nanofabrication and nanotube and graphene nanoribbon. Both are some forms supplies an analytical understanding of some of the most important underlying of allotrope of carbon. Depending on their structure, they technologies, with an emphasis on graphene, carbon nanotubes (CNTs), and can exhibit either metallic or semiconducting properties. nanowires. Featuring contributions from experts from academia and industry, Due to the excellent current carrying capability and long mean free path, this is a valuable resource for nanofabrication professionals, researchers, and these materials find suitability as future interconnects. The book then presents graduate students, as well as for investors who want an overview of the current the details of electrical circuit model for both carbon nanotube and graphene nanofabrication landscape. nanoribbon. Print ISBN: 978-1-4665-6056-7 Print ISBN: 978-1-4822-3948-5 eBook ISBN: 978-1-4665-6057-4 December 2014, 6-1/8 x 9-1/4, 203 pp. February 2013, 6-1/8 x 9-1/4, 364 pp. Suggested Price: $139.95 / £89.00 Suggested Price: $132.95 / £85.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: December 2014,6-1/8x9-1/4,240 pp. Print ISBN:978-1-4822-3103-8 available uponqualifyingcourseadoption. nanotechnology-related industries.An instructor’s manualandfigure slidesare chemistry, engineering,and biologybackgroundsforworkinnanoscience-and developing skillstoprepareundergraduate andgraduatestudentsfromphysics, book places a strong emphasis on in context. This highly interdisciplinary toplacethem experimentsindetailandlinkthemtothetheory laboratory It isnotadirectcompetitorfortheoreticaltexts,thoughitdoesdescribe nanoscience andnanotechnologymodulesspringinguparoundtheworld. manual isaimedatthefast-growingnumberofpractical Written byawell-regardedteacher, thisfirst-evernanolab Murdoch University, Perth,Western Australia Gerrard EddyJaiPoinern Nanotechnology in Nanoscienceand Course A Laboratory Textbook Suggested Price: December 2013,6x9,344pp. eBook ISBN:978-981-4364-78-2 Print ISBN:978-981-4364-77-5 of nanotechnologiesinthoseprocesses. production andstorage,highlightingatthesametimeexclusiveimportance fusion, photosynthesis,andmetabolism.Italsocoversthemethodsofhydrogen main featuresofhydrogenthatmakeitinalienableplayerinprocessessuchas to createtheinfrastructureforhydrogenenergetics.Thebookdescribes hydrogen processesthatareunderresearch anddevelopmentwiththeaim natural sciences.Thesecondhalfofthebookisdevotedtotechnological chemistry, andphysics,showingthathydrogenisatrendcanuniteall covers thegreatnaturalhydrogenprocessesinbiology, and emphasizedinthebook.Thefirsthalfofbook element duetoitsuniquepeculiaritiesthatarehighlighted in energyprocesses,whereitisthemostfunctional This bookhighlightstheoutstandingroleofhydrogen A.F. IoffePhysical-Technical Institute,St.Petersburg,Russia Alexander Gavrilyuk Edited by Hydrogen EnergyforBeginners Suggested Price: August 2014,6x9,500pp. Print ISBN:978-981-4463-36-2 on immunotoxicityandgenotoxicity. neurotoxicity, dermatotoxicity, andreproductivetoxicity, aswelladiscussion andcardiovasculartoxicity,toxicities ofnanomaterials,includingpulmonary of Nanomedicine.Thevolumeincludesaserieschaptersonorgan-specific future of(nano)medicinebyPatrickHunziker, presidentoftheEuropeanSociety development ofnanomedicine(s)andtheirregulation,apersonalviewthe application innanomedicine.Thevolumeincludesahistoricalperspectiveonthe of thestateartsafetyassessmentnanomaterialsincontexttheir This handbook,writtenbyleadinginternationalexperts,providesanoverview Pan StanfordSeriesonBiomedicalNanotechnology Karolinska Institutet,Stockholm,Sweden Bengt Fadeel Edited by to PersonalizedMedicine From Toxicological Testing of Nanomaterials Handbook ofSafetyAssessment $69.95 /£44.99 $149.95 /£95.00 $249.95 /£159.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Suggested Price: 2014,6x9,408pp. February eBook ISBN:978-981-4411-16-5 Print ISBN:978-981-4411-15-8 inspire fruitfulnewideasandsignificantpracticaladvances. principles anddevelopmentofreliableanalyticalinstruments,thebookwill sensor materials,andtransductionprinciples.Helpingreadersunderstandthe applications. Prominent authors from around the world discuss various designs, research directioninmodernET, highlightingup-to-dateETtechnologiesand tongues (ETs). Eachofthebook’s ninechaptersisdevotedtoaparticular systems,widelyknownaselectronic of artificialsensory This bookexploresrecentadvancesinthedevelopment and AudreyLegin Kirsanov,Larisa Lvova,Dmitry CorradoDiNatale, Edited by Materials andSensors for ChemicalAnalysis Multisensor Systems Suggested Price: June 2015,6-1/8x9-1/4,350pp. Print ISBN:978-1-4665-9121-9 biomechanics, cellandtissueengineering, andregenerativemedicine. bioscientists andbiomedicalengineersaswellacademicsincellular industry applications. Thisbookexploresthisrapidlyexpandingfield.Itwillinterest cues canbeusedtocontrolstemcelldifferentiationforregenerativemedicine studiesofstemcellstodeterminehow thesemechanical used inlaboratory novel andexcitingbiomedicalapplications.Nanomagneticactuationisbeing actuation isarelativelynewtechniquethathasledto structures throughmagneticnanoparticle-based The manipulationandcontrolofcellssub-cellular Jon Dobson Edited by Basic PrinciplesandApplications Receptors of CellSurface Nanomagnetic Actuation Suggested Price: September 2014,6x9,300pp. Print ISBN:978-981-4463-54-6 decontamination ofwater. nanocomposites fororganic\inorganicpollutantremovalandtechniques advancements for research and development. It covers biopolymers-based It presents the fundamental knowledgeand recent remediation ofwastewaterandmicrobialtreatment. a comprehensivediscussionaboutnanocompositesfor approach,thisbookprovides Using aninterdisciplinary University ofJohannesburg,SouthAfrica Ajay KumarMishra Edited by in Wastewater Treatment Nanocomposites $149.95 /£95.00 $169.95 /£108.00 $179.95 /£114.00

99 Nanomaterials Nanomaterials Nanoparticles in the Lung Synthesis, Characterization, Environmental Exposure and Applications and Drug Delivery Edited by Edited by A. K. Haghi, Ajesh K. Zachariah, Akira Tsuda and Nandakumar Kalariakkal Harvard University, Cambridge, Massachusetts, USA Series: Advances in Nanoscience and Nanotechnology Peter Gehr University of Bern, Switzerland Intended as a reference for basic and practical knowledge about the synthesis, characterization, and applications of nanotechnology for Nanoparticles have a physical dimension comparable to the size of molecular students, engineers, and researchers, this book focuses on the production of structures on the cell surface. Therefore, nanoparticles, compared to larger e.g., different types of nanomaterials and their applications, particularly synthesis micrometer particles, are considered to behave differently when they interact of different types of nanomaterials, characterization of different types of with cells. The book describes the sequence of events that airborne nanoparticles nanomaterials, applications of different types of nanomaterials, including the encounter in the lungs when they move from air to the bloodstream. This nanocomposites. includes deposition, events occurring on the alveolar surface (inc!. retention and Nanomaterials clearance, interaction with surfactant and with alveolar lining fluid), crossing the Print ISBN: 978-1-926895-19-2 air-blood tissue barrier, and finally getting into the bloodstream. eBook ISBN: 978-1-4665-6858-7 March 2013, 6-1/8 x 9-1/4, 296 pp. Print ISBN: 978-1-4398-9279-4 Suggested Price: $139.95 / £89.00 January 2015, 7 x 10, 388 pp. Suggested Price: $179.95 / £114.00

Nanomaterials for Electrochemical Sensing Nanoscience and and Biosensing Nanoengineering Edited by Advances and Applications Martin Pumera Edited by Nanyang Technological University, Singapore Ajit D. Kelkar, Daniel J.C. Herr, and James G. Ryan Nanotechnology brings new possibilities for the This authoritative text focuses on important breakthroughs in development of sensors, biosensors, and novel nanoelectronics, nanobiology, nanomedicine, nanomodeling, electrochemical bioassays. Nanoscale materials have been extensively used in a nanolithography, nanofabrication, and nanosafety. It delivers wide variety of configurations—as electrode surfaces to promote electrochemical an in-depth survey of emerging, high-impact nanotechnologies, providing a reaction, as “wires” to enzymes connecting their redox centers to electrode framework for interdisciplinary research and a better grasp of the nanoworld and surface, as nanobarcodes for biomolecules, or as tags to amplify the signal of its related application opportunities. By seamlessly integrating interdisciplinary a biorecognition event. Nanomaterial-based electrochemical sensors have foundational science with state-of-the-art engineering tools, this book offers a holistic been used in many areas, including cancer diagnostics and the detection of approach to understanding the mechanisms underpinning the nanotechnology- infectious organisms. This book reviews important achievements in the field of based products we enjoy today, as well as those that will change our society in the nanomaterial-based electrochemical sensors and biosensors. near future. 100 Print ISBN: 978-981-4364-90-4 Print ISBN: 978-1-4822-3119-9 eBook ISBN: 978-981-4364-91-1 eBook ISBN: 978-1-4822-3120-5 May 2014, 6 x 9, 292 pp. May 2014, 6-1/8 x 9-1/4, 331 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $159.95 / £99.00

Nanomedicines Nanostructured Energy Devices and Nanoproducts Optoelectronics and Transport Applications, Disposition, Juan Bisquert and Toxicology in the Human Body Universitat Jaume I, Castello, Spain Eiki Igarashi This books analyzes the fundamental science and properties of energy devices, including hybrid This book is a timely contribution for this purpose, and and organic solar cells, intercalation batteries, provides overall basic knowledge to understand what supercapacitors, and OLEDs. The authors cover may/might happen when nanomaterials in the form of concepts that apply to several types of devices, from medicines and other products get into the body. It provides a comprehensive a very basic level. This gives readers a general view of principles of operation overview about how nanomaterials can interact with organs and structures of the nanoscale energy devices, since innovation in one kind of devices often in the human body. This knowledge is very fundamental and useful for the finds applications in others. The book then moves into advanced coverage of the development of nanomedicines and nanomaterials with maximized effects and device modelling, which allows a realistic treatment of often complex devices minimized risks. based on nanostructured and polymer disordered materials. Print ISBN: 978-1-4987-0662-9 Print ISBN: 978-1-4665-8799-1 April 2015, 6-1/8 x 9-1/4, 264 pp. June 2015, 6-1/8 x 9-1/4, 296 pp. Suggested Price: $179.95 / £114.00 Suggested Price: $129.95 / £82.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2013,8-1/2x11,2444pp.,Soft Cover Print ISBN:978-1-4822-0579-4 on nanotechnologyandoneclean technology. current accomplishmentsinnanotech. Thissetincludesallthreevolumes—two scientific andengineeringdiscipline toprovidethemostcompleterecordof nanotechnology. Morethanmereproceedings,thesevolumescutacrossevery scientists offeranup-to-dateglobalperspectiveonthelatestdevelopments in leading nanoscientists,andNanotech2013isnoexception.Top nano have built a traditionof being themostprestigiousforuminworldfor The NanoScienceandTechnology Institute(NSTI)nanotechnologyconferences NSTI Edited by and Expo,Volumes 1-3 technology Conference of the2013NSTINano- Technical Proceedings Nanotech 2013 Suggested Price: June 2014,6x9,434pp. eBook ISBN:978-1-4822-3158-8 Print ISBN:978-1-926895-88-8 in differentareas. nanoproducts, aswelltheapplicationofnanoproductsandnanotechnologies development of prognostication apparatus when obtaining and investigating nanomaterial science,investigationofnanostructuresandnanomaterials, and nanomedicine.Itcoverstheobtainingmanufacturingofnanostructures, andnanotechnologyaswellinnanobiology new trendsinnanochemistry This bookpresentsthemostimportantinformationabout Series: AAPResearch NotesonNanoscienceandNanotechnology and A.K.Haghi Vladimir I.Kodolov, GennadyEfremovichZaikov, Edited by Nanoindustry and Nanotechnologiesto Nanostructures, Nanomaterials, Suggested Price: November 2014,6-1/8x9-1/4,352pp. Print ISBN:978-1-4398-3602-6 devices. provides aunifyingthemethatconnectsthepropertiesofdifferentenergy properties, emphasizingimpedancespectroscopycharacteristics,sinceit presented asafunctionofthecharacterizationtechniquesusedtotestdevice operating nanoscaleenergydevicestoadvanceddevicemodeling.Modelingis Topics discussedrangefromthefundamentalconceptsof organic solarcells,lithiumbatteries,andsupercapacitors. key fortheenergyrevolution,includinghybridand of arangenanoscalematerialsanddevicesthatare This bookcovers the physical principlesand applications Universitat JaumeI,Castello,Spain Juan Bisquert Equilibrium ConceptsandKinetics Nanostructured EnergyDevices $575.00 /£367.00 $129.95 /£82.00 $129.95 /£82.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Nanotechnology 2014 Suggested Price: March 2013,6-1/8x9-1/4,395pp. eBook ISBN:978-1-4665-0210-9 Print ISBN:978-1-4398-9780-5 been createdtopiquetheinterestandguidereaders. calculations showingtherealnumbersofnanotechnology. Thematicfigureshave scientists—complete witheurekamoments—aswellasback-of-the-envelope audience. Thebookincludesbehind-the-scenesstoriesofNobel-prize-winning math usedinthepedagogyoftexthasbeenminimizedtocaterageneral high-impact fieldoftechnology. Theamountandlevelof public whowanttolearnmoreaboutthisrevolutionary, for technicallyinterested/trainedlaymeninthegeneral of nanotechnology, providingacomprehensivereference language, thesometimestough-to-understandconcepts This bookcommunicates,ineasy-to-understand Ben Rogers,JesseAdams,andSumitaPennathur The WholeStory Nanotechnology Suggested Price: October 2014,6x9,350pp. Print ISBN:978-981-4463-76-8 change. science, publicpolicyrelatedtosustainability, renewableenergy, andclimate this book will appeal to anyone involved in nanotechnology, macromolecular the foremostinternationalscholaringovernanceofartificialphotosynthesis, term sustainabilitytermedtheSustainocene.EditedbyProf.ThomasFaunce, theme ofhowthisnewtechnologycanassistinthecreationaperiodlong- various fieldsofnanotechnologyandinrelatedareasgovernanceunder the sustainability. Thisbookcompriseschaptersbyexpertsin society towardsconditionsoflong-termenvironmental a technologywiththepotentialtotransformhuman In recentdecades,nanotechnologyhasemergedas Australian NationalUniversity, Canberra Thomas AluredFaunce Edited by the Sustainocene Nanotechnology Toward Suggested Price: August 2014,8-1/2x11,1710pp.,SoftCover Print ISBN:978-1-4822-5823-3 on Nanotechnology, andonevolumeonCleantechnology. current accomplishmentsinNanotech.Includesallthreevolumes–two scientific andengineeringdisciplinetoprovidethemostcompleterecordof nanotechnology. Morethanmereproceedings,thesevolumescutacrossevery scientists offeranup-to-dateglobalperspectiveonthelatestdevelopmentsin world forleadingnanoscientists,andNanotech2014isnoexception.Top nano tradition of being the most prestigious forum in the NSTI’s nanotechnologyconferenceshavebuilta NSTI Edited by and Expo(Volumes 1-3) NSTI NanotechnologyConference Technical Proceedingsofthe2014 $71.95 /£45.99 $149.95 /£95.00 $575.00 /£367.00

101 Nanomaterials Nanotoxicology Quantum Nanosystems Progress toward Nanomedicine, Structure, Properties, and Interactions Second Edition Edited by Edited by Mihai V. Putz Nancy A. Monteiro-Riviere West University of Timisoara, Romania Kansas State University, Manhattan, USA The need for economically feasible and multifunctional C. Lang Tran materials becomes more acute as the natural physical and Institute of Occupational Medicine, Edinburgh, UK chemical resources reveal either their limits or reveal the Since the first publication of this book in 2007, the field of nanoscience and difficulties and increasing costs in storage, transport, and nanomedicine continues to grow substantially. This second edition documents conversion. This reference presents the work from contributors from various the continuing development of essential tools for the characterization of fields, of various ages and from different countries, creating a valuable collection engineered nanomaterials (ENM) and for in vitro and in vivo toxicity testing. of research that will advance the fundamental and innovative techniques of Exploring the contribution of nanosafety research to nanomedicine, the editors nanosystems and their interactions. The authors cover self-assembly, self- enlist internationally recognized experts who examine the basics and the regenerating, storage, and directional properties of intelligent materials. It helps Nanomaterials rationale for the safe design of engineered nanomaterials (ENM). Topics include readers respond to the challenges in this field. new improved characterization endpoints, screening, and detection methods Print ISBN: 978-1-926895-90-1 for in vitro and in vivo toxicity testing. These tools also contribute greatly to eBook ISBN: 978-1-4822-3160-1 nanosafety research applied to nanomedicines. September 2014, 6 x 9, 524 pp. Print ISBN: 978-1-4822-0387-5 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4822-0392-9 March 2014, 6-1/8 x 9-1/4, 514 pp. Suggested Price: $169.95 / £108.00 RNA Nanotechnology Organic Structures Design Edited by Bin Wang Applications in Optical Marshall University, Huntington, West Virginia, USA and Electronic Devices A comprehensive volume, this books details details the Edited by traditional approaches and the latest developments in Tahsin J. Chow the field of RNA-related technology. It targets a wide Academia Sinica, Taipei, Taiwan audience: a broad introduction provides a solid academic background for students, researchers, and scientists who The application of organic materials on optical and are unfamiliar with the subject, while the in-depth descriptions and discussions electronic devices is a fast-growing research area, are useful for advanced professionals. Although various compilations address combining the classical electronic properties of metals and topics related to deoxyribonucleic acid (DNA) and protein, there are few books the advantageous properties of organic materials. The functional applications that focus on determining the structure of ribonucleic acid (RNA) and using RNA include light-emitting diodes, organic solar cells, field-effect transistors, artificial as building blocks to construct nanoarchitectures for biomedical and healthcare machines, chemical sensors, and many others. This book provides a review on applications. several topics in this area. The contents are focused mainly on the design and synthesis of organic functional molecules, and also include related topics such Print ISBN: 978-981-4411-64-6 as model study on electron transfer phenomena and fabrication technologies of eBook ISBN: 978-981-4411-65-3 102 organic nanostructures. April 2014, 6 x 9, 466 pp. Suggested Price: $149.95 / £95.00 Print ISBN: 978-981-4463-34-8 August 2014, 6 x 9, 300 pp. Suggested Price: $149.95 / £95.00

Producing Fuels and Fine Safety of Nanomaterials Chemicals from Biomass along Their Lifecycle Using Nanomaterials Release, Exposure, and Human Hazards Edited by Edited by Rafael Luque and Alina Mariana Balu Wendel Wohlleben, Thomas A.J. Kuhlbusch, Universidad de Cordoba, Spain Jürgen Schnekenburger, and Claus-Michael Lehr This book explores the development of innovative Billions of dollars in public funding have been spent on nanomaterials for biomass conversion and the production novel nanomaterials, and the resulting products are of energy and high-added-value chemicals, including biochemicals, biomaterials, entering the consumer world now: new paints and coatings; electric cars powered and biofuels. It is organized into three parts according to nanomaterial by nanomaterials in the battery, chassis, and tires; new renewable energy sources, applications: Nanomaterials for Energy Storage and Conversion, Biofuels from to name a few. But contrary to other disrupting technologies such as nuclear Biomass Valorization Using Nanomaterials, and Production of High-Added-Value energy or genetics, the scientific community has started to investigate the risks Chemicals from Biomass Using Nanomaterials. Providing a multidisciplinary associated with novel nanomaterials early in the development phase. Although perspective, the book covers important aspects of topics such as solar energy there are still gaps in our knowledge of the risks presented by nanomaterials, we storage, design of carbonaceous nanomaterials, catalytic reforming of biogas, now know enough to describe scenarios that are too high-risk to implement as and photocatalysis for producing valuable chemicals. well as scenarios for the safe use of nanomaterials. The goal of this book is to help Print ISBN: 978-1-4665-5339-2 the reader in making such safely decisions. eBook ISBN: 978-1-4665-5340-8 Print ISBN: 978-1-4665-6786-3 October 2013, 6-1/8 x 9-1/4, 352 pp. December 2014, 6-1/8 x 9-1/4, 477 pp. Suggested Price: $125.95 / £79.99 Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: June 2014,,2196pp.,DVD Print ISBN:978-1-4822-5832-5 one volumeonCleantechnology. Nanotech. Includesallthreevolumes –twovolumesonNanotechnology, and discipline toprovidethemostcomplete recordofcurrentaccomplishmentsin scientific andengineering than mereproceedings,thesevolumescutacrossevery to-date globalperspectiveonthelatestdevelopmentsinnanotechnology. More scientists, andNanotech2014isnoexception.Top nanoscientistsofferanup- a traditionofbeingthemostprestigiousforuminworldforleadingnano NSTI’s nanotechnologyconferences havebuilt NSTI Edited by Vol 1-4 Cleantech ProceedingsDVD Nanotech, Microtech,Biotech, Proceedings TechConnect World 2014 Suggested Price: May 2013,2958pp.,DVD Print ISBN:978-1-4822-0604-3 on nanotechnology, andoneoncleantechnology. current accomplishmentsinnanotech.Thissetincludesallfourvolumes-three scientific andengineeringdisciplinetoprovidethemostcompleterecordof nanotechnology. Morethanmereproceedings,thesevolumescutacrossevery scientists offeranup-to-dateglobalperspectiveonthelatestdevelopmentsin world forleadingnanoscientists,andNanotech2013isnoexception.Top nano conferences havebuiltatraditionofbeingthemostprestigiousforumin Institute (NSTI) nanotechnology The NanoScienceandTechnology NSTI Edited by Cleantech ProceedingsDVD Nanotech, 2013 Proceedings Tech Connect World Suggested Price: October 2013,6x9,800pp. eBook ISBN:978-981-4411-88-2 Print ISBN:978-981-4411-87-5 strengthen itsroleintechnologyandmainstreamoftheworld’s economy. 2013 andputsallthisintoperspective.Itconcludesthatsolarpowerisyetto century. between2009and Thebookdescribesthedramaticeventsinindustry all thewayuptostormydevelopmentsduringfirstdecadeofnew authors areamongtheleadingpioneersinPVfromitsindustrialbirth1954 photovoltaics (PV).Thebook’s editorandcontributing with theimplementationofelectricpowergenerationby The bookdescribestheindustrialrevolution associated World CouncilforRenewableEnergy, Brussels,Belgium Wolfgang Palz Edited by about Photovoltaics What You Wanted toKnow Solar PowerfortheWorld Microtech, $575.00 /£367.00 $575.00 /£367.00 $29.95 /£19.99

Biotech, Biotech,

For more informationand acompletelistof titles,visitusat www.crcpress.com

Materials Processes andPolymeric Applications forChemical Analytical Tools andIndustrial Suggested Price: May 2014,6x9,822pp. eBook ISBN:978-981-4411-68-4 Print ISBN:978-981-4411-67-7 tissue, etc.,regenerations. bone, cartilage,craniofacial,osteochondral,muscle,bladderandcardiovascular microfabrication techniquesandbiomaterialsforvarioustissue/organ,suchas for regenerativemedicine.Itcoversanddetailscutting-edgeresearch innano/ microtechnologies usedtomanipulatestemcellbehaviors,whichisacriticalarea the biomedical field, this book presents the latest nano/ a team of pioneers and well-known leading experts in engineering andnanomedicine,withcontributionsfrom Edited bythreeofthetopresearchers inthefieldoftissue and ThomasWebster Lijie GraceZhang,AliKhademhosseini, Edited by Advances inMicro-andNanotechnology Tissue andOrganRegeneration Suggested Price: October 2014,6x9,260pp. Print ISBN:978-1-77188-040-4 production chain. comprehensive booksummarizingallaspectsinvolvedinthefunctionalmaterials professionals and researchers in polymer scienceand technology with a single, This bookcoversabroadrangeofpolymericmaterialsandprovidesindustry Izmir PolytechnicInstitute,Turkey Devrim Balkose Independent PolymerConsultant,Manchester, UK Abbas Hamrang Edited by and Technology in PolymerResearch Applied Methodologies Suggested Price: December 2013,6x9,384pp. eBook ISBN:978-1-4822-2170-1 Print ISBN:978-1-926895-66-6 academic literatureoncomplexmaterialsandtheirapplications. forassimilatingthecurrent also includesthebackgroundinformationnecessary description of the applicationsand tools for chemical polymeric materials. It ofpolymersandchemicalmaterials.Itprovidesacomprehensive performance this bookpresentssomefascinatingphenomenaassociatedwiththeremarkable In a unified treatment for the broad subject of materials, and NekaneGuarrotxena Slavcho KirillovRakovsky, RyszardKozlowski, Edited by $169.95 /£108.00 $119.95 /£76.99 $149.95 /£95.00

103 Nanomaterials / Polymer Chemistry Applied Research on Engineering of Polymer Composites Polymers Edited by and Chemical Pooria Pasbakhsh Complexity Monash University, Selangor, Malaysia Gennady E. Zaikov Two-Volume Set Moscow State Academy of Fine Chemical Technology, Russia Edited by This new volume presents leading-edge research in the LinShu Liu, Antonio Ballada, rapidly changing and evolving field of polymer science Walter W. Focke, as well as on chemical processing. The topics in the book reflect the diversity and Hans-Joachim Radusch of research advances in the production and application of modern polymeric This new two-volume set provides a broad overview of current studies in the materials and related areas, focusing on the preparation, characterization, and engineering of polymers and chemicals with complexity of various origins, on applications of polymers. Also covered are various manufacturing techniques.

Polymer Chemistry scales ranging from single molecules and nano-phenomena to macroscopic The book helps to fill the gap between theory and practice in industry. chemicals. Starting with a detailed introduction to the history of research on Print ISBN: 978-1-77188-038-1 complex chemical systems and its current state of the art and perspectives, the November 2014, 6 x 9, 325 pp. books present chapters that survey the current progress in particular research Suggested Price: $129.95 / £82.00 fields. Print ISBN: 978-1-77188-063-3 August 2014, 6 x 9 Suggested Price: $259.95 / £165.00 Textbook Carraher’s Polymer Chemistry Engineering of Polymers and Ninth Edition Chemical Complexity, Volume I Charles E. Carraher Jr. Current State of the Art and Perspectives Florida Atlantic University, Boca Raton, USA Edited by Continuing the tradition of previous volumes, the LinShu Liu ninth edition provides a well-rounded presentation of Eastern Regional Research Center, Pullman, Washington, USA the principles and applications of polymers. With an Antonio Ballada emphasis on the environment and green chemistry and Fas Tech Technology, Milano, Italy materials, it offers detailed coverage of natural and synthetic giant molecules, inorganic and organic polymers, biomacromolecules, elastomers, adhesives, This book provides a broad overview of current studies in the engineering of coatings, fibers, plastics, blends, caulks, composites, and ceramics. This new polymers and chemicals of various origins. The innovative chapters cover the edition includes updated and expanded chapters as well as several new sections. growth of educational, scientific, and industrial research activities among A user-friendly book, it provides all the elements of an introductory text, covering chemists, biologists, and polymer and chemical engineers. This book publishes synthesis, properties, applications, and characterization. Figure slides and a text significant research and reviews reporting new methodologies and important bank are available upon qualifying course adoption. applications in the fields of industrial chemistry, industrial polymers, and biotechnology, as well the latest coverage of chemical databases and the Print ISBN: 978-1-4665-5203-6 development of new computational methods and efficient algorithms for eBook ISBN: 978-1-4665-5223-4 chemical software and polymer engineering. 104 September 2013, 7 x 10, 818 pp. Suggested Price: $125.95 / £79.99 Print ISBN: 978-1-926895-86-4 eBook ISBN: 978-1-4822-3168-7 May 2014, 6 x 9, 502 pp. Suggested Price: $149.95 / £95.00

Cellulose-Based Engineering of Polymers and Graft Copolymers Chemical Complexity, Volume II Structure and Chemistry New Approaches, Limitations and Control Edited by Edited by Vijay Kumar Thakur Walter W. Focke Washington State University, Pullman, USA Pretoria University, South Africa

This book offers a comprehensive treatment of recent Hans-Joachim Radusch Martin Luther Unversity, Halle-Saale, Germany technical accomplishments in the area of cellulose- based graft copolymers for various applications including toxic ion removal, This book provides a vast amount of information on new approaches, limitations, biomedical engineering, biofuels, micro/nano composites, paper making, and control on current polymers and chemicals complexity of various origins, building materials, and defense. Each chapter addresses a separate biomaterial, on scales ranging from single molecules and nano-phenomena to macroscopic discussing its different properties, composition, characterization, and graft chemicals. Starting with a detailed introduction, the book is comprised of chapters copolymerization chemistry. that survey the current progress in particular research fields. The chapters, Print ISBN: 978-1-4822-4246-1 prepared by leading international experts, yield together a fascinating picture May 2015, 6-1/8 x 9-1/4, 624 pp. of a rapidly developing research discipline that brings chemical technology and Suggested Price: $199.95 / £127.00 polymers to new frontiers. Print ISBN: 978-1-926895-87-1 eBook ISBN: 978-1-4822-3171-7 May 2014, 6 x 9, 322 pp. Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: 2013,7x10,770pp. January eBook ISBN:978-1-4665-5386-6 Print ISBN:978-1-4665-5384-2 course adoption. concepts. Asolutionsmanualandfigure slidesareavailableuponqualifying and answersthroughouttoenhance understanding ofpresentedtheoriesand of polymerscienceandchemistry. Itispepperedwithhelpfulquestions millennium,” this volume to-be. Updating the popular first edition of “the polymer book for the new include recentadvances,whicharecriticalforthemodernpolymerscientist- this enormousandimportantfielddonotstresspracticalproblemsolving or properties andapplicationsofpolymers.However, bookson mostintroductory andacademiaremainfascinatedwiththediverse Industry Indian InstituteofScience,Bangalore Manas Chanda Second Edition A Problem-SolvingApproach, and Chemistry Introduction toPolymerScience Textbook Suggested Price: December 2013,6x9,378pp. eBook ISBN:978-1-4822-2159-6 Print ISBN:978-1-926895-63-5 constants andtheequilibriumwithnatureofmedium. a singleequationfordescribingtherelationshipbetweenreactionrate synthesis andcuringbasedonfractalanalysis.Itprovides first togivethestructuralandphysicalgroundsofpolymers the mainreactionsofhigh-molecularsubstances.Itis synergetics, andpercolation theory, thisbookdescribes Using fractalanalysis,irreversibleaggregationmodels, G.V. Kozlov, A.K.MikitaevandGennadyE.Zaikov Edited by of PolymerSynthesis The FractalPhysics Suggested Price: September 2013,6x9,416pp. eBook ISBN:978-1-4822-0373-8 Print ISBN:978-1-926895-52-9 useful forscientistsaswellgraduatestudentsandengineers. of recentadvancesin polymers.Thecollectionoftopicsinthisbookreflectsthediversity performance relationships, synthesisandpurification,potentialapplicationsofhigh applications ofmodernpolymers.Itoffersnewresearch onstructure–property polymers and also provides an update on features of high performance This book presents some fascinating phenomena associated with the remarkable Central MichiganUniversity, MountPleasant,USA Bob A.Howell Independent PolymerConsultant,Manchester, UK Abbas Hamrang Edited by andApplications Properties, Performance Polymers High Performance Foundations of $132.95 /£85.00 $149.95 /£95.00 $149.95 /£95.00 modern polymers with a broad perspective that will be modern polymerswithabroadperspectivethatwillbe seamlessly integrates exploration of the fundamentals

For more informationand acompletelistof titles,visitusat www.crcpress.com

Nanoparticles Polymer andPolymer-Hybrid Suggested Price: June 2015,6-1/8x9-1/4,200pp.,SoftCover Print ISBN:978-1-4665-9576-7 work andcareers. totheir written byhislivingfriendswhocanreflectonthecontributionofFlory scientific, andprofessionalprogressionofhislife.Inaddition,manychaptersare project, as he was one of Flory’s students. This biography detailsthe personal, andisuniquelyqualifiedforthis historian ofchemistry influenced byFlory. Pattersonisaprofessional Gary Virtually aspectofpolymersciencehasbeen every in1974. who receivedtheNobelPrizeinchemistry This book is a scholarly biography of Paul John Flory, and JoelR.Fried D.Patterson,JamesE.Mark, Gary A LifeofScience John PaulFlory Suggested Price: September 2013,6x9,322pp. eBook ISBN:978-1-4822-0409-4 Print ISBN:978-1-926895-53-6 andpracticeinindustry.The bookwillhelptofillthegapbetween theory applications ofpolymers.Alsocoveredarevariousmanufacturingtechniques. materials andrelatedareas,focusingonthepreparation,characterization, and of research advancesintheproductionandapplicationofmodernpolymeric as wellonchemicalprocessing.Thetopicsinthebookreflectdiversity rapidly changingandevolvingfieldofpolymerscience This newvolumepresentsleading-edgeresearch inthe and GennadyE.Zaikov Richard A.Pethrick,EliM.Pearce, Edited by Techniques, Analysis,andApplications and ChemicalProcesses Polymer Products Suggested Price: August 2013,6-1/8x9-1/4,499pp. eBook ISBN:978-1-4398-6909-3 Print ISBN:978-1-4398-6907-9 the relevantresearch into acomprehensiveresource. dispersions. Theysummarizeimportantdevelopmentsinthefield,condensing characterization andanalysis,properties,behaviorinselectsolvents polymer-based nanostructures,detailingsyntheticprocedures,techniquesfor picture of objectsranging from simplepolymeric micelles to complex hybrid design topossiblebiomedicalapplications.Theauthorspresentawell-rounded of topicsfrompolymersynthesisandmacromolecular well ascommercial applications. Thisbookcoversanarray increased scientificinterestintermsofbasicresearch as Polymeric andhybridnanoparticleshavereceived Stanislav RangelovandAsteriosPispas From SynthesistoBiomedicalApplications $39.95 /£25.99 $129.95 /£76.99 $167.95 /£107.00

105 Polymer Chemistry Polymers for Thermochromic and Packaging Applications Thermotropic Materials Edited by Edited by

Polymer Chemistry / Polymeric Materials & Plastics Polymer Chemistry Sajid Alavi, Sabu Thomas, K. P. Sandeep, Arno Seeboth and Detlef Lötzsch Nandakumar Kalarikkal, Jini Varghese, Fraunhofer Institute for Applied Polymer Research, and Srinivasarao Yaragalla Berlin, Germany This book focuses on food, non-food, and industrial An overview of the scientific and applicative aspects of packaging applications of polymers, blends, nanostructured the entire class of thermochromic and thermotropic materials, macro, micro and nanocomposites, and materials, this book discusses the origin of the thermo- renewable and biodegradable materials. It details physical, thermal, and barrier optical effects at the molecular level and presents the macroscopic optical properties as well as sustainability, recycling, and regulatory issues. The book and material properties of chromogenic materials as well as their present and emphasizes interdisciplinary research on processing, morphology, structure, and potential future application. With a view to particular potential applications, the properties as well as applications in packaging of food and industrial products. book outlines the specific development strategies of these materials. By providing It is useful for chemists, physicists, materials scientists, food technologists, and the fundamental knowledge and outlining the future trends of thermochromism, engineers. this book familiarizes the readers with the entire field of the phenomenon. Print ISBN: 978-1-926895-77-2 Print ISBN: 978-981-4411-02-8 eBook ISBN: 978-1-4822-2455-9 eBook ISBN: 978-1-4822-4220-1 September 2014, 6-1/8 x 9-1/4, 486 pp. December 2013, 6 x 9, 228 pp. Suggested Price: $149.95 / £95.00 Suggested Price: $149.95 / £95.00

Polysulfide Oligomer Sealants Advanced Polymeric Materials Synthesis, Properties, and Applications From Macro- to Nano-Length Scales Edited by Edited by Sabu Thomas, Nandakumar Kalarikkal, Yuri N. Khakimullin, Vladimir S. Minkin, Maciej Jaroszewski, and Josmine P. Jose and Timur R. Deberdeev The aim of this new compendium is to provide a solid This valuable book is devoted to problems of the synthesis, understanding of the recent developments in advanced vulcanization, modification, and study of structure and polymeric materials from macro- to nano-length scales. properties of highly filled sealants based on polysulfide Composites are becoming more important because oligomers (PSO). The book summarizes information they can help to improve our quality of life, such as being put into service in flight concerning chemistry, synthesis technology, structure, and properties of liquid vehicles, automobiles, boats, pipelines, buildings, roads, bridges, and dozens of thiokols and thiokol-containing polyesters. It also presents a literary survey on other products, including medical products. The chapters cover a multitude of chemism and mechanisms for liquid thiokols vulcanization involving oxidants important advances, including explanations of the significance of the new fillers, or through polyaddition. The book describes formulation principles of sealants, like graphene and carbon nanotubes, in different matrix systems. their properties, and application areas. Print ISBN: 978-1-77188-096-1 Print ISBN: 978-1-77188-029-9 May 2015, 6-1/8 x 9-1/4, 285 pp. February 2015, 6 x 9, 225 pp. 106 Suggested Price: $129.95 / £82.00 Suggested Price: $129.95 / £82.00

Progress in Polymer Encyclopedia of Biomedical Polymers and Materials Science Polymeric Biomaterials (Online Version) Research, Development and Applications Edited by Edited by Munmaya Mishra Editor in Chief, International Journal of Polymeric Materials and Polymeric Biomaterials, Gennady E. Zaikov, Oleg V. Stoyanov, Taylor & Francis, Philadelphia, Pennsylvania, USA and Elena I. Kulish The Encyclopedia of Biomedical Polymers & Polymeric Biomaterials presents With chapters by the editors and other experts in the field state-of-the-art research and development on the synthesis, properties, and of polymer science, this book covers a broad selection applications of novel polymers in a vital area. This groundbreaking work of important research advances in the field, including updates on enzymatic includes an extremely large number of contributors for a reference publication destruction and photoelectric characteristics, studies on the changes in the in biomedical polymers and polymeric biomaterials. With multiple articles on polymer molecular mass during hydrolysis and a new type of bioadditive many subjects, the encyclopedia offers a broad-based perspective on a multitude for motor fuel, and an exploration of the interrelation of viscoelastic and of topics, as well as detailed research information, figures, tables, illustrations, electromagnetic properties of densely cross-linked polymers. Also included are and references. chapters that discuss the problems of mechanics of textile performance, new aspects of polymeric nanofibers, a mathematical model of nanofragment cross- Print ISBN: 978-1-4665-0179-9 linked polymers, and much more. August 2014, 8-1/2 x 11, 8000 pp., Online/Web Suggested Price: $2595.00 / £1652.00 Print ISBN: 978-1-926895-41-3 eBook ISBN: 978-1-4665-9162-2 January 2013, 6-1/8 x 9-1/4, 294 pp. Suggested Price: $139.95 / £89.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: April 2014,6-1/8 x 9-1/4,616pp. eBook ISBN:978-1-4398-9860-4 Print ISBN:978-1-4398-9859-8 and newcasestudies,examples,figures. sustainable foams, as well as new coverage of cutting-edge foaming mechanisms on thelatestdevelopmentsinprocessing, rheology, andbiodegradable foam, andmicrocellularinnovation,the secondeditionincludesnewchapters Containing updatedchaptersonextrusion equipment,blowingagents,PET specialists; andcapturestheinterestingevolutionoffield. and industry foam extraction;presentsthecollectiveexpertiseofleadingacademic,research, this bookdiscussesthetheory, design,processing,andapplication ofdegradable Combining scientificprincipleswithengineeringpractice, Series: PolymericFoams University ofToronto, Ontario,Canada Chul B.Park Sealed AirCorporation,SaddleBrook,NeewJersey, USA S.-T. Lee Edited by Principles andPractice,SecondEdition Foam Extrusion Suggested Price: September 2013,6x9,280pp. eBook ISBN:978-1-4822-0616-6 Print ISBN:978-1-926895-55-0 corrosive environments. gases andinthecreationofspecificproductionstructuresthatwillwithstand of analyzingstructureswiththeinfluencechemicallyaggressiveliquidsand presented herewillaidinthedevelopmentofreliablemethodsandnewpractices materials. With mathematicalstrictness,theexperimentalandtheoreticalstudies of fiberswithemphasisonthechangesphysico-chemicalproperties properties of polymers composite materials andpolymerizedbundles made experimental-theoretical methodonthedefinitionofphysico-mechanical changeability of physico-chemicalpropertiesis examined. It presents an and reinforced structures made of polymer materials withregardto the ofthestrengthlaminated This bookcoversthetheory Baku, Azerbaijan Research andDevelopmentCenterforHighTechnologies, Faig BakhmanOgliNaghiyev Azerbaijan NationalAcademyofSciences,Baku, Gabil GaribxanOgliAliyev Theories, PropertiesandApplications of PolymericMaterials Engineering Mechanics Suggested Price: 2015,8-1/2x11,8330pp. February Print ISBN:978-1-4398-9879-6 and references. of topics,aswelldetailedresearch information,figures,tables,illustrations, many subjects,theencyclopediaoffersabroad-basedperspectiveonmultitude in biomedicalpolymersandpolymericbiomaterials.With multiplearticleson includes anextremelylargenumberofcontributorsforareferencepublication applications ofnovelpolymersinavitalarea.Thisgroundbreakingwork state-of-the-art research and development on the synthesis, properties, and The Pennsylvania, USA and PolymericBiomaterials,Taylor &Francis,Philadelphia, Editor inChief,InternationalJournalofPolymericMaterials Munmaya Mishra Edited by 11 Volume Set Polymeric Biomaterials Biomedical Polymersand Encyclopedia of presents Encyclopedia ofBiomedicalPolymers&PolymericBiomaterialspresents $249.95 /£159.00 $129.95 /£82.00 $3995.00 /£2545.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

and PolymerAdditives Analysis ofPlastic Handbook fortheChemical Suggested Price: November 2014,6-1/8x9-1/4,384pp. Print ISBN:978-1-77188-041-1 changing andevolvingfield. convenience only. This book presents leading-edge research in this rapidly of mediumortheircombinationsisdefinedbyexpediencyandfurtherusage model representations attraction. Incidentally, the choice of any structural model of polymericmediumswithintheframeworksfractalanalysiswithcluster that connectthestructuralandbasicmechanicalproperties This newbookexplorestheconsiderationofrelationships Russian AcademyofSciences,Moscow Yu G.Yanovskii Kabardino-Balkarian StateUniversity, Russia G. V. Kozlov Complex PolymericMaterials andPhysicsof Chemistry Fractal MechanicsofPolymers Suggested Price: October 2014,6-1/8x9-1/4,235pp. Print ISBN:978-1-77188-024-4 understanding. notes,andschematicsformore clarityandbetter case studies,explanatory in polymerproductsandchemicalprocesses.Itincorporatesappropriate and academia,thisbookpresentsthelatestdevelopments With contributionsfromexpertsboththeindustry and Technology Series: AAPResearch NotesonPolymerScienceEngineering and GennadyE.Zaikov Nikolay D.Morozkin,Vadim P. Zakharov, Edited by in PolymerChemistry Key Technologies Suggested Price: April 2015,7x10,650pp. Print ISBN:978-1-4398-6074-8 includes morecasestudiesandreal-worldexamples. use,italsoexploresnewregulationsand deactivators. Suitableforlaboratory aids, antistaticcompounds, soil releaseproducts,blowingagents,andmetal additive categories,includingnewcategoriesondyesandcolorants,processing 50 additional compounds, this second edition nearly doubles the number of the regulationsissuedbyFDA,USEPA, EU,andotheragencies.Alongwith used inplastics,especiallyrelatingtotheirreleaseintotheenvironmentand comprehensive manualhelpsreadersanalyzeadditives Addressing additivesfromananalyticalviewpoint,this and SusanMeronek Michael Bolgar, JackHubball,JoeGroeger, Second Edition $139.95 /£89.00 $129.95 /£82.00 $249.95 /£159.00

107 Polymeric Materials & Plastics Materials Science of Polymers Photopolymers Plastics, Rubber, Blends, and Composites Photoresist Materials, Processes, Edited by and Applications A. K. Haghi, Eduardo A. Castro, Sabu Thomas, Kenichiro Nakamura P. M. Sivakumar, and Andrew G. Mercader Tokai University, Tokyo, Japan Series: Optics and Photonics The fundamentals of polymerization, polymer characteristics, rheology and morphology, as well as composition, Photopolymers have led to groundbreaking achievements technology, testing and evaluation of various plastics, in the electronics, optical engineering, and medical fields. rubbers, fibers, adhesives, coatings, and composites are At present, photopolymers have myriad applications in

Polymeric Materials & Plastics comprehensively presented in this volume. The book presents the developments semiconductor device manufacturing, printed circuit boards (PCBs), ultraviolet of advanced polyblends and the respective tools to characterize and predict the (UV) curing, microelectromechanical systems (MEMS), and medical materials. material properties and behavior. It provides original and theoretical experimental Addressing topics such as chemically amplified resists, immersion lithography, results that use non-routine methodologies often unfamiliar to many readers. extreme ultraviolet (EUV) lithography, and nanoimprinting, this book covers Chapters on novel applications of more familiar experimental techniques and photopolymers from core concepts to industrial applications, providing the analyses of composite problems are included. chemical formulae and structures of the materials discussed as well as practical case studies from some of the world’s largest corporations. Print ISBN: 978-1-77188-066-4 January 2015, 6 x 9, 425 pp. Print ISBN: 978-1-4665-1728-8 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4665-1731-8 August 2014, 6-1/8 x 9-1/4, 189 pp. Suggested Price: $149.95 / £95.00

Multicomponent Polymer Electronics Polymeric Materials Edited by From Introduction to Application Meng Hsin-Fei National Chiao-Tung University, Hsinchu, Taiwan Edited by Gennady E. Zaikov, Nodar G. Lekishvili, Polymer semiconductor is the only semiconductor that and Yurii J. Medvedevskikh can be processed in solution. Electronics made by these flexible materials have many advantages such as large- Through a balanced combination of theory and area solution process, low cost, and high performance. experiments, this book provides a detailed overview of the Researchers and companies are increasingly dedicating main and most up-to-date advances in the area of polymeric materials. Because time and money in polymer electronics. This book focuses on the fundamental the subject is essentially interdisciplinary and brings together scientists and materials and device physics of polymer electronics. It describes polymer light- engineers with different educational backgrounds, the book offers a research- emitting diodes, polymer field-effect transistors, organic vertical transistors, oriented exposition of the fundamentals as well. polymer solar cells, and many applications based on polymer electronics. The Print ISBN: 978-1-926895-35-2 book also discusses and analyzes in detail preparation techniques and device eBook ISBN: 978-1-4665-7805-0 properties of polymer electronics. January 2013, 6-1/8 x 9-1/4, 232 pp. Print ISBN: 978-981-4267-84-7 108 Suggested Price: $129.95 / £82.00 eBook ISBN: 978-981-4364-04-1 February 2013, 6 x 9, 286 pp. Suggested Price: $149.95 / £95.00

Optical Properties of Functional Polymer Nanocomposite Foams Polymers and Nano Engineering Edited by Applications Vikas Mittal The Petroleum Institute, Abu Dhabi, United Arab Emirates Edited by Advancements in polymer nanocomposite foams have Vaibhav Jain TSG Group, Alion Science and Technology, Maryland, USA led to their use in a variety of fields, such as automotive, packaging, and insulation. Presenting developments Akshay Kokil in various aspects of nanocomposite foams, this book University of Massachusetts, Lowell, USA provides information on using composite nanotechnology Nanotechnology and Application Series, 1 for making functional foams to serve a variety of applications. Summing up Functional polymers are an increasingly important class of materials relevant the most recent research developments in the area of polymer nanocomposite not only in academic research but also in industry. This book introduces the foams, this book provides background information for readers new to the field ability of nano-engineering to improve the optical properties of the mentioned and serves as a reference text for researchers. applications. This book focuses on the optical properties and nano-engineering Print ISBN: 978-1-4665-5812-0 applications of functional polymers, in order to compile an informative reference eBook ISBN: 978-1-4665-5813-7 to the reader. October 2013, 6-1/8 x 9-1/4, 264 pp. Print ISBN: 978-1-4665-5690-4 Suggested Price: $177.95 / £113.00 December 2014, 6-1/8 x 9-1/4, 280 pp. Suggested Price: $159.95 / £99.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: March 2013,6-1/8x9-1/4,286pp. eBook ISBN:978-1-4665-7795-4 Print ISBN:978-1-926895-34-5 materials, particularlypolymercomposite materials. number of aspects of nanomaterials and their practical applications to create new Writtena byexpertsintheirfields,thechaptersprovideimportantupdateson materials, coveringthesynthesis,properties,andapplicationsofnanomaterials. the scienceandapplicationofnanoparticlesincreationnanocomposite This bookprovidesanabundanceofinformationabout and JimsherN.Aneli Gennady E.Zaikov, LiliyaI.Bazylyak, Edited by and Applications Processing, Characterization Technologies Polymers forAdvanced Suggested Price: October 2014,6x9,336pp. Print ISBN:978-1-77188-049-7 are presented. included, which indicate theneed for thenew experimental approaches that more familiarexperimentaltechniquesandanalysesofcompositeproblemsare unfamiliar tomanyreaders.Furthermorechaptersonnovelapplicationsof theoretical experimentalresultsthatusenon-routinemethodologiesoften material propertiesandbehavior. Thebookprovidesimportantoriginaland advanced polyblendsandrespectivetoolstocharacterizepredictthe in advancedpolyblendsandtheirstructures.Itpresentsthedevelopmentsof This volume highlights the latest developments and trends and Technology Series: AAPResearch NotesonPolymerScienceEngineering Liliya I.Bazylak,GennadyE.Zaikov, andA.K.Haghi Edited by Properties, Optimization,andApplications Polymeric Composites Polymers and Suggested Price: May 2014,6x9,199pp. eBook ISBN:978-1-4822-3928-7 Print ISBN:978-1-926895-99-4 professionalsworkinginadhesion. departments), andindustry on adhesiveinteractionimprovement,collegelibraries,bookstores(technical specific teachingcourses,studentsandpostgraduatewhoarefocusing polymer-metal systems.Thebookisintendedforprofessorsandinstructorsof propertiesthatimpliestherelationshipwithadhesiveabilityin acid-base surface practical recommendationsregardingparametersofquantitativeestimation adhesive-adherentcontactandoutlines interactions playinestablishinginterfacial Thebookshowstheimportantrolethatacid-base surfaces. applicability to examination of solid organic and inorganic the determinationofacid-basepropertiesinviewtheir This bookpresentstheanalysisoftechniquesusedfor and RustamYa Deberdeev Irina A.Starostina,OlegV. Stoyanov, in Polymer-MetalSystems Acid-Base InteractionsandAdhesion andInterfaces Polymer Surfaces $139.95 /£89.00 $129.95 /£82.00 $99.95 /£63.99

For more informationand acompletelistof titles,visitusat www.crcpress.com

of RubberProducts Reverse Engineering Suggested Price: June 2015,6-1/8x9-1/4,528pp. Print ISBN:978-1-4665-0423-3 pertaining totheenvironmentalimpactandrecyclingofelectronicwaste. standards governingtelecommunicationsandenergyequipmentaswellissues and degradationfailureanalysis.Theauthoralsoaddressesrelevantindustry selection criteriarelatedtoendproducts,polymeranalysisandtestingmethods, applications. It describes materialproperties and plastics usedintelecommunicationsandenergy information onthevarioustypesofpolymersand This bookoffers a singlesource of valuabletechnical Polyplast ConsultantsInternational,OrlandPark,Illinois,USA Sitaram Rampalli Energy Applications Telecommunications and Polymers in Suggested Price: June 2015,6-1/8x9-1/4,700pp. Print ISBN:978-1-4822-3549-4 become amainstayinthefield. technologies, andquicklybecameatrusted reference.Thissecondeditionalso The firsteditionfilledagapintheliterature coveringintermediatelevelrubber research. Thebookalsofeaturescoverageofenvironmentalissues andrecycling. specialists, thebookanalyzestrendsandadvancesfrommorethanadecade of halobutyl polymersformoderntires.With contributionsfrommorethan23field engineering ofnewrubberproductsandoutlinesthebenefitsattributes of and materialcompoundsforoptimalformulation and modification of raw materials, elastomers, chemistry This secondeditionofabestsellerinvestigatesthe Exxon MobilChemicalCompany, Baytown,Texas, USA Brendan Rodgers Edited by Second Edition andApplications, Chemistry Rubber Compounding Suggested Price: September 2013,7x10,357pp. eBook ISBN:978-1-4200-0717-6 Print ISBN:978-0-8493-7316-9 andshortentheproductdevelopmentcycle. improve productperformance, benchmark information,discoverformulationsusedthroughouttheindustry, This isaninvaluable reference foranyone who wants togathercomparative the reengineeringofchemicalformulationanunknownrubberproduct. identification, carbonblackpercent calculation,volatileseparation,andultimately a combinationofrawrubber, chemicals,andpigments.Itcoverspolymer produce a particular vulcanized rubber compound from discover whichmaterialsandprocesseswereusedto This unique book describes the techniques used to Krishna C.Baranwal,andAnilK.Bhowmick Saikat DasGupta,RabindraMukhopadhyay, Concepts, Tools, andTechniques $199.95 /£127.00 $199.95 /£127.00 $199.95 /£127.00

109 Polymeric Materials & Plastics Textbook Carbon-Based Nanomaterials Structural Analysis of Polymeric and Hybrids Composite Materials Synthesis, Properties, Polymeric Materials & Plastics / Surface Engineering Polymeric Materials & Plastics / Surface Second Edition and Commercial Applications Mark E. Tuttle Edited by University of Washington, Seattle, USA Hans Fecht, Kai Brühne, and Peter Gluche Emphasizing the macromechanical (structural) level over The success of the nanoscience and nanotechnology micromechanical issues and analyses, this unique text related research and products is connected with the covers crucially important effects of environment at the outset to establish a technological exploitation of size effects in structures and materials. This coherent and updated knowledge base. Each chapter includes numerical most recent trend represents the main focus of the present book applied to example problems to illustrate the concepts presented. Updated with new carbon-based materials including nanocrystalline diamond, aerogels, and examples, problems, and improved flow, this second edition includes a solutions carbon nanotubes. The book compiles and details cutting-edge research, and manual for qualifying course adoptions and a suite of computer programs that several applications are described within the field of energy, microelectronics, implement the analyses discussed. and biomedicine. Beyond that, a perspective is given including a diversity of Print ISBN: 978-1-4398-7513-1 industrial applications and market opportunities for C-based nanoscale materials January 2013, 6-1/8 x 9-1/4, 668 pp., Invalidated Ebook and devices in the future. Suggested Price: $125.95 / £81.00 Print ISBN: 978-981-4316-85-9 eBook ISBN: 978-981-4411-41-7 June 2014, 6 x 9, 220 pp. Suggested Price: $149.95 / £95.00

Supermacroporous Cryogels Biomedical and Biotechnological Colloid and Interface Chemistry Applications for Nanotechnology Edited by Edited by Ashok Kumar Peter Kralchevsky, Reinhard Miller, Indian Institute of Technology, Kampur, India and Francesca Ravera Recent research in cryogelation has focused on the Series: Progress in Colloid and Interface Science application of these polymer systems in various biomedical as well as biotechnological fields. Despite With contributions by leading experts, this book the fact that there is significant literature available as research publications, some covers a wide range of topics. It describes highlights in reviews, and book chapters, there has been no dedicated book on this topic until nanotechnology based on state-of-the-art principles in now. This edited work explores the unique inherent features of the cryogels, colloid and interface science, demonstrating how great progress in the various often referred to as macroporous polymer systems (MPs), their synthesis and branches of nanotechnology can be achieved. The application of these principles optimization from various natural and synthetic polymers, and their applicability allows for the development of new experimental and theoretical tools. The in the medical and biotechnological areas of research. chapters give examples of the synthesis of nanoparticles for specific applications as well as their characterization in bulk phases and at interfaces. Print ISBN: 978-1-4822-2881-6 Print ISBN: 978-1-4665-6905-8 110 May 2015, 6-1/8 x 9-1/4, 488 pp. Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4665-6906-5 July 2013, 6-1/8 x 9-1/4, 560 pp. Suggested Price: $157.95 / £99.00

Biosurfactants Friction, Wear, and Erosion Atlas Research Trends and Applications Kenneth G. Budinski Bud Labs, Rochester, New York, USA Edited by Catherine N. Mulligan, Sanjay K. Sharma, By understanding what mode of friction, wear, or and Ackmez Mudhoo erosion predominates in a mechanism or device, you can reduce negative effects. This book is a collection Biosurfactants have the properties of reducing surface of examples from 50 years of tribology consulting and tension, stabilizing emulsions, promoting foaming and research, complete with detailed explanations of every are generally non-toxic and biodegradable. Interest in friction, wear, and erosion process. Featuring nearly microbial surfactants has been steadily increasing in 300 photos of part failures, macro- and micrographs of surface damage, and recent years due to their diversity, environmentally friendly nature, possibility of schematics on material removal mechanisms, Friction, Wear, and Erosion Atlas large-scale production, selectivity, and potential applications in environmental assists tribology specialists and laymen alike in visually identifying specific causes protection. This book provides an up-to-date, coherently written and objectively of component failure. presented set of book chapters from eminent international researchers who are actively involved in academic and technological research in the area of Print ISBN: 978-1-4665-8726-7 biosurfactants. eBook ISBN: 978-1-4665-8727-4 November 2013, 7 x 10, 309 pp. Print ISBN: 978-1-4665-1823-0 Suggested Price: $199.95 / £127.00 eBook ISBN: 978-1-4665-1824-7 February 2014, 6-1/8 x 9-1/4, 352 pp. Suggested Price: $159.95 / £95.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: May 2013,6x9,1184pp. eBook ISBN:978-981-4364-18-8 Print ISBN:978-981-4316-63-7 describe theircontributionsthathave been developedinrecentyears. molecularly orsupra-molecularlycontrolledarchitectures. Expertsinthefield layers on solid substrateswith and thebio-(medical) application of interfacial general. Thisbookdescribesthedesign,synthesis,assemblyandcharacterization, in living tissueortosimplyconstructaninteractivebiocompatibilityofsurfaces communication betweenmicroelectronicdevicesand tolerate implants,toguaranteethebidirectional understanding ofwhatisneededtomakeanorganism beginningofgeneratingabetter It isstillthevery Austrian InstituteofTechnology, Vienna Wolfgang Knoll Edited by Biofunctional Surfaces Handbook of Suggested Price: March 2014,6x9,304 pp. eBook ISBN:978-981-4411-14-1 Print ISBN:978-981-4411-13-4 energy storage,ascatalystsupports,andforenvironmentalapplications. and thenreviewstherecentdevelopmentsinuseofcarbonmaterialsfor availablewastematerialsandprocessesforcarbonproduction This booksurveys for energystorage,electrodematerials,andselectiveadsorptionofpollutants. canproducebettercarbonmaterials chemistry tailor porestructureandsurface carbon materialswithenhancedpropertieshavebeenstudied.Techniques to production andutilizationprocesses,newadvanced for manyyears.Inthedevelopmentofcleanerenergy an importantfeedstockforactivatedcarbonproduction wastematerialshavebeen Agricultural andfoodindustry and JohnZhu Thomas E.Rufford,DenisaHulicova-Jurcakova, Edited by Advances andApplications Green CarbonMaterials Suggested Price: August 2013,6-1/8x9-1/4,333pp. eBook ISBN:978-1-4665-0404-2 Print ISBN:978-1-4665-0401-1 and self-healing. can helpengineersdesign“smart”biomimeticmaterialsthatareself-lubricating understanding the structure–property relationships that lead to self-organization and vibrationscanleadtoself-organizedstructures.Theyalsoexplorehow thermodynamic approaches.Theauthorsshowhowfriction-inducedinstabilities a freshperspectiveonfrictionandtribologybycombiningmechanical and variouspatterns,whichcanreducefrictionwear. Thisbookpresents includinginsitutribofilms of newstructuresattheinterface, Under certain conditions, friction can lead to the formation University ofWisconsin, Milwaukee, USA Michael NosonovskyandVahid Mortazavi Thermodynamics ofSlidingContact Mechanics andNon-Equilibrium and Self-Organization Friction-Induced Vibrations $500.00 /£318.00 $149.95 /£95.00 $209.95 /£134.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Molecular Materials Multifunctional Suggested Price: May 2015,6-1/8x9-1/4,600pp. Print ISBN:978-1-4665-9667-2 (such ascarbondioxidecapturetechnology). importance inbothenergy(suchasfrackingtechnology)andpollutioncontrol edition ofthishandbook.Inparticular, isfoundtobeofmuch chemistry surface number ofnewdevelopmentsinthefield,andthisinitiatedneedfora since thethirdeditionofthisbookwaspublishedin2008.Therehavebeena andcolloidchemistry published intheareaofsurface A significantnumberofresearch papershavebeen KSB Consultant,Holte,Denmark K. S.Birdi Edited by Fourth Edition and ColloidChemistry Handbook ofSurface Suggested Price: September 2014,6x9,350pp. Print ISBN:978-981-4411-17-2 of individualconstituentstoenhancetheir functionalityforvariousapplications. under specificdepositionconditions, structure-propertyrelationsandstability special attentionispaidtounderstanding growthmechanismsofthesestructures resistance against oxidation optimized for high-temperature applications. A thermalstabilityand containing nanocompositecoatings with extraordinary coatings tailoredwithsuperiormechanicalpropertiesandnovelhigh Si- versatility ofthesenanocompositesisdemonstratedforlowSi-containing based on transition metal nitrides by plasma-based thin film processing. Full synthesis ofSi-containinghardnanocompositecoatings of the This book provides a comprehensive overview University ofWest Bohemia,Plzen, CzechRepublic Jindrˇich Musil University ofLeoben,Austria Rostislav Daniel Edited by Advances andIndustrialApplications Novel NanocompositeCoatings Suggested Price: 2013,6x9,314pp. January eBook ISBN:978-981-4364-30-0 Print ISBN:978-981-4364-29-4 some potentialitiesofapplicationsthesematerialsinmolecule-baseddevices. coordination complexestogenuineorganicmaterials.Thebookalsodiscusses luminescence. Thebook’s coveragerangesfromtransitionmetalsandlanthanide magnetism, single-moleculemagnetsbehavior, chirality, spincrossover, and physical propertiesfocusingonelectricalconductivity, coexistence orinterplaysynergybetweenmultiple multifunctional molecularmaterialsthatinvolve on This bookprovidesacomprehensiveoverview Laboratoire SciencesChimiquesdeRennes,France Lahcene Ouahab Edited by $249.95 /£159.00 $149.95 /£95.00 $149.95 /£95.00

111 Surface Engineering Surface Tension and Related Surfactant Science Thermodynamic Quantities of and Technology Aqueous Electrolyte Solutions Retrospects and Prospects Norihiro Matubayasi Edited by Nagasaki University, Nagasaki, Japan Laurence S. Romsted Series: Surfactant Science, 157 Rutgers University, New Brunswick, New Jersey, USA

This book provides a detailed and systematic analysis of the This book provides a broad perspective on recent properties of ions at the air/water interface. Unifying older developments and future possibilities in surfactant and newer theories and measurements, it emphasizes the contributions of simple science and technology. It contains chapters by leaders in surfactant-based ions to surface tension behavior, and the practical consequences. It presents physical, organic, and materials chemistries, including many who participated fundamental knowledge regarding ions in fluid /fluid systems and gives scientists in a special symposium honoring Kash Mittal’s 100th edited book at the 18th a quantitative, rigorous, and objectively experimental methodology they can Surfactants in Solution meeting in Melbourne, Australia. Each chapter provides

Surface Engineering Surface employ in their research. Chapters cover surface tension and thermodynamic an overview of a specific research area, including past, present, and future properties of pure water, simple salt solutions, mixed electrolyte solutions, directions. Both theory and applications are covered, including micellization zwitterionic amino acids, and more. and ion binding theories, biosurfactants, liquid formulations, drug delivery, and Print ISBN: 978-1-4398-8087-6 enhanced oil recovery. eBook ISBN: 978-1-4398-8089-0 Print ISBN: 978-1-4398-8295-5 September 2013, 6-1/8 x 9-1/4, 223 pp. eBook ISBN: 978-1-4398-8296-2 Suggested Price: $145.95 / £93.00 May 2014, 7 x 10, 593 pp. Suggested Price: $199.95 / £127.00

Surfactants in Tribology, Volume 3 Surface Chemistry Essentials Edited by K. S. Birdi KSB Consultant, Holte, Denmark Girma Biresaw USDA, ARS, NCAUR, CPF, Peoria, Illinois, USA Presenting fundamental knowledge of surface science, this K.I. Mittal concise volume uses solved examples to illustrate basic Hopewell Junction, New York, USA principles and provide deeper understanding to a broad This third volume in the series reflects the latest audience including chemists and engineers working for developments, highlighting the relevance of surfactants the first time on surface-related problems. It contains data in tribological phenomena in a broad range of industries, including cutting-edge from real-world examples to stimulate readers to consider areas in micro- and nanodevices. Volume 3 comprises 19 chapters on various both fundamental theory and industrial applications. Drawing on the expertise of aspects of surfactants in tribology presented in four parts: Nanotribology and a known authority in the field, the book addresses interdisciplinary applications Polymeric Systems, Biobased and Environmentally Friendly Lubricants and Additives, in areas such as biology, medicine, polymers, and food science. Tribological Properties of Aqueous and Nonaqueous Systems, and Advanced Print ISBN: 978-1-4398-7178-2 Tribological Concepts. It provides an up-to-date reference that includes subjects eBook ISBN: 978-1-4398-7179-9 not covered in previous volumes. November 2013, 6-1/8 x 9-1/4, 285 pp., Soft Cover Print ISBN: 978-1-4398-8958-9 Suggested Price: $49.95 / £31.99 112 eBook ISBN: 978-1-4398-8961-9 March 2013, 6-1/8 x 9-1/4, 597 pp. Suggested Price: $199.95 / £127.00

Surface Physics Surfactants in Tribology, Theoretical Models and Volume 4 Experimental Methods Edited by M.V. Mamonova, V.V. Prudnikov, Girma Biresaw and I.A. Prudnikova USDA, ARS, NCAUR, CPF, Peoria, Illinois, USA K.L. Mittal This text describes the physical properties of surfaces and Hopewell Junction, New York, USA explores modern theoretical and experimental methods for calculating the surface and adhesive characteristics of This fourth volume in a new series offers information on various materials and coatings. It presents relatively simple advances in the tribological aspects of innovative areas in and efficient approaches and methods developed by the authors and compares micro- and nanodevices including MEMS, NEMS, biosurfactants, biolubricants, the results to experimental data for metals, alloys, semiconductors, and complex and bioemulsions. Written by a global team of respected authors, it serves as a compounds. The book also covers dry friction, adsorption of metal atoms, and reference for scientists and engineers developing advanced materials and devices ferromagnetic films. The principles and methods are useful in selecting optimum where nanoscale understanding of the tribiological properties is critical. The materials and coatings for various applications such as minimizing friction. text offers up-to-date coverage of the state of the art, with an emphasis on green solutions. Cutting-edge topics include the superlubricity of fullerness, Print ISBN: 978-1-4665-9433-3 nanotribology of SAMs, and the effect of surface texturing on tribological eBook ISBN: 978-1-4665-9434-0 phenomena, among many others. October 2013, 6-1/8 x 9-1/4, 384 pp. Suggested Price: $145.95 / £93.00 Print ISBN: 978-1-4665-8337-5 November 2014, 6-1/8 x 9-1/4, 533 pp. Suggested Price: $179.95 / £114.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: November 2014,6x9,375pp. Print ISBN:978-1-77188-044-2 and experimentation. experts inthefield,examinevariousaspects ofchemicalandbiochemical physics physics research, thepapersinthiscollection,allwrittenby highlyregarded of current developments in applied methodologies in chemical and biochemical understanding ofthekeyprinciplesinfield.Presentingawide-ranging view engineering, andgivesthemthedepthofcoveragetheyneedtodevelopasolid of studyingchemicalphysicsandtechnologytoallareasapplied will helpreadersunderstandthevalueandrelevance By providing an appliedandmodern approach, thisvolume Moscow StateUniversity, Russia Sergei D.Varfolomeev Edited by Materials, Processing,andReliability Technology Chemical andBiochemical Suggested Price: August 2014,6x9,454pp. eBook ISBN:978-981-4411-55-4 Print ISBN:978-981-4411-54-7 contributions tothisbook. on utilizing cavitationfor the generation of nanomaterials have made their the stimulusbehinddevelopmentofthisbook.Leadingresearchers working the technologicallyimportantnanomaterialsobtainedbycavitation.Thiswas aspects ofcavitationandsonochemistry, thereisnobookdevotedspecificallyto using cavitation.Whileafewcurrentlyavailablebooksdealwiththefundamental The pastdecadehaswitnessedthedevelopmentofawiderangenanomaterials University ofMelbourne,Parkville,Australia Muthupandian Ashokkumar The UniversityofNottinghamMalaysiaCampus,Semenyih Sivakumar Manickam Edited by for theGenerationofNanomaterials A NovelEnergy-Efficient Technique Cavitation Suggested Price: April 2015,6-1/8x9-1/4,632pp. Print ISBN:978-1-4822-0578-7 each cleanenergymaterial. of eachtypematerial.ItalsodescribesNewAdvancesandFutureScopefor cells. Thebookexplainsthedesign,synthesis,characterization,andapplications batteries, materialsforhydrogenproductionandstorage,fuel electrochemicalsupercapacitorfor energyharvesting, materials,materialsfor materials forphotovoltaics,thermoelectricmaterials,piezoelectric the mainareasofcleanenergymaterials,including art materialsdevelopmentforcleanenergy. Itcovers onstate-of-the- This editedworkgivesabroadoverview Technology (AIST),Osaka,Japan National InstituteofAdvancedIndustrialScienceand Qiang Xu(KyoJo)andTetsuhiko Kobayashi Edited by for CleanEnergy Advanced Materials $149.95 /£95.00 $149.95 /£95.00 $139.95 /£89.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Textbook Suggested Price: July 2013,6x9,664pp. eBook ISBN:978-1-4665-9203-2 Print ISBN:978-1-926895-45-1 experts withcountlessyearsofexperiencelendthisvolumecredibility. behind currentusesandpotentialnotyetimplemented.International studies andsupportingtechnologies,italsoexplainstheconceptualthinking provides newresearch andupdatesonavarietyofnanoscienceusesthroughcase technology toimplementation.Itisanimportantreferencepublicationthat and nanotechnology, addressingmanyofthemajorissues,fromconceptto nanotechnology. Itcoversthemajorthemesofnanoscience offers aglobalperspectiveonthelatestdevelopmentsin With contributionsfromtopnanoscientists,thisbook Jimsher N.Aneli,AlfonsoJimenez,andStefanKubica Edited by Processing, ProductionandApplications of ModernMaterials andPhysics Chemistry Suggested Price: May 2015,81/4x11,7752pp. Print ISBN:978-1-4665-9045-8 products. with informationneededtodeviseor modifyprocessesforcurrentandnew edition, in nine volumes, ensures that the work continues to provide practitioners a correspondingincreaseintheamountofinformationgenerated.This new editions ofthisencyclopediawasimpressive,thefieldcontinuestogrow with and appliedmathematics.Althoughthebreadthofcoverageinfirst two materials sciencesandengineering,biology, physics,computersciences, aspectsofthefieldschemistry,interface-related This well-respectedencyclopediadrawstogether the Columbia University, NewYork, NewYork, USA Ponisseril Somasundaran Edited by Third Edition,Ten Volume Set and ColloidScience Encyclopedia ofSurface Suggested Price: July 2013,6-1/8x9-1/4,469pp. eBook ISBN:978-1-4665-0471-4 Print ISBN:978-1-4665-0468-4 slides areavailableuponqualifyingcourseadoption. as electroniccharge,mass,andatomicnumber. Asolutionsmanualandfigure properties ofmaterialsintermsbasicquantitieselectronsandnuclei,such of materials as composed of interacting electrons and nuclei. It explains all the them tousethesetechniquesintheirwork.Thetexttakesamicroscopicview understand electronicstructuremethodsandenables helps advancedundergraduateandgraduatestudents topics. Bridgingthisgap,classroom-testedbook students ordon’t adequately covercurrentresearch Most textbooks in thefield areeithertooadvancedfor Indian InstituteofTechnology (ITT),Kanpur Rajendra Prasad Electronic StructureofMaterials $149.95 /£95.00 $3800.00 /£2430.00 $94.95 /£59.99

113 General Reference Engineering Textiles High Performance Research Methodologies, Concepts, Elastomer Materials and Modern Applications An Engineering Approach Edited by Edited by Alexandr A. Berlin, Roman Joswik, Dariusz M. Bielinski, Ryszard Kozlowski, and Vatin Nikolai Ivanovich and Gennady E. Zaikov This volume provides the textile science community Series: AAP Research Notes on Chemistry with a forum for critical, authoritative evaluations of This book presents selected papers on various aspects of advances in the discipline of textile engineering. Reporting on recent advances rubber engineering, technology, and exploitation. The contributions range with significant applications in textile engineering, the chapters are written by from new methods of the modification of filler surface and crosslinks structure internationally recognized researchers. This book covers a multitude of important of rubber vulcanizates, through modern functional elastomer composites, to concepts and advances in the field, including: applications of nonwovens aspects of their thermal stability, flammability, and ozone degradation. in textile engineering, textile waste treatment for use in emulsion rubbers, General Reference parameters of polyhydroxybutyrate nanofibers, preparation of amines for use Print ISBN: 978-1-77188-042-8 in textile engineering, progress in photovoltaic textile, and new applications in October 2014, 6 x 9, 292 pp. nanoengineering materials in the textile industry. Suggested Price: $129.95 / £82.00 Print ISBN: 978-1-77188-078-7 March 2015, 6 x 9, 450 pp. Suggested Price: $149.95 / £95.00

Handbook of Micromechanics and Nanomechanics Introduction to Polymer–Clay Edited by Nanocomposites Shaofan Li Ahmet Gurses, Mehtap Ejder-Korucu, University of California at Berkeley, USA and Cetin Dogar Xin-Lin Gao This book focuses on polymer–clay nanocomposite University of Texas at Dallas, USA materials. It introduces readers to polymers, clays, This book presents the latest developments and applications and organo-clay and discusses the nature of of micromechanics and nanomechanics. It particularly interparticle interactions and physical adsorption, focuses on some recent applications and impact areas of micromechanics and which are predominant in the synthesis of organo-clay; nanomechanics that have not been discussed in traditional micromechanics conversion of clay to organo-clay; interactions between functional groups in and nanomechanics books on metamaterials, micromechanics of ferroelectric/ the interlayer region of clay and modifier ions; synthesis of organo-clays and piezoelectric, electromagnetic materials, micromechanics of interface, size effects their uses; and the commercial utilization of organo-clays. The text then covers and strain gradient theories, computational and experimental nanomechanics, the preparation of polymer–clay nanocomposites and their characterization, multiscale simulations and theories, soft matter composites, and computational properties, performance, and applications. homogenization theory. This book covers analytical, experimental, as well as Print ISBN: 978-981-4613-02-6 computational and numerical approaches in depth. March 2015, 6 x 9, 300 pp. Print ISBN: 978-981-4411-23-3 Suggested Price: $149.95 / £95.00 114 eBook ISBN: 978-981-4411-24-0 April 2013, 6 x 9, 1264 pp. Suggested Price: $550.00 / £350.00

Handbook of Research Materials Characterization on Functional Materials Modern Methods and Applications Principles, Capabilities and Limitations Edited by Edited by Naryanaswami (Mohan) Ranganathan University of Tours, France Charles A. Wilkie, Georges Geuskens, and Victor Manuel de Matos Lobo This book gives a comprehensive state-of-the- art treatment to nanoindentation techniques and This book introduces current state-of-the-art technology applications (four chapters cover metals, polymers, and in modern materials with an emphasis on the rapidly rubber—novel applications such as creep and impact growing technologies. It takes a unique approach by presenting specific materials tests results at micro/nano level are considered). In fact Chapter 1 is a thorough and then progresses into a discussion of the ways in which these materials and analysis of this technique, its possibilities, and future developments. There are processes are integrated into today’s functioning manufacturing industry. It two chapters regarding corrosion and abrasion resistance of metals and dental follows a more quantitative and design-oriented approach than other texts in composites and three chapters treating fatigue—one on rubber that highlights a the market, helping readers gain a better understanding of important concepts. hitherto unknown mechanism in a chloroprene rubber. There is one chapter on a Readers will also discover how material properties relate to the process variables very precise technique for modulus measurements up to 1200 °C. in a given process as well as how to perform quantitative engineering analysis of manufacturing processes. Print ISBN: 978-981-4613-06-4 March 2015, 6 x 9, 300 pp. Print ISBN: 978-1-926895-65-9 Suggested Price: $149.95 / £95.00 eBook ISBN: 978-1-4822-2164-0 February 2014, 6 x 9, 494 pp. Suggested Price: $179.95 / £114.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Suggested Price: September 2013,6x9,664pp. eBook ISBN:978-1-4822-0022-5 Print ISBN:978-1-926895-47-5 well. book willbeanexcellentresource forindustriesandacademic researchers as numerous comparisonsofdifferentmethods. Thenewtopicscoveredinthis ofthefield,explainsbasicunderlying theory,provides anoverview andgives efficient algorithmsforchemicalsoftwareandengineering.The book of chemicaldatabasesandthedevelopmentnewcomputationalmethods and applications inthefieldofnanopolymersaswellincludeslatestcoverage This bookreportsonnewmethodologiesandimportant and GennadyEfremovichZaikov Oleg V. Stoyanov, A.K.Haghi, Edited by and Applications Preparation, Properties, Modern Materials Nanopolymers and Suggested Price: March 2015,6x9,350 pp. Print ISBN:978-981-4463-90-4 of engineeringapplications. widerange range ofmultifunctionalcoatingsandmaterialsthatrelatetoavery a focusontribologicalapplications.Itpresentsthestateofartandcovers tobemultifunctional,with increasingly importantneedforengineeringsurfaces as betweenhighcorrosionresistanceandlowwear. Thisbookfocusesonthe usually thereisantagonismbetweenobtaininglowfrictionandwearaswell of modern advanced materials and coatings. This is a challenging area because tobemultifunctional.Thismultifunctionalitycanachievedbytheuse surfaces to otherincreasinglyhostileenvironments,thereisaneedforengineering that arehotter, faster, highlypressurized,andexposed thatseeapplications environmentally friendlysurfaces cheaper, lighter, smarter, longer-lasting,andmore As designsofmachinecomponentsrequire University ofSouthampton,UK Robert J.K.Wood Edited by for Tribological Applications Multifunctional Materials Suggested Price: April 2015,6-1/8x9-1/4,320pp. Print ISBN:978-1-77188-092-3 text. to furtherillustrateproceduresandaddthepracticalimplementationof chemicals, andsectionshapesavailable.Severalcasestudieshavebeendeveloped materials foragivenapplicationareidentifiedfromthefullrangeofmaterials, procedures formaterialselectionanddesigntoensurethatthemostsuitable leading expertsdescribingtheirmostrecentresearch, thisbookdescribesthe is fundamental to chemical and engineering design. With some of the world’s Understanding chemicalandsolidmaterialstheirpropertiesbehavior University ofOttawa,Canada A. K.Haghi University ofBoumerdes,Algeria Seghir Maamir Edited by Evaluationand Selection Performance of ModifiedMaterials Chemical Characteristics Mechanical andPhysico- $149.95 /£95.00 $149.95 /£95.00 $139.95 /£89.00

For more informationand acompletelistof titles,visitusat www.crcpress.com

Commercialization Nanotechnology Suggested Price: September 2013,6x9,580pp. eBook ISBN:978-1-4822-0355-4 Print ISBN:978-1-926895-49-9 metal/carbon nanocomposites. an up-to-datelookatthisimportantandvaluablenewclassofnanostructures: researchers, academics,andpost-graduatestudents,thebookwillgivereaders obtaining processesandmaterialmodificationprocesses.Intendedfor nanocomposites synthesisprocessingaswellfinedispersedsuspensions computer prognosis,includingquantumchemicalmodeling,formetal/carbon discusses newmethodsoftheir of nanostructures—metal/carbonnanocomposites—and This bookprovidesvaluableinformationonthenewclass Gennady E.Zaikov, andA.K.Haghi P. M.Sivakumar, VladimirI.Kodolov, Edited by Theory, ProductionandDevelopment Nanostructured Materials Nanostructure, Nanosystems,and Suggested Price: 2013,6-1/8 x9-1/4,262pp. January eBook ISBN:978-1-4665-6869-3 Print ISBN:978-1-926895-27-7 explored. different partsoftheworldandthrowslightonareasthatneedtobefurther It providesathoroughknowledgeabouttheworkbeingdoneinrecycling in and itsreuseaswellpresentsanin-depthlookatvariousrecyclingmethods. It provides a basic understanding about polymer recycling of recyclinginconnectionwithvarioustypesmaterials. This bookanalyzesdifferentinnovativemethodsandways Series: AdvancesinMaterialsScience and AbderrahimBoudenne Yves Grohens,KishorKumarSadasivuni, Edited by and TheirProducts Recycling andReuseofMaterials Suggested Price: September 2013,6x9,480pp. eBook ISBN:978-981-4303-29-3 Print ISBN:978-981-4303-28-6 the foremostnanotechnologyexpertsintheirfields. the issues associated with, the commercialization of nanomaterials by some of ofthecurrenttrendsin,and exclusively withnanomaterials.Itprovidesoverviews and ethics.Thisisthefirstbookonnanotechnologycommercialization thatdeals any othernanotechnologysectorwithregardtosafety, regulation,standardization, In addition, the nanomaterial sector has attracted much more heated debate than the leading sector in nanotechnology commercialization. nanomaterials, especiallynanoparticulatematerials,are a uniqueplaceinnanotechnology. Engineered In termsofcommercialization, nanomaterialsoccupy Australian NationalUniversity, Canberra Takuya Tsuzuki Edited by $149.95 /£95.00 $139.95 /£89.00 $99.95 /£63.99 synthesis, properties, and applications. It covers synthesis, properties,andapplications.Itcovers

115 General Reference Scalable Innovation A Guide for Inventors, Entrepreneurs, and IP Professionals Eugene Shteyn Stanford University, California, USA Max Shtein University of Michigan, Ann Arbor, USA

Based on recent advances in cognitive sciences, this book introduces a model for the innovation process, helping inventors, investors, and entrepreneurs to understand the nature and timing of opportunities and risks on the path to success. The authors apply systems thinking to discover real-life challenges, and provide tools for turning these challenges into opportunities for practical, scalable innovation. Using illustrative General Reference case studies, they analyze several landmark innovations in detail, revealing surprising and essential elements common to all of them. Print ISBN: 978-1-4665-9097-7 eBook ISBN: 978-1-4665-9098-4 June 2013, 6-1/8 x 9-1/4, 333 pp., Soft Cover Suggested Price: $49.95 / £31.99

Supplementary Cementing Materials in Concrete Michael Thomas This textbook provides detailed information on the use of supplementary cementing materials (SCM), such as fly ash, slag, silica fume and natural pozzolans, in concrete. It presents the provenance of these materials and their chemical, physical, and mineralogical properties. By providing an understanding of the chemical reactions involving these materials and the resulting changes in the microstructure of the concrete, the book explains how SCM’s influence the mechanical properties of concrete and can improve its durability in aggressive environments. It includes a number of case histories where SCMs have been used in important concrete structures. Print ISBN: 978-1-4665-7298-0 eBook ISBN: 978-1-4665-7301-7 116 February 2013, 6-1/8 x 9-1/4, 210 pp. Suggested Price: $132.95 / £85.00

The Chemistry and Physics of Engineering Materials Two Volume Set Edited by Alexandr A. Berlin, Roman Joswik, and Vatin Nikolai Ivanovich This new two-volume set focuses on the chemistry and physics of engineering materials that have potential for applications in several disciplines of engineering and science. Contributions range from new methods to novel applications of existing methods. Volume 1 addresses modern analytic methodologies while Volume 2 focuses on the limitations, properties, and models of materials. The collection of topics in these volumes reflect the diversity of recent advances in chemistry and physics of engineering materials with a broad perspective that will be useful for scientists as well as graduate students and engineers. This new two-volume set presents leading-edge research from around the world. Print ISBN: 978-1-77188-081-7 March 2015, 6 x 9, 750 pp. Suggested Price: $299.95 / £191.00

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 A Biomedical Engineering Fundamentals...... 69 CMOS: Front-End Electronics for Radiation Sensors...... 45 Biomedical Photonics Handbook, 3 Volume Set, Coen & Hamworthy Combustion Handbook: Active Plasmonic Nanomaterials...... 27 Second Edition...... 9 Fundamentals for Power, Marine & Industrial Applications.....66 Adaptive Optics for Biological Imaging...... 27 Biomedical Photonics Handbook, Second Edition: Colloid and Interface Chemistry for Nanotechnology...... 110 Additive Manufacturing...... 90 Biomedical Diagnostics...... 9 Colloid and Surface Chemistry: A Laboratory Guide Additive Manufacturing: Innovations, Advances, Biomedical Photonics Handbook, Second Edition: for Exploration of the Nano World...... 51 and Applications...... 90 Fundamentals, Devices, and Techniques...... 9 Color of Metal Compounds, Second Edition...... 96 Advanced Bioactive Inorganic Materials for Biomedical Photonics Handbook, Second Edition: Combustion for Material Synthesis...... 92 Bone Regeneration and Drug Delivery...... 68 Therapeutics and Advanced Biophotonics...... 9 Commonly Asked Questions in Physics...... 23 Advanced Biophotonics: Tissue Optical Sectioning...... 27 Biomedical Signals, Imaging, and Informatics...... 69 Compact Models for Integrated Circuit Design: Advanced Digital Optical Communications, Second Edition...27 Biomimetic Architectures by Plasma Processing: Conventional Transistors and Beyond...... 79 Fabrication and Applications...... 17 Advanced Energy Systems, Second Edition...... 63 Compact Plasma and Focused Ion Beams...... 59 Biomineralization Sourcebook: Characterization Advanced Linear Algebra...... 16 Complex Liquids, Polymers and Membranes...... 17 of Biominerals and Biomimetic Materials...... 86 Advanced Materials for Clean Energy...... 113 Composite Materials and Processing...... 76 Bionanophotonics: An Introductory Textbook...... 28 Advanced Materials for Joint Implants...... 74 Composite Materials: Design and Applications, Biophysics for Beginners: Third Edition...... 76 Advanced Nanomaterials for Aerospace Applications...... 97 A Journey through the Cell Nucleus...... 10 Composites and Nanocomposites...... 76 Advanced Nanomaterials: Synthesis, Properties, Biosensor Technology: Fundamentals, Applications, and Applications...... 97 and New Challenges...... 69 Computational and Experimental Chemistry: Developments and Applications...... 61 Advanced Polymer Concretes and Compounds...... 75 Biosensors Based on Nanomaterials and Nanodevices...... 98 Computational and Visualization Techniques Advanced Polymeric Materials: From Macro- to Biosurfactants: Research Trends and Applications...... 110 for Structural Bioinformatics Using Chimera...... 10 Nano-Length Scales...... 106 Biothermodynamics: Principles and Applications...... 63 Computational Approaches to Protein Dynamics: Algebras, Rings and Modules: Non-commutative Black Holes, Wormholes and Time Machines...... 22 From Quantum to Coarse-Grained Methods...... 10 Algebras and Rings...... 41 Building Earth Observation Cameras...... 28 Computational Bioengineering...... 70 Aluminum Recycling, Second Edition...... 96 Computational Biomechanics of the Musculoskeletal System.....46 Index Title Amorphous Chalcogenides: Advances and Applications...... 75 C Computational Electromagnetics: Domain Analysis and Performance of Engineering Materials: Cadmium Telluride Quantum Dots: Decomposition Methods and Practical Applications...... 16 Key Research and Development...... 86 Advances and Applications...... 98 Computational Methods for Data Evaluation Analytic Hyperbolic Geometry in N Dimensions: Cancer Nanotechnology: Principles and Applications and Assimilation...... 58 An Introduction...... 41 in Radiation Oncology...... 45 Computational Modeling of Inorganic Nanomaterials...... 18 Analytical Mechanics: Solutions to Problems Carbon Nanomaterials, Second Edition...... 90 in Classical Physics...... 22 Computational Modeling of Polymer Composites: Carbon Nanotube and Graphene Nanoribbon Interconnects....98 A Study of Creep and Environmental Effects...... 76 Analytical Tools and Industrial Applications for Chemical Processes and Polymeric Materials...... 103 Carbon Nanotubes: Theoretical Concepts and Research Computational Nanophotonics: Modeling and Applications..28 Strategies for Engineers...... 93 Applied Engineering Failure Analysis: Theory and Practice...... 93 Computational Nanotechnology Using Finite Difference Carbonated Hydroxyapatite: Materials, Synthesis Time Domain...... 29 Applied Medical Image Processing, Second Edition: and Applications...... 70 A Basic Course...... 45 Computational Optical Biomedical Spectroscopy Carbon-Based Electronics: Transistors and Interconnects and Imaging...... 11 Applied Methodologies in Polymer Research at the Nanoscale...... 98 Computer-Aided Detection and Diagnosis and Technology...... 103 Carbon-based Nanomaterials and Hybrids: Synthesis, in Medical Imaging...... 46 Applied Research on Polymer Composites...... 104 Properties, and Commercial Applications...... 110 Concepts and Methods in Modern Theoretical Chemistry, Aquananotechnology: Global Prospects...... 55 Carbon-based Superconductors: Towards High-Tc Two Volume Set...... 18 Armour: Protecting Against Blast and Ballistic Attack...... 93 Superconductivity...... 79 Concepts and Methods in Modern Theoretical Chemistry: Astrobiology: An Evolutionary Approach...... 6 Carraher’s Polymer Chemistry, Ninth Edition...... 104 Electronic Structure and Reactivity...... 18 Astrobiology: An Introduction...... 6 Causal Physics: Photons by Non-Interactions of Waves...... 28 Concepts and Methods in Modern Theoretical Chemistry: Statistical Mechanics...... 18 117 Astrophysical Techniques, Sixth Edition...... 7 Cavitation: A Novel Energy-Efficient Technique for Condensed Matter Optical Spectroscopy: An Illustrated Asymptotic Analysis and Perturbation Theory...... 41 the Generation of Nanomaterials...... 113 Introduction...... 18 At the Root of Things: The Subatomic World...... 58 Cell Membrane Nanodomains: From Biochemistry to Nanoscopy...... 10 Cone Beam Computed Tomography...... 46 Atomic and Molecular Beams: Production and Collimation...... 8 Cells, Forces, and the Microenvironment...... 10 Consider a Spherical Patent: IP and Patenting Atomic Force Microscopy in Nanobiology...... 9 in Technology Business...... 67 Cellular Potts Models: Multiscale Extensions and b Biological Applications...... 10 Control for Aluminum Production and Other Processing Industries...... 96 Cellulose-Based Graft Copolymers: Structure and Chemistry...104 Basic Elements of Crystallography, Second Edition...... 17 Controlled Release Systems: Advances in Nanobottles Charged Particle Optics Theory: An Introduction...... 28 Bent-core Liquid Crystals...... 17 and Active Nanoparticles...... 98 Chemical and Applied Engineering Materials: Beyond Quantum...... 60 Corrosion and Materials in the Oil and Gas Industries...... 78 Interdisciplinary Research and Methodologies...... 93 Bioadhesion and Biomimetics: From Nature to Applications...... 68 Corrosion of Ceramic Materials, Third Edition...... 78 Chemical and Biochemical Technology: Coupled Systems: Theory, Models, and Applications Bio-Based Composites for High-Performance Materials: Materials, Processing, and Reliability...... 113 From Strategy to Industrial Application...... 76 in Engineering...... 42 Chemical Technology: Key Developments Course in Field Theory...... 58 Bioengineered Nanomaterials...... 97 in Applied Chemistry and Materials Science...... 93 Course in Mathematical Methods for Physicists...... 42 Biofunctional Surface Engineering...... 68 Chemistry and Physics of Complex Materials: Bioinspired Photonics: Optical Structures and Concepts and Applications...... 87 CRC Handbook of Chemistry and Physics, 96th Edition...... 67 Systems Inspired by Nature...... 28 Chemistry and Physics of Engineering Materials Creating Life from Life: Biotechnology and Science Fiction.....67 Bio-inspired Wettability Surfaces: Developments in - Two Volume Set...... 116 Crystal Growth and Evaluation of Silicon for VLSI and ULSI...... 3 Micro- and Nanostructures...... 17 Chemistry and Physics of Engineering Materials, D Biointeractions of Nanomaterials...... 51 Volume One: Modern Analytical Methodologies...... 87 Biomaterial Applications: Macro to Nanoscale...... 68 Chemistry and Physics of Engineering Materials, Dancing with Light: Advances in Photofunctional Biomaterials for Stem Cell Therapy: Volume Two: Limitations, Properties, and Materials...... 88 Liquid-Crystalline Materials...... 79 State of Art and Vision for the Future...... 69 Chemistry and Physics of Modern Materials: Processing, Dark Matter: An Introduction...... 7 Biomaterials: A Basic Introduction...... 69 Production and Applications...... 113 Decommissioning Health Physics: Biomechanics and Robotics...... 69 Classical Mechanics, Second Edition...... 22 A Handbook for MARSSIM Users, Second Edition...... 46

For more information and a complete list of titles, visit us at www.crcpress.com Defects and Damage in Composite Materials and Structures....76 Engineering of Polymers and Chemical Complexity, Fundamentals of Systems Biology: From Synthetic Dekker Encyclopedia of Nanoscience and Volume II: New Approaches, Limitations and Control...... 104 Circuits to Whole-cell Models...... 11 Nanotechnology, Third Edition, Seven Volume Set...... 55 Engineering of Polysaccharide Materials: G Design and Layout of Fire Sprinkler Systems, Third Edition.....84 by Phosphorylase-Catalyzed Enzymatic Chain-Elongation...... 71 Gauge Theories in Particle Physics: A Practical Design Controls for the Medical Device Industry, Engineering Textiles: Research Methodologies, Concepts, Introduction, Fourth Edition - 2 Volume set...... 59 Second Edition...... 70 and Modern Applications...... 114 General Relativity: Basics and Beyond...... 24 Design of 3D Integrated Circuits and Systems...... 55 Environmental Degradation of Advanced and Traditional Engineering Materials...... 79 Geometry of Musical Rhythm: What Makes a Design of Biomedical Devices and Systems, Third Edition...... 70 Essential Dynamics and Relativity...... 5 “Good” Rhythm Good?...... 67 Detonation Nanodiamonds: Science and Applications...... 18 Essential MATLAB and Octave...... 42 Geometry, Topology and Physics, Second Edition...... 43 Devices for Mobility and Manipulation for Graphene, Carbon Nanotubes, and Nanostructures: People with Reduced Abilities...... 70 Essential Physics...... 23 Techniques and Applications...... 98 Diagnostic Endoscopy...... 46 Essential Principles of Image Sensors...... 29 Graphene: Energy Storage and Conversion Applications...... 80 Dictionary of Inequalities, Second Edition...... 67 Essentials of In Vivo Biomedical Imaging...... 47 Graphene: Fundamentals, Devices and Applications...... 19 Difference Equations: Theory, Applications Essentials of Modern Physics...... 24 Graphene-Based Materials: Science and Technology...... 80 and Advanced Topics, Third Edition...... 42 Essentials of Natural Gas Microturbines...... 64 Green Biorenewable Biocomposites: From Knowledge Differential Forms and the Geometry of General Relativity...... 42 Experimental Characterization of Advanced Composite to Industrial Applications...... 77 Materials, Fourth Edition...... 77 Diffractive Nanophotonics...... 29 Green Carbon Materials: Advances and Applications...... 111

Title Index Experimental Combustion: An Introduction...... 64 Diffusion: Formalism and Applications...... 63 Green Composites from Natural Resources...... 77 Digital Processing: Optical Transmission and Coherent F Ground-Based Microwave Radiometry and Remote Receiving Techniques...... 29 Sensing: Methods and Applications...... 26 Finite Element Analysis of Composite Materials DNA Nanotechnology...... 70 using Abaqus™...... 77 Guided Wave Optics and Photonic Devices...... 30 Drills: Science and Technology of Advanced Operations...... 90 Finite Element Analysis of Composite Materials H Dynamics of Classical and Quantum Fields: An Introduction.....61 Using ANSYS®, Second Edition...... 77 Handbook for the Chemical Analysis of Plastic Dynamics of Discrete Populations and Series of Events...... 57 Fire Safety Engineering Design of Structures, Third Edition.....85 and Polymer Additives, Second Edition...... 107 E Fire Safety Management Handbook, Third Edition...... 85 Handbook of 3D Machine Vision: Optical Metrology Fischer-Cripps Student Companion Set (5 Volumes)...... 24 and Imaging...... 30 Einstein Was Right!...... 23 Fluctuation Theory of Solutions: Applications in Handbook of Biofunctional Surfaces...... 111 Elastic and Plastic Deformation of Carbon Nanotubes...... 90 Chemistry, Chemical Engineering, and Biophysics...... 11 Handbook of Clinical Nanomedicine: Electricity and Magnetism...... 23 Fluid Dynamics via Examples and Solutions...... 5 From Bench to Bedside...... 71 Electrochemical Discharges and Applications in Fluid Mechanics and Heat Transfer: Advances in Handbook of Encapsulation and Controlled Release...... 71 Nanotechnology...... 60 Nonlinear Dynamics Modeling...... 3 Handbook of Enhanced Spectroscopy...... 30 Electrochemical Supercapacitors for Energy Storage Fluorescence Lifetime Spectroscopy and Imaging: Handbook of Granular Materials...... 19 and Delivery: Fundamentals and Applications...... 79 Principles and Applications in Biomedical Diagnostics...... 29 Handbook of Hydrogen Energy...... 64 Electromagnetic Fields in Biology and Medicine...... 46 Fluorescent Protein Revolution...... 15 Handbook of Imaging in Biological Mechanics...... 11 Electromagnetic Theory for Electromagnetic Foam Extrusion: Principles and Practice, Second Edition...... 107 Compatibility Engineers...... 3 Handbook of Ion Channels...... 11 Foundations of Crystallography with Electronic Structure of Materials...... 113 Computer Applications, Second Edition...... 88 Handbook of Lipid Bilayers, Second Edition...... 11 Electronics Companion: Devices and Circuits for Foundations of High Performance Polymers: Properties, Handbook of Medical Device Regulatory Affairs in Asia ...... 71 Physicists and Engineers, 2nd Edition...... 23 Performance and Applications...... 105 Handbook of Micromechanics and Nanomechanics...... 114 Electrostatics of Soft and Disordered Matter...... 63 Foundations of Nanotechnology, Volume One: Handbook of Molecular Plasmonics...... 30 Elements of Mechanics...... 23 Pore Size in Carbon-Based Nano-Adsorbents...... 55 Handbook of Nanomagnetism: Applications and Tools...... 80 Elements of Quantum Computation and Quantum Foundations of Nanotechnology, Volume Three: Handbook of Optical Dimensional Metrology...... 30 118 Communication...... 61 Mechanics of Carbon Nanotubes...... 56 Handbook of Optical Metrology: Encyclopedia of Biomedical Polymers and Polymeric Foundations of Nanotechnology, Volume Two: Principles and Applications, Second Edition...... 31 Biomaterials (Online Version)...... 106 Nanoelements Formation and Interaction...... 56 Handbook of Optical Microcavities...... 31 Encyclopedia of Biomedical Polymers and Polymeric Fractal Mechanics of Polymers: Chemistry and Physics of Biomaterials, 11 Volume Set...... 107 Complex Polymeric Materials...... 107 Handbook of Optical Sensors...... 31 Handbook of Oral Biomaterials...... 71 Encyclopedia of Chemical Physics and Physical Fractal Physical Chemistry of Polymer Solutions and Melts.....88 Handbook of Ordinary Differential Equations, Chemistry - 3 Volume Set...... 15 Fractal Physics of Polymer Synthesis...... 105 Third Edition...... 43 Encyclopedia of Surface and Colloid Science, Friction, Wear, and Erosion Atlas...... 110 Third Edition - Ten Volume Set (Print Version)...... 113 Handbook of Personalized Medicine: Advances in Friction-Induced Vibrations and Self-Organization: Nanotechnology, Drug Delivery, and Therapy...... 52 Endohedral Metallofullerenes: Basics and Applications...... 19 Mechanics and Non-Equilibrium Thermodynamics Handbook of Photomedicine...... 47 Energy and Society: An Introduction, Second Edition...... 63 of Sliding Contact...... 111 Handbook of Radiotherapy Physics: Theory and Practice...... 47 Energy Conversion, Second Edition...... 63 FRP Deck and Steel Girder Bridge Systems: Energy Efficiency and Renewable Energy Handbook, Analysis and Design...... 77 Handbook of Research on Functional Materials: Principles, Capabilities and Limitations...... 114 Second Edition...... 64 Fuel Cells: Principles, Design, and Analysis...... 64 Handbook of Safety Assessment of Nanomaterials: Energy Management and Conservation Handbook, Functional Cobalt Oxides: Fundamentals, Properties From Toxicological Testing to Personalized Medicine...... 99 Second Edition...... 64 and Applications...... 19 Handbook of Silicon Photonics...... 31 Engineering Applications of Lasers...... 29 Functional Materials: Properties, Performance, Handbook of Surface and Colloid Chemistry, Engineering Materials: Applied Research and Evaluation...... 88 Fourth Edition...... 111 and Evaluation Methods...... 88 Functions of a Complex Variable...... 42 Handbook of Terahertz Technologies: Engineering Materials: Research, Applications and Advances.....93 Fundamentals of Machining Processes: Conventional Devices and Applications...... 3 Engineering Mechanics of Polymeric Materials: and Nonconventional Processes, Second Edition...... 90 Heat Exchanger Design Handbook, Second Edition...... 65 Theories, Properties and Applications...... 107 Fundamentals of Manufacturing Engineering, Heat Exchangers for Refrigeration Applications...... 65 Engineering of Polymers and Chemical Complexity, Third Edition...... 91 Two-Volume Set...... 104 Fundamentals of Picoscience...... 56 Heat Transfer Aspects of Manufacturing Processes: Advances in Numerical Heat Transfer Volume V...... 94 Engineering of Polymers and Chemical Complexity, Fundamentals of Solid-State Lighting: LEDs, OLEDs, Volume I: Current State of the Art and Perspectives...... 104 and Their Applications in Illumination and Displays...... 30 Heat Transfer Enhancement with Nanofluids...... 65

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Hierarchical Micro/Nanostructured Materials: J/K/L Mathematics and Music: Composition, Perception, Fabrication, Properties, and Applications...... 91 and Performance...... 68 High Brightness Metal Vapor Lasers: John Paul Flory: A Life of Science...... 105 Mathematics Companion: Mathematical Methods Physical Fundamentals and Mathematical Models...... 31 Key Technologies in Polymer Chemistry...... 107 for Physicists and Engineers, 2nd Edition...... 26 High Brightness Metal Vapor Lasers: Laboratory Course in Nanoscience and Nanotechnology...... 99 Measured Tones: The Interplay of Physics and Music, Third Edition...... 24 Physics and Applications...... 31 Laboratory Manual in Biophotonics...... 8 Measurement and Detection of Radiation, Fourth Edition...... 58 High Performance Elastomer Materials: Labs on Chip: Principles, Design and Technology...... 52 An Engineering Approach...... 114 Mechanical and Physico-Chemical Characteristics of Laser and Photonic Systems: Design and Integration...... 32 High Temperature Materials and Mechanisms...... 86 Modified Materials: Performance Evaluation and Selection...115 Laser Beam Propagation in Nonlinear Optical Media...... 32 High-Resolution XAS/XES: Analyzing Electronic Mechanics of Cellular Bone Remodeling: Structures of Catalysts...... 86 Laser Beam Propagation: Generation and Propagation Coupled Thermal, Electrical, and Mechanical Field Effects...... 72 of Customized Light...... 32 High-Speed Devices and Circuits with THz Applications...... 55 Medical Devices and Human Engineering...... 72 Laser Beam Shaping: Theory and Techniques, High-Speed Photonics Interconnects...... 32 Medical Equipment Management...... 48 Second Edition...... 33 Horizons in Clinical Nanomedicine...... 71 Medical Imaging: Technology and Applications...... 48 Laser Modeling: A Numerical Approach with Hydrogen Energy for Beginners...... 99 Algebra and Calculus...... 33 Melt-Quenched Nanocrystals...... 94 Hydroxyapatite Coat ings for Biomedical Applications...... 72 Laser Safety: Tools and Training, Second Edition...... 33 MEMS Cost Analysis: From Laboratory to Industry...... 4 Metal-Induced Crystallization: Laser Shock Peening and Related Phenomena...... 96 I Fundamentals and Applications...... 75 Laser-Based Measurements for Time and Frequency Metallic Spintronic Devices...... 56 Illustrated Introduction to Topology and Homotopy...... 43 Domain Applications: A Handbook...... 33 Metal-Organic Frameworks: Materials Modeling Illustrated Wavelet Transform Handbook: Introductory Laser-Based Optical Detection of Explosives...... 33 Theory and Applications in Science, Engineering, towards Engineering Applications...... 16 Laser-Induced Damage in Optical Materials...... 33 Medicine and Finance...... 43 Metamaterials: Beyond Crystals, Noncrystals, Learning Bio-Micro-Nanotechnology...... 52 and Quasicrystals...... 81 Image Processing in Radiation Therapy...... 47 Light - The Physics of the Photon...... 34 Method of Moments in Electromagnetics, Second Edition...... 44 Image Processing with MATLAB®: Applications in Light Propagation in Linear Optical Media...... 34 Medicine and Biology, Second Edition...... 47 Methods of Experimental Physics...... 24 Index Title Imaging in Cellular and Tissue Engineering...... 72 Light Sources, Second Edition: Basics of Lighting Micro- and Macromechanical Properties of Materials...... 87 Technologies and Applications...... 34 Industrial Brazing Practice, Second Edition...... 96 Micro- and Nanoelectronics: Emerging Device Challenges Light-Induced Defects in Semiconductors...... 19 and Solutions...... 81 Informatics in Radiation Oncology...... 47 Liposomes, Lipid Bilayers and Model Membranes: Microbiology for Minerals, Metals, Materials Information Photonics: Fundamentals, Technologies, From Basic Research to Application...... 12 and Environment...... 91 and Applications...... 32 Liquid Crystals and Polymers in Display Applications...... 19 Microlenses: Properties, Fabrication and Liquid Lenses...... 34 Infrared Astronomy – Seeing the Heat: Lithium-Ion Batteries: Fundamentals and Applications...... 80 Microplasma Sprayed Hydroxyapatite Coatings...... 75 from William Herschel to the Herschel Space Observatory...... 7 Low Temperature Plasma Technology: Microwave Engineering: Concepts and Fundamentals...... 81 Inorganic-Whisker-Reinforced Polymer Composites: Methods and Applications...... 60 Synthesis, Properties and Applications...... 88 Microwave Photonics, Second Edition...... 35 Luminescence: The Instrumental Key to the Future Inside the Photon: A Journey towards Health...... 12 Mimetic Discretization Methods...... 44 of Nanotechnology...... 80 Integrated Quantum Hybrid Systems...... 61 Modeling and Control for Micro/Nano Devices and Systems...... 44 Integrated Reliability: Condition Monitoring M Modern Atomic Physics...... 8 and Maintenance of Equipment...... 94 Magnesium Alloys as Degradable Biomaterials...... 72 Modern Diagnostic X-Ray Sources: Intelligent Integrated Systems: Devices, Technologies, Magnetic Materials and 3D Finite Element Modeling...... 81 Technology, Manufacturing, Reliability...... 48 and Architectures...... 80 Magnetic Microwires: A Magneto-Optical Study...... 3 Molecular and Cellular Biomechanics...... 13 International Handbook of FRP Composites in Civil Engineering...... 78 Magnetic Nanoparticle Assemblies...... 81 Molecular Materials...... 89 Introduction to Astronomy and Astrophysics...... 7 Magnetic Resonance Imaging: The Basics...... 48 Molecular Modeling at the Atomic Scale: Methods and Applications in Quantitative Biology...... 13 Introduction to Beam Physics...... 59 Marine Biomaterials: Characterization, Isolation 119 and Applications...... 72 Molecular Modelling with Materials Studio®...... 89 Introduction to Ceramics and Refractories...... 96 Masers and Lasers, Second Edition: Molecular, Cellular, and Tissue Engineering...... 73 Introduction to Crystal Growth: Principles and Practice...... 15 An Historical Approach...... 34 Monte Carlo Methods for Particle Transport...... 58 Introduction to Enzymology...... 12 Mass Spectrometry for the Novice...... 12 Monte Carlo Techniques in Radiation Therapy...... 48 Introduction to Fluorescence...... 12 Materials and Process Selection for Engineering Design, Multicomponent Polymeric Materials: Introduction to Imaging from Scattered Fields...... 32 Third Edition...... 94 From Introduction to Application...... 108 Introduction to Instrumentation and Measurements, Materials Behavior: Research Methodology Multifunctional Materials and Modeling...... 89 Third Edition...... 3 and Mathematical Models...... 94 Multifunctional Materials for Tribological Applications...... 115 Introduction to Mathematical Modeling Materials Characterization: Multifunctional Molecular Materials...... 111 and Chaotic Dynamics...... 43 Modern Methods and Applications...... 114 Multisensor Systems for Chemical Analysis: Introduction to Nuclear Science, Second Edition...... 57 Materials Design Using Computational Materials and Sensors...... 99 Introduction to Numerical Analysis Intelligence Techniques...... 86 N and Scientific Computing...... 43 Materials Physics Companion, 2nd Edition...... 20 Introduction to Numerical Programming: A Practical Guide Materials Processing by Cluster Ion Beams: Nanoantenna: Plasmon-Enhanced Spectroscopies for Scientists and Engineers Using Python and C/C++...... 16 History, Technology, and Applications...... 91 for Biotechnological Applications...... 13 Introduction to Polymer Science and Chemistry: Materials Science and Engineering, Volume II: Nanobiomaterials: Development and Applications...... 73 A Problem-Solving Approach, Second Edition...... 105 Physiochemical Concepts, Properties, and Treatments...... 92 Nanocomposite Materials: Fundamentals and Introduction to Polymer–Clay Nanocomposites...... 114 Materials Science and Engineering. Volume I: Practical Applications...... 73 Introduction to Quantum Biology...... 12 Physical Process, Methods, and Models...... 94 Nanocomposites in Wastewater Treatment...... 99 Introduction to Quantum Physics Materials Science and Engineering: Nanoelectrochemistry...... 52 Volumes 1 and 2 (two volume set)...... 92 and Information Processing...... 61 Nanoelectronic Device Applications Handbook...... 52 Materials Science of Polymers: Plastics, Rubber, Introductory Course of Particle Physics...... 59 Nanoelectronics: Quantum Engineering of Blends, and Composites...... 108 Ion Beam Analysis: Fundamentals and Applications...... 91 Low-Dimensional Nanoensembles...... 5 Mathematical Methods for Electron Tomography...... 34 Ion Exchange and Solvent Extraction: Volume 21, Nanoimprint Biosensors: The Fusion of Supramolecular Aspects of Solvent Extraction...... 86 Mathematical Theory of Quantum Computation...... 44 Nanofabrication, Nanophotonics and Nanobiology...... 35

For more information and a complete list of titles, visit us at www.crcpress.com Nanoindentation of Brittle Solids...... 74 Nanotechnology Commercialization...... 115 Oscillations and Waves: An Introduction...... 25 Nano-Inspired Biosensors for Improved Healthcare...... 73 Nanotechnology for Sustainable Manufacturing...... 54 Oxide Nanostructures: Growth, Microstructures, Nanomagnetic Actuation of Cell Surface Receptors: Nanotechnology for the Delivery of and Properties...... 20 Basic Principles and Applications...... 99 Therapeutic Nucleic Acids...... 73 Oxygen-Enhanced Combustion, Second Edition...... 65 Nanomaterials and Nanotechnology for Composites: Nanotechnology in Advanced Electrochemical P Design, Simulation, and Applications...... 78 Power Sources...... 20 Nanomaterials for Electrochemical Sensing and Biosensing...... 100 Nanotechnology Toward the Sustainocene...... 101 Parallel Science and Engineering Applications: Nanomaterials for Lithium-Ion Batteries: Nanotechnology: The Whole Story...... 101 The Charm++ Approach...... 16 Fundamentals and Applications...... 95 Nanotechnology: Understanding Small Systems, Partial Differential Equations with Variable Exponents: Nanomaterials in Energy and Environmental Applications...... 22 Third Edition...... 54 Variational Methods and Qualitative Analysis...... 44 Nanomaterials: Synthesis, Characterization, Nanotoxicology: Progress toward Nanomedicine, Particle and Particle Systems Characterization: and Applications...... 100 Second Edition...... 102 Small-Angle Scattering (SAS) Applications...... 59 Nanomedicine in Drug Delivery...... 52 Nanotubes and Nanosheets: Functionalization and Patterns in Excitable Media: Genesis, Dynamics, and Control...... 49 Nanomedicine: A Soft Matter Perspective...... 48 Applications of Boron Nitride and Other Nanomaterials...... 20 Pediatric Radiotherapy Planning and Treatment...... 49 Nanomedicines and Nanoproducts: Applications, Natural Biomarkers for Cellular Metabolism: Biology, Disposition, and Toxicology in the Human Body...... 100 Techniques, and Applications...... 13 Performance-Based Fire Safety Design...... 85 Nanoparticles in Humans: Experiments, Methods Natural Biophotonic Architectures: Complex Optical Phase Estimation in Optical Interferometry...... 38 and Strategies...... 53 Effects and Bioimimetic Applications...... 35 Phase Transitions in Solids Under High Pressure...... 20 Title Index Nanoparticles in the Lung: Environmental Exposure Natural Mineral Nanotubes: Properties and Applications...... 95 Photoacoustic Tomography...... 49 and Drug Delivery...... 100 Near-Infrared Organic Materials and Emerging Applications...35 Photonic Crystals: Principles and Applications...... 38 Nanophotonics: Devices, Circuits, and Systems...... 81 Needleless Electrospinning of Nanofibers: Photonics Modelling and Design...... 38 Technology and Applications...... 20 Nanoplasmonics...... 35 Photopolymers: Photoresist Materials, Processes, Nanoplasmonics: Advanced Device Applications...... 35 New Cosmic Onion: Quarks and the Nature of the Universe.....24 and Applications...... 108 Nanopolymers and Modern Materials: Nonlinear Optics: Principles and Applications...... 36 Physics and Chemistry of Classical Materials: Preparation, Properties, and Applications...... 115 Nonlinear Physics of Ecosystems...... 57 Applied Research and Concepts...... 89 Nanoporous Materials: Synthesis and Applications...... 89 Novel Green Treatment for Textiles: Plasma Treatment Physics and Chemistry of Graphene: Nanorobotics: An Introduction...... 53 as a Sustainable Technology...... 87 Graphene to Nanographene...... 82 Nano-scale CMOS Analog Circuits: Novel Nanocomposite Coatings: Physics Companion, 2nd Edition...... 25 Models and CAD Techniques for High-Level Design...... 53 Advances and Industrial Applications...... 111 Physics Curiosities, Oddities, and Novelties...... 25 Nanoscale Energy Transport and Harvesting: Nuclear Engineering Fundamentals...... 65 Physics for Diagnostic Radiology, Third Edition...... 49 A Computational Study...... 82 Nuclear Engineering Handbook, Second Edition...... 65 Physics from Planet Earth - An Introduction to Mechanics...... 25 Nanoscale Flow: Advances, Modeling, and Applications...... 53 Nuclear Magnetic Resonance Studies of Physics of Continuous Media: Problems and Solutions Nanoscale Liquid Interfaces: Wetting, Patterning Interfacial Phenomena...... 87 in Electromagnetism, Fluid Mechanics and MHD, and Force Microscopy at the Molecular Scale...... 56 Numerical Methods in Photonics...... 36 Second Edition...... 5 Nanoscale Semiconductor Memories: O Physics of Exciton-Polariton Condensates...... 61 Technology and Applications...... 53 Physics of Nuclear Radiations: Concepts, Techniques Nanoscale Spectroscopy with Applications...... 56 Odyssey of Light in Nonlinear Optical Fibers: and Applications...... 58 Nanoscience and Computational Chemistry: Theory and Applications...... 36 Physics of PET and SPECT Imaging...... 49 Research Progress...... 53 OLED Fundamentals: Materials, Devices, and Processing Physics of Schottky Electron Sources: Nanoscience and Nanoengineering: of Organic Light-Emitting Diodes...... 36 Theory and Optimum Operation...... 49 Advances and Applications...... 100 Optical Coding Theory with Prime...... 36 Physiological Measurement Handbook...... 51 ® Nanosilicon: Properties, Synthesis, Applications, Optical Fiber Communication Systems with MATLAB and Planetary Science: The Science of Planets ® Methods of Analysis and Control...... 92 Simulink Models, Second Edition...... 36 around Stars, Second Edition...... 7 120 Nanostructural Bioceramics: Advances in Optical Fiber Sensors: Advanced Techniques Plasma Electronics, Second Edition: Chemically Bonded Ceramics...... 75 and Applications...... 37 Applications in Microelectronic Device Fabrication...... 60 Nanostructure, Nanosystems, and Nanostructured Optical Modeling and Simulation of Plasma Harmonics...... 60 Materials: Theory, Production and Development...... 115 Thin-Film Photovoltaic Devices...... 37 Plasma Physics: An Introduction...... 60 Nanostructured and Advanced Materials for Fuel Cells...... 91 Optical Probes in Biology...... 13 Plasticity: Fundamentals and Applications...... 97 Nanostructured Ceramic Oxides for Optical Properties of Functional Polymers Pocket Book of Integrals and Mathematical Supercapacitor Applications...... 82 and Nano Engineering Applications...... 108 Formulas, 5th Edition...... 45 Nanostructured Energy Devices: Optical Techniques in Regenerative Medicine...... 37 Polymer and Polymer-Hybrid Nanoparticles: Equilibrium Concepts and Kinetics...... 101 Optics Essentials: An Interdisciplinary Guide...... 37 From Synthesis to Biomedical Applications...... 105 Nanostructured Energy Devices: Optoelectronics Optics of Aperiodic Structures: Fundamentals and Polymer Electrolyte Fuel Cells: Physical Principles and Transport...... 100 Device Applications...... 37 of Materials and Operation...... 82 Nanostructured Semiconductors: Opto-Mechanical Systems Design, Fourth Edition, Polymer Electronics...... 108 From Basic Research to Applications...... 82 Two Volume Set...... 37 Polymer Nanocomposite Coatings...... 75 Nanostructures, Nanomaterials, and Opto-Mechanical Systems Design, Fourth Edition, Volume 1: Polymer Nanocomposite Foams...... 108 Nanotechnologies to Nanoindustry...... 101 Design and Analysis of Opto-Mechanical Assemblies...... 38 Polymer Products and Chemical Processes: Nanotech 2013: Technical Proceedings of the 2013 NSTI Opto-Mechanical Systems Design, Fourth Edition, Volume 2: Techniques, Analysis, and Applications...... 105 Nanotechnology Conference and Expo, Volumes 1-3...... 101 Design and Analysis of Large Mirrors and Structures...... 38 Polymer Surfaces and Interfaces: Acid-Base Nanotechnology 2014: Technical Proceedings of the Ordinary and Partial Differential Equations...... 44 2014 NSTI Nanotechnology Conference and Expo Interactions and Adhesion in Polymer-Metal Systems...... 109 Organic Light-Emitting Materials and Devices, (Volumes 1-3)...... 101 Polymers and Polymeric Composites: Second Edition...... 82 Nanotechnology and Drug Delivery, Volume One: Properties, Optimization, and Applications...... 109 Organic Solar Cells: Fundamentals, Devices, and Upscaling....22 Nanoplatforms in Drug Delivery...... 54 Polymers for Advanced Technologies: Organic Solar Cells: Materials, Devices, Interfaces, Nanotechnology and Drug Delivery, Volume Two: Processing, Characterization and Applications...... 109 and Modeling...... 21 Nano-Engineering Strategies and Nanomedicines Polymers for Packaging Applications...... 106 against Severe Diseases...... 54 Organic Structures Design: Applications in Optical Polymers in Telecommunications and Energy Applications...109 and Electronic Devices...... 102 Nanotechnology and Human Health...... 54 Polysulfide Oligomer Sealants: Synthesis, Properties, Orthopaedic Biomaterials in Research and Practice, Nanotechnology and Photovoltaic Devices: and Applications...... 106 Second Edition...... 73 Light Energy Harvesting with Group IV Nanostructures...... 57

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Portable Biosensing of Food Toxicants Rule-Based Modeling in Systems Biology...... 14 Surfactants in Tribology, Volume 3...... 112 and Environmental Pollutants...... 4 S Surfactants in Tribology, Volume 4...... 112 Precision Manufacturing Technologies...... 92 Symmetries and Symmetry Breaking in Field Theory...... 59 Safety Aspects of Engineered Nanomaterials...... 21 Principles and Applications of Therapeutic Ultrasound Synergy in Supramolecular Chemistry...... 95 in Healthcare...... 13 Safety of Nanomaterials along Their Lifecycle: Release, Synthetic Jets: Fundamentals and Applications...... 6 Principles of Electromagnetic Waves and Materials...... 83 Exposure, and Human Hazards...... 102 Systems Biology: Mathematical Modeling Principles of Fabric Formation...... 85 Scaffolds for Tissue Engineering: Biological Design, and Model Analysis...... 14 Principles of Metallurgical Thermodynamics...... 95 Materials, and Fabrication...... 74 T Principles of Solar Engineering, Third Edition...... 66 Scalable Innovation: A Guide for Inventors, Entrepreneurs, and IP Professionals...... 116 Principles of Sustainable Energy Systems, Second Edition...... 66 Targeted Muscle Reinnervation: Schrödinger’s Killer App: Race to Build the World’s First Principles of Thermodynamics...... 66 A Neural Interface for Artificial Limbs...... 50 Quantum Computer...... 25 Process Management in Spinning...... 85 Tech Connect World 2013 Proceedings: Nanotech, Second Harmonic Generation Imaging...... 14 Microtech, Biotech, Cleantech Proceedings DVD...... 103 Process Techniques for Engineering High-Performance Semiconductor Laser Theory...... 39 Materials...... 92 TechConnect World 2014 Proceedings: Nanotech, Semiconductor X-Ray Detectors...... 4 Microtech, Biotech, Cleantech Proceedings DVD Vol 1-4...... 103 Processes of Formation of Micro -and Nanodispersed Systems...... 95 Sensors for Process Control and Safety in Hydrogen Technology Computer Aided Design: Technologies...... 4 Simulation for VLSI MOSFET...... 84 Producing Fuels and Fine Chemicals from Biomass Using Nanomaterials...... 102 Silicon and Silicide Nanowires: Applications, Fabrication, Terahertz Astronomy...... 8 and Properties...... 83 Progress in Polymer Materials Science: Terahertz Biomedical Science and Technology...... 39 Research, Development and Applications...... 106 Silicon Earth: Introduction to Microelectronics and Ternary Alloys Based on II-VI Semiconductor Compounds...... 84 Nanotechnology, Second Edition...... 57 Properties of Materials...... 25 Testing for Small-Delay Defects in Nanoscale Silicon, Germanium, and Their Alloys: Growth, Defects, CMOS Integrated Circuits...... 55 Q Impurities, and Nanocrystals...... 83 Textiles for Industrial Applications...... 85 Simple Solutions to Energy Calculations, Fifth Edition...... 45 Quantifying Morphology and Physiology Thermochromic and Thermotropic Materials...... 106 of the Human Body Using MRI...... 50 Simulations of Oscillatory Systems: with award-winning Index Title Thermodynamics and Heat Power, Eighth Edition...... 67 Quantum Dot Sensors: Technology software PHYSICS OF OSCILLATIONS...... 6 Thermoelectric Materials: Advances and Applications...... 21 and Commercial Applications...... 21 Single Molecule Science: Physical Principles and Models...... 8 Tissue and Organ Regeneration: Advances in Micro- Quantum Mechanical Tunneling in Chemical Physics...... 15 Single-Atom Nanoelectronics...... 5 and Nanotechnology...... 103 Quantum Mechanics for Thinkers...... 62 Singular and Chiral Nanoplasmonics...... 39 Tomosynthesis Imaging...... 51 Quantum Mechanics I: The Fundamentals...... 62 Skin Bioscience: A Molecular Approach...... 14 Transport Phenomena Fundamentals, Third Edition...... 6 Quantum Mechanics II: Advanced Topics...... 62 Small Scale Optics...... 83 Trends in Biophysics: From Cell Dynamics Toward Quantum Mechanics, Fifth Edition...... 62 Smart Composites: Mechanics and Design...... 78 Multicellular Growth Phenomena...... 15 Quantum Nanosystems: Structure, Properties, Smart Materials Taxonomy...... 84 Tribocorrosion for Materials Engineers...... 79 and Interactions...... 102 Smart Mini-Cameras...... 39 Tunable Laser Optics, Second Edition...... 40 Quantum Optics for Beginners...... 62 Smart Sensors for Industrial Applications...... 54 Two-Dimensional Carbon: Fundamental Properties, Quantum Optics for Engineers...... 38 Sodium Fast Reactors with Closed Fuel Cycle...... 66 Synthesis, Characterization, and Applications...... 21 Quantum Thermodynamic Processes: Solar Power for the World: What You Wanted U Energy and Information Flow at the Nanoscale...... 66 to Know about Photovoltaics...... 103 Quantum Transport Calculations for Nanosystems...... 17 Solar Radiation: Practical Modeling for Ultrafast Infrared Vibrational Spectroscopy...... 9 Quantum-Chemical Calculation of Renewable Energy Applications...... 39 Ultrafast Laser Processing: From Micro- to Nanoscale...... 40 Unique Molecular Systems, Two-Volume Set...... 8 Special Integrals of Gradshteyn and Ryzhik: Ultra-Realistic Imaging: Advanced Techniques in Analogue and Quaternary Alloys Based on II - VI Semiconductors...... 83 the Proofs - Volume I...... 45 Digital Colour Holography...... 40 R Spectral Methods in Geodesy and Geophysics...... 27 Ultrasonic Treatment of Light Alloy Melts, Second Edition...... 97 121 Spike Timing: Mechanisms and Function...... 14 Ultrasound Imaging and Therapy...... 51 Radiation Synthesis of Materials and Compounds...... 89 Spintronics in Nanoscale Devices...... 84 Understanding Biophotonics: Fundamentals, Advances and Radiophysical and Geomagnetic Effects of Rocket Burn Statistical Computing in Nuclear Imaging...... 50 Applications...... 40 and Launch in the Near-the-Earth Environment...... 26 Stellar Explosions: Hydrodynamics and Nucleosynthesis...... 7 Understanding Chemistry through Cars...... 5 Radiosensitizers and Radiochemotherapy in the Understanding LED Illumination...... 40 Treatment of Cancer...... 50 Stereotactic Radiosurgery and Stereotactic Body Radiation Therapy...... 50 Understanding Spin Dynamics...... 62 Random Light Beams: Theory and Applications...... 39 Strength of Materials, Second Edition...... 95 Underwater Acoustic Modeling and Simulation, Fourth Edition.. Rare Earth Materials: Properties and Applications...... 83 40 Strengthening Design of Reinforced Concrete with FRP...... 78 Real Analysis and Foundations, Third Edition...... 57 Unified Grand Tour of Theoretical Physics, Third Edition...... 22 Structural Analysis of Polymeric Composite Materials, Recycling and Reuse of Materials and Their Products...... 115 Second Edition...... 110 Usability Testing of Medical Devices, Second Edition...... 74 Redox Proteins in Supercomplexes and Signalosomes...... 14 Structural Intermetallics and V/W/X/Z Remote Sensing Image Fusion...... 26 Intermetallic Matrix Composites...... 97 Renewable Energy: A First Course...... 68 Superfluid States of Matter...... 21 Vascularization: Regenerative Medicine and Tissue Engineering...... 74 Research Methodology on Interfaces of Physics Supermacroporous Cryogels: Water at Interfaces: A Molecular Approach...... 16 and Chemistry in Micro and Nanoscale Materials...... 15 Biomedical and Biotechnological Applications...... 110 Wave Optics: Basic Concepts and Contemporary Trends...... 41 Research Methods in Science and Engineering...... 4 Superstrings and Other Things: A Guide to Physics...... 26 Wavelet Analysis in Civil Engineering...... 6 Resistive, Capacitive, Inductive, Supplementary Cementing Materials in Concrete...... 116 Wavelets and Fractals in Earth System Sciences...... 27 and Magnetic Sensor Technologies...... 4 Surface Chemistry Essentials...... 112 Waves and Oscillations in Nature: An Introduction...... 26 Reverse Engineering of Rubber Products: Surface Imaging for Biomedical Applications...... 50 Concepts, Tools, and Techniques...... 109 Webb’s Physics of Medical Imaging, Second Edition...... 51 Surface Physics: Theoretical Models RNA Nanotechnology...... 102 and Experimental Methods...... 112 Wireless and Guided Wave Electromagnetics: Fundamentals and Applications...... 41 Robotic Surgery: Smart Materials, Robotic Structures, Surface Tension and Related Thermodynamic XAFS for Everyone...... 87 and Artificial Muscles...... 74 Quantities of Aqueous Electrolyte Solutions...... 112 X-Ray Diffraction: Modern Experimental Techniques...... 41 Rubber Compounding: Chemistry and Applications, Surfactant Science and Technology: Second Edition...... 109 Retrospects and Prospects...... 112 Zinc Oxide Nanostructures: Advances and Applications...... 84

For more information and a complete list of titles, visit us at www.crcpress.com A Beilin; Dmitry...... 75 Chabot; Victor...... 79 Bellini; Marco...... 33 Chakrabarty; Krishnendu...... 55 Abelquist; Eric W...... 46 Belozerova; Tatyana...... 44 Chakraborty; Tanmoy...... 61 Abhilash...... 91 Benedict; Stanley H...... 50 Chanda; Manas...... 105 Adams; Donald F...... 77 Berlin; Alexandr A...... 87, 88, 114, 116 Chandrasekhar; E...... 27 Adams; Jesse...... 54, 101 Berne; Rosalyn W...... 67 Chang; Jiang...... 68 Addison; Paul S...... 43 Bertolotti; Mario...... 34 Chattaraj; Pratim Kumar...... 18 Adler; Ralph P.I...... 79 Berz; Martin...... 59 Chatterjee; Pranesh...... 6 Afzali; Arezo...... 56 Beu; Titus A...... 16 Chattopadhyay; Surojit...... 17 Agarwal; Ravi ...... 42 Bhadra; Shyamal...... 30 Chellapandi; P...... 66 Aiazzi; Bruno...... 26 Bhat; H.L...... 15 Chen; An...... 77 Aimé; Jean-Pierre...... 56 Bhatele; Abhinav...... 16 Chen; Goong...... 44 Aitchison; Ian J.R...... 59 Bhattacharjee; Sudeep...... 59 Chen; John J. J...... 96 Akasaka; Takeshi...... 19 Bhowmick; Anil K...... 109 Chen; Qizhi...... 69 Alavi; Sajid...... 106 Bianco; Vincenzo...... 65 Chen; Ying (Ian)...... 20 Ali; Jalil...... 83 Bianco-Peled; Havazelet...... 68 Chen; Yuan...... 17 Aliyev; Gabil Garibxan Ogli...... 107 Bielinski; Dariusz M...... 114 Cheng; Gary J...... 32 Aliyev; Soltan Ali Ogli...... 3 Binh; Le Nguyen...... 27, 29, 36, 41 Cheng; Ya...... 40 Author Index Al-Khalili; Jim...... 22 Birdi; K. S...... 111, 112 Chernogor; Leonid F...... 26 Allagui; Anis...... 60 Biresaw; Girma...... 112 Cherry; Simon R...... 47 Alparone; Luciano...... 26 Birkfellner; Wolfgang...... 45 Chien; Liang-Chy ...... 19 Alwarappan; Subbiah...... 80 Bisquert; Juan...... 100, 101 Chizhik; Alexander...... 3 Amato; Joseph C...... 25 Bjelkhagen; Hans...... 40 Cho; Sang Hyun...... 45 Amemiya; Shigeru...... 52 Black; Jonathan...... 73 Cho; Yeol Je...... 42 Ando; Tsuneya...... 82 Blank; Vladimir Davydovich...... 20 Choi; Anthony H. W...... 31 Aneli; Jimsher N...... 109, 113 Blaunstein; Nathan...... 26 Choi; Jung Han...... 55 Anisimov; Victor...... 12 Blough; Eric R...... 52 Chollakup; Rungsima...... 76 Arias; José L...... 54 Bluestein; Maurice...... 67 Chon; James W. M...... 35 Arjunan; Sridhar Poosapadi...... 70 Bochkarev; A. A...... 95 Chow; Tahsin J...... 102 Arora; Vijay Kumar...... 5 Boicea; Valentin A...... 64 Chow; Tai L...... 22 Ashokkumar; Muthupandian...... 113 Boichenko; A. M...... 31 Chrostowski; Lukas...... 32 Aslalnov; Leonid A...... 92 Bolgar; Michael...... 107 Chu; Paul K...... 60 Asli; Kaveh Hariri...... 3 Boriskina; Svetlana...... 39 Churchman; G. Jock...... 95 Astakhov; Viktor P...... 90 Bose; Subir Kumar...... 95 Ciocoiu; Mihai...... 94 Asyali; Musa H...... 47 Bose; Susmita...... 90 Clements; David L...... 7 Audette; Gerald F...... 71 Boudenne; Abderrahim...... 115 Close; Frank...... 24 Auletta; Gennaro...... 62 Bowers; Geoffrey M...... 5 Cole; George H. A...... 7 Ayub; Zahid H...... 65 Bowers; Ruth A...... 5 Constantinides; Christakis...... 48 B Brett-Boon; Lois...... 4 Covert; Markus W...... 11 Brey; Eric M...... 74 Cressler; John D...... 57 Babaev; Egor S...... 21 Brock; Kristy K...... 47 Csele; Mark Steven...... 33 Babkin; Vladimir A...... 8 Bromann; Mark...... 84 Cuerrier; Charles M...... 10 Babu; Snigdha S...... 68 Bromley; Stefan T...... 18 Cui; Tie Jun...... 81 Backman; Vadim...... 8 Bronsgeest; Merijntje...... 49 Badawi; Ramsey D...... 47 D Bronzino; Joseph D...... 69, 72, 73 122 Bader; Augustinus...... 69 Brotherton-Ratcliffe; David...... 40 D’Agostino; Stefania...... 30 Balakrishnan; Avinash...... 82 Brozek; Tomasz...... 81 Dahlbom; Magnus...... 49 Balasubramanian; M...... 76 Brühne; Kai...... 110 Dal Negro; Luca...... 37 Balch; Alan L...... 19 Bryan; Jeff C...... 57 Daniel; Rostislav...... 111 Balkose; Devrim...... 103 Bucak; Seyda...... 51 Das Gupta; Saikat...... 109 Ballada; Antonio...... 104 Buchanov; V. V...... 31 Das; Debaprasad...... 98 Balu; Alina Mariana...... 102 Bucknum; Michael J...... 61 Dass; N.D. Hari...... 66 Bandyopadhyay; Amit...... 90 Budinski; Kenneth G...... 110 Date; Ghanashyam...... 24 Banerjee; Ayan...... 41 Bullen; Peter...... 67 Datta; Alokmay...... 17 Banerjee; Prabir Kumar...... 85 Burgess; John...... 96 Datta; Asit Kumar...... 32 Baranwal; Krishna C...... 109 Burkowski; Forbes J...... 10 Datta; Shubhabrata ...... 86 Barat; Ken...... 33 Butikov; Eugene I...... 6 Dattagupta; Sushanta...... 63 Barbero; Ever J...... 77 Buttner; William...... 4 Davalos; Julio F...... 77 Bar-Cohen; Yoseph...... 86 Davidovich-Pinhas; Maya...... 68 Barlow; Ann K...... 50 C Davidson; Michael W...... 15 Baronti; Stefano...... 26 Cabrera; Carlos R...... 97 Day; Richard N...... 15 Bartecki; Adam...... 96 Cacuci; Dan Gabriel...... 58 De Bartolo; Loredana...... 69 Bastos; João Pedro A...... 81 Cai; Weiping...... 91 de la Chapelle; Marc Lamy...... 13, 30 Bastos-Filho; Teodiano Freire...... 70 Callan; John...... 21 De Natale; Paolo ...... 33 Basu; Prasanta Kumar...... 39 Calle; Carlos I...... 26 de Oliveira Louro; Ricardo Saraiva Loureiro...... 14 Basu; Rikmantra ...... 39 Calvin; Scott...... 87 De Sio; Luciano...... 27 Batenin; V. M...... 31 Cambi; Alessandra...... 10 Dean; David S...... 63 Bauer; Elizabeth...... 12 Campagnola; Paul J...... 14 Deberdeev; Rustam Ya...... 109 Baukal Jr.; Charles E...... 65, 66 Carlsson; Leif A...... 77 Deberdeev; Timur R...... 106 Bawa; Raj...... 71 Carraher Jr.; Charles E...... 104 Deleonibus; Simon...... 80 Bazylyak; Liliya I...... 109 Castillo; Jose E...... 44 Della-Giustina; Daniel E...... 85 Behling; Rolf...... 48 Castro; Eduardo A...... 53, 61, 108 Demirkaya; Omer...... 47

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Dendy; Philip Palin...... 49 French; Paul M. W...... 29 Hani; Ahmad Fadzil Mohamad...... 50 Dey; Arjun...... 74, 75 Fried; Joel R...... 105 Harding; Kevin...... 30 Di Natale; Corrado...... 99 Friedman; Adam...... 52 Haruyama; Junji...... 79 Diao; Zijian...... 44 Fries; Richard C...... 70 Haynes; William M...... 67 Diaz-Moreno; Irene...... 14 Fujita; Satoshi...... 35 Hazell; Paul J...... 93 Dickey; Fred M...... 33 Fuxreiter; Monika...... 10 Hazewinkel; Michiel...... 41 DiLorenzo; Patricia M...... 14 G He; Junhui...... 22 DiMasi; Elaine...... 86 Heaton; Brian...... 49 Dimri; V. P...... 27 Gadre; V. M...... 27 Hedin; Eric R...... 84 Dixit; P.M...... 97 Galstian; Tigran V...... 39 Heikal; Ahmed A...... 13 Dixit; U.S...... 97 Galvez; Enrique J...... 25 Henner; Victor...... 44 Doblin; I. V...... 88 Ganapathy; R...... 36 Herman; Russell L...... 42 Dobnikar; Jure...... 63 Ganeev; Rashid A...... 60 Hermansson; Leif...... 75 Dobson; Jon...... 99 Gang; Zhang...... 82 Herr; Daniel J.C...... 100 Dogar; Cetin...... 114 Gao; Xin-Lin...... 114 Heslehurst; Rikard Benton...... 76 Don; Gary W...... 68 Garzelli; Andrea...... 26 Hess; Karl...... 23 Donegan; John...... 98 Gaspar; Daniel J...... 36 Hey; Anthony J.G...... 59 Dong; Lixin...... 53 Gavrilyuk; Alexander...... 99 Hihara; Lloyd H...... 79 Dowling; Jonathan P...... 25 Gay; Daniel...... 76 Hikita; Harumi...... 19 Dray; Tevian...... 42 Gehr; Peter...... 100 Hirose; Kenji...... 17 Du; Winncy Y...... 4 Geiser; Juergen...... 42 Hlavacek; William S...... 14 Duan; Guotao...... 91 Genin; Guy M...... 11 Ho; Jee-Hou...... 93 Duarte; F.J...... 38, 40 Geuskens; Georges...... 114 Holthoff; Ellen L...... 33 Ghatak; Ajoy...... 30 E Hopcraft; Keith Iain...... 57 Gheshmi; Siavash...... 74 Howard; Ruth H...... 89 Echegoyen; Luis...... 19 Ghosh; Nirmalya...... 41 Howell; Bob A...... 105 Author Index Ehrlich; Robert...... 68 Ghosh; Swapan Kumar...... 18 Hsin-Fei; Meng...... 108 Eikerling; Michael...... 82 Ghukasyan; Vladimir V...... 13 Hsu; Chain-Shu...... 19 Ejder-Korucu; Mehtap...... 114 Gibson; Walton C...... 44 Hu; Xiaoyong...... 38 El Messabeb-Ouali; Amel...... 60 Gille; Wilfried...... 59 Huang; Ying-Ying...... 47 Elhajjar; Rani...... 78 Gillen; Glen D...... 34 Huang; Yongli...... 87 El-Hofy; Hassan Abdel-Gawad ...... 90 Gillen; Katharina...... 34 Huang; Yu...... 83 Elson; Daniel S...... 29 Gilmore; Adam M...... 80 Hubball; Jack...... 107 Emond; Claude...... 54 Glezer; A. M...... 94 Hübert; Thomas...... 4 Enoki; Toshiaki...... 82 Glick; Stephen...... 51 Hulicova-Jurcakova; Denisa ...... 111 Eranna; Golla...... 3 Goel; Sandeep K...... 55 Hurley; Morgan J...... 85 Erdem; Arzum...... 4 Goetsch; Steven J...... 50 I Eremin; Alexey ...... 17 Gogotsi; Yury...... 90 Eskin; Dmitry G...... 97 Gold; Scott A...... 4 Iannone; Eugenio...... 52 Eskin; Georgy I...... 97 Goldade; Victor...... 84 Igarashi; Eiki...... 100 Estrin; Emmanuel Isakovich...... 20 Gong; Qihuang...... 38 Imae; Toyoko...... 14 Etter; Paul C...... 40 Gonzalez; Julian...... 3 Iniewski; Kris...... 48 F Gonzalez; Leonel P...... 32 Iniewski; Krzysztof...... 32, 35, 52, 53, 54 Gortych; Joseph E...... 67 Ionescu-Bujor; Mihaela...... 58 Fadeel; Bengt...... 99 Goswami; D. Yogi...... 63, 64, 66 Ionita; Iulian...... 18 Faeder; James...... 14 Gower; Laurie B...... 86 Ischenko; Anatoly A...... 92 123 Fan; Yubo...... 46 Granet; Irving...... 67 Ison; Keith...... 48 Farag; Mahmoud M...... 94 Granitzer; Petra...... 82 Ivanovich; Vatin Nikolai...... 87, 88, 114, 116 Farahi; Faramarz...... 31 Greanya; Viktoria...... 28 Iyengar; Satteluri R. K...... 43 Farncombe; Troy...... 48 Greaves; John...... 12 J Farrell; Mikella E...... 33 Gregersen; Niels...... 36 Faunce; Thomas Alured...... 101 Groeger; Joseph...... 107 Jain; Pankaj...... 7 Fayer; Michael D...... 9 Grohens; Yves...... 115 Jain; Vaibhav...... 108 Fayyad; Dolly Khuwayri...... 43 Groves; Timothy R...... 28 Jakeman; Eric...... 57 Fecht; Hans J...... 110 Grum; Janez...... 96 Jameson; David M...... 12 Fellmuth; Bernd...... 4 Guarrotxena; Nekane...... 15, 93, 103 Jaroszewski; Maciej...... 106 Fenster; Aaron...... 51 Gubareni; Nadiya M...... 41 Javaherdashti; Reza...... 78 Fetisov; Gennady V...... 92 Gucciardi; Pietro Giuseppe...... 30 Jekeli; Christopher...... 27 Feychuk; Petro...... 84 Guha; Shekhar...... 32, 34 Jeurgens; Lars P. H...... 75 Ficek; Zbigniew...... 62 Gun’ko; Vladimir M...... 87 Jha; A.R...... 83 Fiddy; Michael A...... 32 Gupta; K.M...... 93 Jiang; Hongrui...... 34 Figovsky; Oleg...... 75 Gupta; Subhasish Dutta...... 41 Jiang; Huabei...... 49 Fischer-Cripps; Anthony C...... 20, 23, 24, 25, 26 Gurses; Ahmet...... 114 Jiang; Jianwen...... 16 Fitzpatrick; Richard...... 25, 60 Jiang; San Ping...... 91 H Fleet; Michael E...... 70 Jiang; Wei Xiang...... 81 Fleming; Tony ...... 12 Hack; Erwin...... 38 Jimenez; Alfonso...... 113 Flower; M A...... 51 Haghi; A. K...... 8, 53, 55, 76, 78, 89, 92, Joe; Yong S...... 84 Focke; Walter W...... 104 ...... 93, 100, 101, 108, 109, 115 Johnson; Arthur T...... 70 Forbes; Andrew...... 32 Haghighat; Alireza...... 58 Johnston; Ian...... 24 Forcada; Jacqueline...... 98 Haija; Ajawad...... 23 Jose; Jordi...... 7 Franklin; Scott...... 19 Hamblin; Michael R...... 47 Jose; Josmin P...... 76, 106 Fraxedas; Jordi...... 16, 89 Hamrang; Abbas...... 78, 92, 94, 103, 105 Joseph; George...... 28

For more information and a complete list of titles, visit us at www.crcpress.com Joswik; Roman...... 87, 88, 114, 116 Kumar; Arun...... 52 Malhotra; Sanjay...... 89 Julian; Maureen M...... 88 Kumar; Ashok...... 80, 110 Malsch; Ineke...... 54 K Kumar; Dinesh...... 70 Mamonova; Marina V...... 112 Kumar; Pramod...... 35 Manca; Ornonzio...... 65 Kadokawa; Jun-ichi...... 71 Kumar; Prashant...... 92 Mandal; Chittaranjan ...... 53 Kaiyu; Raymond Tong...... 71 Kumar; R. Senthil...... 85 Manickam; Sivakumar...... 113 Kalajdzievski; Sasho...... 43 Kumar; S. Kishor...... 115 Mansour; Heidi M...... 52 Kalarikkal; Nandakumar...... 68, 97, 100, 106 Kurinec; Santosh K...... 53 Marcu; Laura ...... 29 Kale; Laxmikant V...... 16 Kuroda; Takao...... 29 Maria; Hanna J...... 76 Kalluri; Dikshitulu K...... 83 Kurzak; Krzysztof...... 96 Mark; James E...... 105 Kan; Chi-wai...... 87 Kwong; Wing C...... 36 Markov; Marko S...... 46 Kaneko; Yoshiro...... 71 L Marsh; Derek...... 11 Karagkiozaki; Varvara...... 71 Marulanda; Jose Mauricio...... 98 Karmakar; Pranab Kumar...... 26 La Saponara; Valeria ...... 78 Masterson; Robert...... 65 Katsaras; John...... 12 Lacefield; James C...... 51 Matcher; Stephen J...... 37 Kavanagh; Brian D...... 50 Lægsgaard; Jesper...... 36 Matinlinna; Jukka Pekka...... 71 Kazaryan; M. I...... 31 Lagoudakis; Konstantinos...... 61 Matolyak; John...... 23 Kelkar; Ajit D...... 100 Landsberger; Sheldon...... 58

Author Index Matteoli; Enrico...... 11 Keller; Ole...... 34 Latanision; Ronald M...... 79 Matubayasi; Norihiro...... 112 Kelly; P.F...... 23, 25 Lavrinenko; Andrei V...... 36 Mayer; James W...... 91 Kendler; Jonathan...... 74 Lawes; Ron...... 4 Mayles; P...... 47 Kessler; Michael R...... 77 Lawrie; Ian D...... 22 McCauley; Ronald A...... 78 Khademhosseini; Ali...... 103 Layton; Bradley...... 13 Medvedevskikh; Yurii J...... 108 Khakimullin; Yuri N...... 106 Lee; Chi H...... 35 Mehta; Sohum...... 13 Khan; Ahmad Shahid...... 81 Lee; Jin-Fa...... 16 Mei; Zhong Lei...... 81 Khan; M. Nisa...... 40 Lee; S.-T...... 107 Mendelson; Mel I...... 52 Khanna; Vinod Kumar...... 30 Legin; Audrey...... 99 Mercader; Andrew G...... 53, 108 Kharchenko; Vadym M...... 63 Lehnert; Shirley...... 50 Merches; Ioan...... 22 Kharisov; Boris Ildusovich...... 89 Lehr; Claus-Michael...... 102 Meron; Ehud...... 57 Kharissova; Oxana Vasilievna...... 89 Lekishvili; Nodar G...... 108 Meronek; Susan...... 107 Khartchenko; Nikolai V...... 63 Li; Guangyong...... 44 Meunier; Marc...... 89 Khenner; Mikhail...... 44 Li; Jun...... 98 Michael; M. Siluvai...... 20 Khrennikov; Andrei...... 60 Li; Long-Yuan...... 85 Mickens; Ronald E...... 42 Kim; Se-Kwon...... 72 Li; Qiang...... 46 Migliaresi; Claudio...... 74 Kimball; John...... 25 Li; Shaofan...... 114 Mikitaev; A. K...... 105 King; Paul H...... 70 Li; Yue...... 91 Miller; Reinhard...... 110 Kinoshita; Shuichi...... 28 Li; Zhigang Rick...... 82 Mil’nikov; Gennady...... 15 Kirsanov; Dmitry...... 99 Lidgi-Guigui; Nathalie...... 30 Minkin; Vladimir S...... 106 Kissinger; Gudrun...... 83 Lidke; Diane S...... 10 Minkowycz; W. J...... 94 Kitchin; C.R...... 7 Lin; Tong...... 20 Mirabella; Salvo...... 57 Kitsinelis; Spyridon...... 34 Lipanov; A. M...... 89 Miranda; Félix...... 97 Klimov; Vasily...... 35 Liu; LinShu...... 104 Miranda; Guillermo F...... 44 Klimovskii; I. I...... 31 Liu; Zhaoping...... 80 Mirkin; Michael V...... 52 Klodzinska; E...... 92 Lobo; Victor Manuel de Matos...... 114 MirMahaleh; Moein MehdiPour...... 55 Klodzinska; Ewa...... 78, 88, 89 Loehr; Nicholas...... 16 Mishra; Ajay Kumar...... 99 124 Knoll; Wolfgang...... 111 Logothetidis; Stergios...... 71 Mishra; D. P...... 64 Kobayashi; Nobuhiko...... 17 Londerville; Stephen...... 66 Mishra; Munmaya...... 71, 106, 107 Kobayashi; Tetsuhiko...... 113 Longstaff; Alan...... 6 Mitra; Parthasarathi...... 59 Kodolov; Vladimir I...... 101, 115 Lötzsch; Detlef...... 106 Mitra; Rahul...... 97 Kok; Kenneth D...... 65 Lovald; Scott...... 73 Mittal; K.L...... 112 Kokil; Akshay...... 108 Lowe; B. G...... 4 Mittal; Kash...... 112 Kolb; Vera M...... 6 Lu; Xing...... 19 Mittal; Rajat...... 6 Korepanov; M. A...... 89 Lu; XinPei...... 60 Mittal; Vikas...... 75, 108 Korotkova; Olga...... 39 Lucas; Cyril Bernard...... 8 Mittemeijer; Eric J...... 75 Kozlov; G. V...... 88, 105, 107, Lukaszew; Rosa A...... 80 Mohseni; Kamran...... 6 Kozlowski; Ryszard...... 103, 114 Luong; John H...... 69 Moll; Victor H...... 45 Kraikivski; Pavel...... 15 Luque; Rafael...... 102 Kralchevsky; Peter...... 110 Luther; Wolfgang...... 21 Molodykh; E. I...... 31 Krantz; Steven G...... 57 Lvova; Larisa...... 99 Monteiro-Riviere; Nancy A...... 102 Krc; Janez...... 37 Lyshevski; Sergey Edward...... 55 Moore; John H...... 15 Morgan; Stephen P...... 37 Kreith; Frank...... 63, 64, 66 M Kremling; Andreas...... 14 Morigaki; Kazuo...... 19 Krishnan; Sunil...... 45 Maamir; Seghir...... 115 Morozkin; Nikolay D...... 107 Kruk; Danuta...... 62 Maciá; Enrique...... 21 Morris; James E...... 52, 98 Krumdieck; Susan...... 66 Maddaloni; Pasquale...... 33 Mortazavi; Vahid...... 111 Kubby; Joel A...... 27 Maghsoodlou; Shima...... 56 Motta; Antonella...... 74 Kubica; Stefan...... 113 Mahler; Guenter...... 66 Moyer; Bruce A...... 86 Kucˇerka; Norbert...... 12 Majumdar; Debasish...... 7 Mudhoo; Ackmez...... 110 Kuhlbusch; Thomas A.J...... 102 Majumdar; Pradip...... 64 Muftuler; L. Tugan...... 50 Kuiken; Todd A...... 50 Makabe; Toshiaki...... 60 Mukasyan; Alexander S...... 92 Kulikovsky; Andrei ...... 82 Makarov; Dmitrii E...... 8 Mukhopadhyay; Anoop Kumar...... 74, 75 Kulish; Elena I...... 106 Makino; Kyoko...... 59 Mukhopadhyay; Bratati...... 39

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 Mukhopadhyay; Rabindra...... 109 Pathak; Hemant Kumar ...... 42 Ram; Manoj Kumar ...... 73 Muliana; Anastasia...... 78 Pathak; Yashwant...... 51 Rampalli; Sitaram...... 109 Mulligan; Catherine N...... 110 Patra; Amit...... 53 Rand; Barry P...... 22 Munshi; Soumika...... 32 Patra; Amitava...... 89 Raneesh; B...... 97 Murphy; Bridget...... 41 Patterson; Gary D...... 105 Rangacharyulu; Chary...... 58 Musa; Sarhan M...... 11, 28, 29, 53, 56 Paulsen; William...... 41 Ranganathan; Naryanaswami (Mohan)...... 114 Musil; Jindrˇich...... 111 Pavesi; Lorenzo...... 31 Rangelov; Stanislav...... 105 Myers; Daryl Ronald...... 39 Pavone; Francesco S...... 14 Rasheed; Hayder A...... 78 N Pearce; Eli M...... 105 Rastogi; Pramod...... 38 Peer; Dan...... 73 Ravera; Francesca...... 110 Nabeshima; Tatsuya...... 95 Pellegrino; Paul M...... 33 Raymo; Françisco M...... 21 Nagase; Shigeru...... 19 Pelling; Andrew E...... 10 Reddy; J.N...... 76 Nagatsuma; Tadao...... 3 Peng; Zhen ...... 16 Reiser; Ingrid...... 51 Naghiyev; Faig Bakhman Ogli...... 107 Pennathur; Sumita...... 54, 101 Reisner; David E...... 55 Nahum; A...... 47 Pergament; M. I...... 24 Rende; Deniz...... 51 Naji; Ali...... 63 Permyakova; I. E...... 94 Revankar; Shripad T...... 64 Nakahara; Mikio...... 43 Peterson; Donald R...... 69, 72, 73, Rex; Andrew...... 23 Nakamura; Hiroki...... 15 Pethrick; Richard A...... 105 Richter; Henning...... 22 Nakamura; Kenichiro...... 108 Petrovic; Zoran Lj...... 60 Rickerby; David...... 54 Narayanan; A Satya...... 26 Pezzotti; Giuseppe...... 74 Ridley; Kevin D...... 57 Nardin; Michel...... 76 Pingarron; Jose M...... 69 Ristau; Detlev...... 33 Nardini; Sergio...... 65 Pipes; R. Byron...... 77 Ritter; R. Shane...... 32 Nassif; Nabil...... 43 Pispas; Asterios...... 105 Rivetti; Angelo...... 45 Nastasi; Michael...... 91 Pizzini; Sergio...... 83 Roberts; Philip...... 96 Natarajan; K. A...... 91 Plawsky; Joel L...... 6 Roboz; John...... 12 Natarajan; Vasant...... 8 Podgornik; Rudolf...... 63 Rodgers; Brendan...... 109 Author Index Navon; Ionel Michael...... 58 Poinern; Gerrard Eddy Jai...... 99 Rogachev; Alexander S...... 92 Nazarenko; Sergey...... 5 Polikarpov; Evgueni...... 36 Rogel-Salazar; Jesus...... 42 Nelson; Bradley J...... 53 Polyakova; V. I...... 95 Rogers; Ben...... 54 Neu; Corey P...... 11 Polyanin; Andrei D...... 43 Rogers; Ben...... 101 Neverov; Aleksander...... 84 Popovic´; Marko B...... 69 Romsted; Laurence S...... 112 Nieh; Mu-Ping...... 12 Porsezian; K...... 36 Rose; Felicity R...... 37 Nikoleli; Georgia-Paraskevi...... 4 Pourhashemi; Ali...... 78, 88 Rosenbaum; Eric R...... 85 Nikolelis; Dimitrios P...... 4 Prabaharan; S. R. S...... 20 Rosenwald; J.C...... 47 Nishikawa; Robert M...... 46 Pradeep; T...... 55 Rottwitt; Karsten...... 36 Nishikawa; Takeo...... 35 Prasad; B. L. V...... 89 Roy; Samit...... 76 Nof; Shimon Y...... 32 Prasad; Rajendra...... 113 Roy; Sanat Kumar...... 95 Northrop; Robert B...... 3 Prati; Enrico...... 5 Roychoudhuri; Chandrasekhar...... 28 Nosonovsky; Michael...... 111 Presser; Volker...... 90 Rubinstein; Israel...... 71 NSTI...... 101, 103 Preziosi; Luigi...... 10 Rufford; Thomas E...... 111 Nwaoha; Chikezie...... 78 Priyadarshy; Satyam...... 70 Rullgard; Hans...... 34 O Prokof’ev; Nikolay V...... 21 Rumpf; Klemens...... 82 Prudnikov; Vladimir V...... 112 Ruzer; Lev S...... 53 O’ Connell; John P...... 11 Prudnikova; Irina A...... 112 Ryan; James G...... 100 O’Donnell; Peter J...... 5 Pucci; Annemarie...... 13 S 125 Obare; Sherine O...... 73 Pumera; Martin...... 100 Oberle; Tim...... 92 Purkiss; John A...... 85 Sa; Jacinto...... 86 Ocana; Jose L...... 96 Putz; Mihai V...... 102 Sadowski; Nelson...... 81 Ogihara; Chisato...... 19 Saha; Samar K...... 79 Q/R Oktem; Ozan...... 34 Saha; Swapan K...... 26 Olch; Arthur J...... 49 Qi; Jinyi...... 47 Sahoo; Prasanna K...... 47 Oluwafemi; Oluwatobi Samuel...... 76 Qiao; Pizhong...... 77 Sala; Fabio Della...... 30 Ondarçuhu; Thierry ...... 56 Qiao; Qiquan ...... 21 Sandeep; K. P...... 106 Ong; Kevin L...... 73 Qin; Qing-Hua...... 72 Santos; Jose Luis ...... 31 Ooi; Jong-Boon...... 93 Qua; Hock-Chye...... 93 Sareen; R. A...... 4 Ortiz Mendez; Ubaldo...... 89 Qunfeng; Cheng...... 17 Sarkar; Chandan Kumar...... 84 Osarenren; John...... 94 Radu; Daniel...... 22 Sato; Motohiro...... 90 Ouahab; Lahcene...... 111 Radulescu; Vicentiu D...... 44 Sattler; Klaus D...... 56 Ozilgen; Mustafa...... 63 Radusch; Hans-Joachim...... 104 Schiessel; Helmut...... 10 P Rae; Alastair I. M...... 62 Schlesinger; David J...... 50 Rafiei; Saeedeh...... 56 Schlesinger; Mark E...... 96 Pabst; Georg...... 12 Rafiei; Saeedeh...... 56 Schmidt; Frank...... 36 Pal; Palash B...... 58, 59 Rahaman; Hafizur...... 98 Schmidtchen; Ulrich...... 4 Palz; Wolfgang...... 103 Rahim; Nur Aida Abdul...... 72 Schnekenburger; Jürgen...... 102 Pan; Dipanjan...... 48 Rai; Jagdish...... 24 Schobert; Harold H...... 63 Pandey; B. D...... 91 Raj; Baldev...... 66 Scholz; Martin...... 68 Pandit; Soumya...... 53 Rajan; Ginu...... 37 Schultz Feuser; Aimee E...... 50 Papaefthymiou; Georgia C...... 73 Rajasekar; S...... 62 Schultz; Carsten...... 13 Park; Chul B...... 107 Rajasekar; Shanmuganathan...... 62 Scianna; Marco...... 10 Pasbakhsh; Pooria...... 95, 104 Rajkiewicz; Maria...... 87, 93 Seco; Joao...... 48 Pastorin; Giorgia...... 98 Rakovich; Yury...... 98 Seeboth; Arno...... 106 Pathak; Anirban ...... 61 Rakovsky; Slavcho Kirillov...... 103 Seeck; Oliver H...... 41

For more information and a complete list of titles, visit us at www.crcpress.com Setlur; Girish S...... 61 Thakur; Vijay Kumar...... 77, 104 Willander; Magnus...... 84 Shafraniuk; Serhii...... 19 Thomas; Michael...... 116 Willson; Keith...... 48 Shahinpoor; Mohsen...... 74 Thomas; Sabu...... 55, 56, 68, 78, 93, 97, 106, 108 Wohlleben; Wendel...... 102 Shankar; Latha...... 70 Thouas; George...... 69 Wolters; Janik...... 61 Sharma; Ashwani...... 98 Thulukkanam; Kuppan...... 65 Wong; Jack...... 71 Sharma; Rohit...... 55 Tidemand-Lichtenberg; Peter...... 36 Wong; Kok-Cheong...... 93 Sharma; Sanjay K...... 110 Ting; Yu...... 21 Wong; Yee-Shiuan...... 93 Shattuck; Mark...... 19 Tiwari; Ashutosh...... 97 Wood; Robert J. K...... 115 Shaw; Chris C...... 46 Tiwari; Atul...... 97 Woolfson; Michael M...... 7 Shcherbak; Larysa...... 84 Toh; Tze-Chuen...... 3 Wu; Chengtie...... 68 Shen; Pei Kang...... 91 Tomashyk; Vasyl...... 83, 84 Wu; Nianqiang...... 98 Shenderova; Olga...... 18 Topic; Marko...... 37 Wu; Yuping...... 80 Sherif; S.A...... 64 Toussaint; Godfried T...... 67 Wuthrich; Rolf...... 60 Shil’ko; Serge...... 84 Tran; C. Lang...... 102 X/Y Shima; Hiroyuki ...... 90 Trohidou; Kalliopi N...... 81 Shinada; Takahiro...... 5 Trudeau; Matthew C...... 11 Xi; Ning...... 44 Shtein; Max...... 116 Tsia; Kevin...... 40 Xiao; Yin...... 68 Shteyn; Eugene...... 116 Tsoulfanidis; Nicholas...... 58 Xu (Kyo Jo); Qiang...... 113

Author Index Singh; D.K...... 91 Tsuda; Akira...... 100 Xu; Qiang...... 89 Singh; Kamal P...... 35 Tsuzuki; Takuya...... 115 Xu; Yao...... 98 Singh; Ramesh K...... 29 Tu; King-Ning...... 83 Yacoubian; Araz...... 37 Sinha; Sitabhra...... 49 Tuchin; Valery V...... 27 Yadav; Kanhaiya Lal...... 24 Siochi; R. Alfredo C...... 47 Turov; Vladimir V...... 87 Yamada; Isao...... 91 Sitek; Arkadiusz...... 50 Tuttle; Mark E...... 110 Yang; Guu-Chang...... 36 Sivakumar; P. M...... 108 Tyszkiewicz; Wiktor...... 87 Yang; Li...... 87 Sivakumar; P. M...... 115 U/V Yang; Weimin...... 68 Smith; Paul E...... 11 Yang; Xin Mi...... 81 Smitthipong; Wirasak...... 76 Ungar; Abraham Albert...... 41 Yanovskii; Yu G...... 107 Soifer; Victor A...... 29 Upadhyay; Ranjit Kumar...... 43 Yap; Eng-Hwa...... 93 Somasundaran; Ponisseril...... 113 Vafai; Kambiz...... 65 Yaragalla; Srinivasarao...... 106 Son; Joo-Hiuk...... 39 Vaillencourt; Richard R...... 45 Yazami; Rachid...... 95 Søndergaard; Thomas...... 36 Valenta; Jan ...... 57 Yi; Dong Kee...... 73 Song; Ho-Jin...... 3 van Baal; Pierre...... 58 Yihong; Wu ...... 21 Sorguven Oner; Esra...... 63 van Herk; Alex...... 98 Yoder; Paul...... 37, 38 Sparrow; Ephraim M...... 94 Varfolomeev; Sergei D...... 113 Yongmei; Zheng...... 17 Spencer; Nicholas D...... 15 Varghese; Jini...... 106 Yongping; Hou...... 17 Sridhar; S...... 49 Varzakas; Theodoros ...... 4 Yoshizawa; Toru...... 31 Srivastava; Ashok...... 98 Vasudeva Rao; P.R...... 66 Young; Brent Richmond...... 96 Srivastava; Atul...... 29 Vathsan; Radhika...... 61 Yu; Aiping...... 79 Srivastava; Avanish Kumar...... 20 Vekstein; Grigory...... 5 Yu; Haifeng...... 79 Srivatsan; T.S...... 90 Velusamy; R...... 62 Yu; Hanry...... 72 Stack; Margaret...... 79 Velusamy; Ramiah...... 62 Yufeng; Zheng...... 72 Starkschall; George...... 47 Venkatesh; T. S...... 95 Yupapin; Preecha...... 81, 83 Starostina; Irina A...... 109 Verhaegen; Frank...... 48 Z Stefanakos; E.K. (Lee)...... 64 Victor; Jonathan D...... 14 Stefanakos; Elias K...... 73 Vivien; Laurent...... 31 Zachariah; Ajesh K...... 100 126 Steinfeld; Aldo...... 64 Vizirianakis; Ioannis S...... 52 Zaikov; Gennady E...... 8, 86, 88, 89, 92, 93, 101, Stephan; A. Manuel...... 97 Vo-Dinh; Tuan...... 9 ...... 104, 105, 106, 107, 108, 109, 114, 115 Stewart; James J.P...... 12 Vukobratovich; Daniel...... 37, 38 Zaitsev; Valentin F...... 43 Stoyanov; Oleg V...... 106, 109, 115 Vul’; Alexander...... 18 Zakharov; Vadim P...... 107 Zeng; Haishan...... 46 Strochlic; Allison Y...... 74 W Subramanian; K.R.V...... 82 Zeng; Xuefeng ...... 34 Sudarshan; T.S...... 90 Wahiddin; Mohamed Ridza...... 62 Zexiang; Shen...... 21 Sugioka; Koji...... 40 Walker; Christopher K...... 8 Zhang; Guigen...... 70 Sujecki; Slawomir...... 38 Walker; James S...... 68 Zhang; Hao...... 8 Sun; Qiuju...... 88 Wan; Weishi...... 59 Zhang; Jin...... 13 Surendranathan; A. O...... 96 Wang; Bin...... 102 Zhang; Jiujun...... 79 Sutariya; Vijaykumar B...... 51 Wang; Rong Ping...... 75 Zhang; Lijie Grace...... 103 Suzuki; Haruo...... 12 Wang; Ruikang K...... 27 Zhang; Ming...... 46 Svistunov; Boris V...... 21 Wang; Shang-Yung...... 62 Zhang; Mingjun...... 44 Szwacka; Teresa...... 17 Wang; Xiaobin...... 56 Zhang; Sam...... 72 Szwacki; Nevill Gonzalez...... 17 Wang; Xin...... 93 Zhang; Song...... 30 Zheludev; Nikolay I...... 39 T Wang; Xungai...... 20 Wang; Yongqiang...... 91 Zheng; Jie...... 11 Tabakov; Slavik...... 48 Wang; Zhi Yuan...... 35 Zhou; Ruhong...... 13 Takami; Tsuyoshi...... 19 Wang; Zumin...... 75 Zhou; Xufeng...... 80 Takeyasu; Kunio...... 9 Wax; Adam...... 8 Zhou; Yichun...... 87 Takezoe; Hideo...... 17 Webster; John G...... 51 Zhou; Yufeng...... 13 Tallarida; Ronald J...... 45 Webster; Thomas...... 103 Zhu; John...... 111 Tan; Ching-Seong...... 93 Weimin; Yang...... 115 Zoghi; Manoochehr...... 78 Tan; Henry...... 78 Weiner; Andrew M...... 32 Zweck; Axel...... 21 Tang; Wen Xuan...... 81 Wertejuk; Zbigniew...... 87 Zwijnenburg; Martijn...... 18 Taylor; Mark P...... 96 Wiklund, P.E.; Michael E...... 74 Teixeira; Marie B...... 70 Wilkie; Charles A...... 114

www.crcpress.com • e-mail: [email protected] • 1-800-634-7064 • 1-859-727-5000 • +44 (0) 1235 400 524 e-mail: [email protected] Fax: +18022236824 Tel: +18022236565 Montpelier, VT05602,USA 7 ClarendonAve,Suite2 Cranbury InternationalLLC Ethan E.Atkin(ExcludingBrazil) [email protected] e-mail: Fax: 561-361-6049 Tel: 561-998-2582 300, BocaRaton,FL33487,USA 6000 BrokenSoundParkway,NW,Suite & Francis Taylor Sales Office,BocaRaton,FL Michael Dulisse Mexico Central andSouthAmerica e-mail: [email protected] Fax: 561-361-6049 Tel: 561-998-2538 Susie Carlisle CRC PressTextbookSales [email protected] e-mail: Fax: 800-374-3401 Tel: 800-272-7737ext.6091 Angela Williams Customer Service/SalesOperations e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176191 Jude Sermon UK SalesSupport e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176273 Alfred Lea Corporate andInstitutionalSales e-mail: [email protected] Fax: +44(0)2070176732 Tel: +44(0)2070176132 Nick Perry Head ofUKSales e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176048 Graham Crossley International SalesDirector e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176194 Christoph Chesher Group SalesDirector

Outside theContinentalUSA- Within theContinentalUSA- e-mail: [email protected] Tel: +44(0)2033773656 International SalesSupportCoordinator David Mann Europe Enquiries e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176149 International SalesSupportCoordinator Hannah Dolton Japan andKoreaEnquiries e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176053 (Books) International SalesSupportManager Joanne Blackford International Enquiries e-mail: [email protected] Tel: +44(0)1235400524 Higher EducationSalesManager Tim Page Academic Representatives(UK) e-mail: [email protected] Tel: +44(0)70177365 Lindsey Binks UK SalesSupport Latin AmericanSales e-mail: [email protected] AUSTRALIA Victoria Melbourne Level 2,11QueensRoad Taylor andFrancisBooks Australasia e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176187 Milton ParkSalesOffice Area SalesManager Jasmina Basic Caribbean andTheWestIndies 01415-000 –SãoPauloSP. Rua BelaCintra,967–11and. Tel: (11)3017-6941/97486-8236 [email protected] Renata Zanzini–DeptoComercial Taylor &FrancisGroupBrazil [email protected] e-mail: Fax: 561-361-6049 Tel: 561-998-2582 Michael Dulisse [email protected] e-mail: Fax: 561-361-6049 Tel: 561-361-6010 Evelyn Elias Sales Director;LibraryMarket Milton ParkSalesOffice-Taylor&

6000 BrokenSoundParkway,NW,Suite300,BocaRaton,FL33487,U.S.A. 2 ParkSquare,MiltonPark,Abingdon,Oxon,OX144RN,UK Visit usonlineat In theAmericasSalesOffice-CRC Tel: 561-994-0555 • Fax: 561-361-6018 • [email protected] • 561-361-6018 Fax: • 561-994-0555 Tel: Tel: 800-272-7737 • Fax: 800-374-3401 • [email protected] • 800-374-3401 Fax: • 800-272-7737 Tel:

www.crcpress.com e-mail: [email protected] Adele Parker Foreign Rights [email protected] Tel: 8610–82503061 China Haidian District,Beijing100872,P.R. Zhongguancun St. Room 1108B,CultureSquare,No.59Jia, Taylor &FrancisGroup,BeijingOffice Senior Manager-AcademicPublishing Leo Li China LiaisonOffice e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176114 Coordinator International SeniorSalesSupport Adrian Riddock Enquiries South Asia,MiddleEastandAfrica e-mail: [email protected] Fax: 561-361-6049 Tel: 561-998-2539 Christina M.Taranto Subsidiary RightsSales [email protected] e-mail: Fax: (212)244-1563 Tel: (212)2167899 Sean Concannon Bookstores Website: http://www.ipsme.com e-mail: [email protected] Fax: +97142384005 Tel: +97142384001 Dubai, UAE P.O. Box27533 IPS (MiddleEast)Ltd Zoe Kaviani e-mail: [email protected] Fax: +44(0)2070176748 Tel: +44(0)2070176187 Milton ParkSalesOffice Middle EastandSouthAfrica Area SalesManager– Jasmina Basic Middle EastandSouthAfrica Francis Group(BooksLtd)

Press e-mail (international):[email protected] e-mail (UK):[email protected] Fax: +44(0)1235400525 Tel: +44(0)1235400524 Abingdon, OxonOX144SE 130 ParkDrive,Milton Bookpoint Taylor &Francis Bookpoint: overseas agentortheCustomerServiceDepartmentat Book ordersshouldbeaddressedtotheappropriate Customer Services your areamanagerorCustomerServicesDepartment. have furtherinformationaboutthisservice,pleasecontact selective standingordersystem,orifyouwouldliketo If youwouldliketoreceivebooksonourimprovedpre- Standing Orders e-mail: [email protected] Fax: 561-998-2580 Tel: 561-998-2510 Dennis Weiss Senior VicePresidentofSales [email protected] e-mail: Fax: (212)244-1563 Tel: (212)2167899 Sean Concannon Premium/Custom Sales e-mail: [email protected] Fax: +44(0)1865517999 Tel: +44(0)1865553606 OX2 6TR Oxford Aristotle Lane Aristotle House Tula PublishingLtd Julian Russ South AfricaandBotswana) Sub-Saharan Africa(excluding e-mail: [email protected] Coordinator International SeniorSalesSupport Adrian Riddock Rest ofAfrica

127 Sales Agents Botswana East and Southeast Asia Malaysia and Brunei Spain, Portugal, Italy, and Greece Arthur Oageng For all Taylor & Francis Group imprints Taylor & Francis Publishing Services Philip Veysey Book Promotions/Horizon Books Botswana please order from our Singapore Sales Office Taylor & Francis Asia Pacific Area Sales Manager No. 23-2, Jalan PJS 8/18 Gaborone International Finance Park Singapore Sales Office Príncipe de Vergara 109, Plot 113-114, Unit 33, Kgale Mews 2, Suite 3 Dataran Mentari 28002 Madrid, Spain Taylor & Francis Asia Pacific 46150 Petaling Jaya Gaborone, Botswana 60 MacPherson Road Tel: +34 91 700 0688 Tel: +267 393 1194 Selangor Darul Ehsan Fax: +34 91 141 2304 Block 1 #06-09 Siemens Centre Malaysia Fax: +267 392 4908 Singapore 348615 Mobile: +34 68 777 3678 e-mail: [email protected] Tel: +60 (3) 5630 1361 e-mail: [email protected] Tel: +65 6508 2888 Fax: +60 (3) 5630 1732 South Africa, Namibia, Lesotho and Fax: +65 6742 9356 David Yeong Eastern Europe Swaziland e-mail: [email protected] General Manager Marek Lewinson Sales Agents Tracy Whitaker Hong Kong Mobile: +60 (0)16 331 9923 (Humanities and Social Sciences) Book Promotions/Horizon Books Taylor & Francis Asia Pacific e-mail: [email protected] Bohaterewicza 3/45 PO Box 6836 Suite 153, Somptueux Central Taiwan 03-982 Warsaw, Poland Roggebaai 52-54 Wellington Street Taylor & Francis Asia Pacific Tel/fax: +48 (0) 22 6714819 8012 Central Room 629, 6F, No. 6, Sec. 4, Hsinyi Road Mobile: +48 (0) 602 707 037 South Africa Hong Kong Da-an District e-mail: [email protected] Tel: +27 21 469 8900 Tel: +852 3752 0625 / 3752 0626 Taipei 106 Radek Janousek Fax: +27 21 469 8903 Jeffrey Lim Taiwan (R.O.C.) (Science and Technology) Fax2Email: 0865314387 Books Sales Director Jeffrey Lim Pod Nouzovem 972/21 e-mail: [email protected] Singapore Sales Office Books Sales Director 197 00 Prague, Czech Republic e-mail: [email protected] South Asia Singapore Sales Office Tel: +42 (0) 28 658 49888 Andrew Kwan e-mail: [email protected] Mobile: +42 (0) 602294014 Ryan Cooper Manager Jason Lin e-mail: [email protected] International Sales Manager e-mail: [email protected] Sales Manager Milton Park Sales Office China Tel: +886 (2) 5551 1266 ext. 6291 England and Wales Tel: +44 (0) 20 7017 6113 Taylor & Francis Asia Pacific e-mail: [email protected] Fax: +44 (0) 20 7017 6748 London and Eastern England Room 1108B, Culture Square e-mail: [email protected] Philippines, Vietnam and Indo-China No. 59 Jia, Zhongguancun St. James Whittle India Haidian District Jeffrey Lim Area Representative Books Sales Director Mobile: 07802 536233 Taylor & Francis Books India Pvt Ltd. Beijing 100872 P.R. China Singapore Sales Office e-mail: [email protected] 2nd & 3rd floor | The National Council of e-mail: [email protected] YMCAs of India Tel: +86 10 82502670 West Midlands, Southern England, 1, Jai Singh Road| New Delhi 110001| India Fax: +86 10 82502566 Israel and the Palestinian the South West and South Wales Jeffrey Lim Tel: +91 (11) 43155100 | 23712131|34|35 John Blake Books Sales Director Territories Fax: 91 (11) 23712132 Area Representative Singapore Sales Office Emily Legge e-mail: [email protected] Mobile: 07889 263 857 e-mail: [email protected] International Sales Executive Website: www.taylorandfrancis.com e-mail: [email protected] Cynthia Ji Milton Park Sales Office Pakistan Sales Manager Tel: +44 (0) 20 7017 3783 North and Northwest England, M. Anwer Iqbal e-mail: [email protected] e-mail: [email protected] East Midlands and North Wales Book Bird Shanghai Region Europe Lucy Pink 128 Mian Chambers, 3 Temple Road Area Representative PO Box 518, Lahore, Pakistan Chris Ye Belgium, The Netherlands, France Account Manager Mobile: 07860 633156 Tel: +92 42 636 7275 and Luxembourg e-mail: [email protected] Fax: +92 42 636 1370 Room 2201& 2204 e-mail: [email protected] Hong Kong New World Tower Vera Piena No. 300 Huaihai Road Middle Area Sales Manager (Maternity Cover) North of England, Scotland, Ireland and Northern Ireland Japan Shanghai 200021 Taylor & Francis P.R. China P.O. Box 447 Nick Pepper United Publishers Services Limited Tel: +86 21 23263671 2300 AK Leiden Area Representative 1-32-5 Higashi-shinagawa e-mail: [email protected] The Netherlands Mobile: 07825 748476 Shinagawa-ku, Tokyo 140-0002 Tel. 0031 (0) 715243084 e-mail: [email protected] Tel: +81 (0) 3 5479 7251 Guangdong Region F: 0031 (0) 71 523 4571 Fax: +81 (0) 3 5479 7307 Cherry Wang Mobile: +31 (0)6 194 709 42 Library Supply e-mail: [email protected] Sales Executive e-mail: [email protected] e-mail: [email protected] Nigel Berkeley Editorial Office Nordic Countries Library Supply and London Key Singapore and Indonesia Accounts Manager Eva Nyika Korea Mobile: 07795 968206 Mohamed Feroz Sales Representative Se-Yung Jun e-mail: [email protected] Assistant Sales Manager Taylor & Francis Scandinavia ICK (Information & Culture Korea) Singapore Sales Office Kungsbroplan 3 A, 1st Floor 473-19 Seokyo-dong, Mapo-ku Online Retailers e-mail: [email protected] P.O Box 3255 Seoul, Korea 121-896 SE-103 65 Stockholm, Sweden Rod Abraham Tel: +82 2 3141-4791 Thailand Taylor & Francis Asia Pacific e-Mail [email protected] Assistant UK Sales Manager Fax: +82 2 3141-7733 Mobile: 07860 380 814 e-mail: [email protected] Jeffrey Lim Germany, Austria and Switzerland Fax: 01372 273 744 Books Sales Director e-mail: [email protected] Singapore Sales Office Gabriela Mauch e-mail: [email protected] Area Sales Manager Taylor & Francis Group (Books Ltd) Nonglak Sawaithong Karlshofstr. 22 Account Manager 70599 Stuttgart, Germany Tel : +66 2 639 1333 ext. 3612 Tel: +49 (0)711 7207231 e-mail: [email protected] Fax: +49 (0)711 7220668 Mobile +49 (0)173 9059469 e-mail: [email protected] The following subject catalogs are also available from CRC Press. Visit www.crcpress.com/catalogs or contact your local sales representative for copies.

www.crcpress.com/catalogs Science, Technology, and Medical

4 Agriculture & Life Sciences 4 Environmental Science & Engineering Knowledge for the Next Generation

4 Biomedical Sciences 4 Ergonomics & Human Factors, Industrial Engineering & Manufacturing 4 Business, Management, & Public Administration 4 Food Science & Nutrition

4 Chemistry & Chemical Engineering 4 Forensic Science, Law Enforcement, & Homeland Security 4 Civil & Mechanical Engineering 4 Mathematics & Statistics 4 Computer Science, Information Technology, & Game Development 4 Medicine & Veterinary Medicine

4 Electrical Engineering 4 Physics & Materials Science

Discover More at www.crcpress.com

• Related titles, tables of contents, and new and With more than a century of publishing excellence, forthcoming publications as science evolves, so do we. • Book reviews by industry influencers and thought leaders • Authoritative STM references that cover the latest developments •Our Featured Authors community with detailed author bios, and emerging trends news about their work, and the latest research • Textbooks with ancillary materials that make teaching easier

• Digital content delivery that provides anywhere, anytime access in multiple formats

CRC Press CRC Press Go to www.crcpress.com for detailed information on every book. Taylor & Francis Group Go to www.crcpress.com to find out more. Taylor & Francis Group Premium Science, Technology, and Medical eBook Collections

Ask about Free Trials

✦ More than 12,000 references in over 350 subject areas ✦ Comprehensive, customizable, and cost-effective ✦ Up-to-date information with new titles added monthly

Take a Video Tour at www.CRCnetBASE.com [email protected] 1-888-318-2367 [email protected] 44 (0) 203-377-3680