Vertebrate-Specific Glutaredoxin Is Essential for Brain Development

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Vertebrate-specific glutaredoxin is essential for brain development Lars Bräutigama,b, Lena Dorothee Schüttec, José Rodrigo Godoyc, Timour Prozorovskid, Manuela Gellertc, Giselbert Hauptmannb, Arne Holmgrena, Christopher Horst Lilligc,1, and Carsten Berndta,d,1 aDivision of Biochemistry, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, Scheeles Väg 2, 17177 Stockholm, Sweden; bDepartment of Biosciences and Nutrition, Karolinska Institutet, Novum, 14183 Huddinge, Sweden; cDepartment for Clinical Cytobiology and Cytopathology, Philipps-University, Robert-Koch-Strasse 6, 35037 Marburg, Germany; and dDepartment of Neurology, Medical Faculty, Heinrich-Heine University, Merowinger Platz 1A, 40225 Düsseldorf, Germany Edited by Pasko Rakic, Yale University, New Haven, CT, and approved October 13, 2011 (received for review June 22, 2011) Cellular functions and survival are dependent on a tightly controlled Knockdown of the mitochondrial Grx2 isoform sensitized HeLa redox potential. Currently, an increasing amount of data supports cells toward oxidative stress-induced apoptosis, whereas its over- the concept of local changes in the redox environment and specific expression increased resistance against various apoptotic stimuli redox signaling events controlling cell function. Specific protein thiol (14, 15). Protection against mitochondrial oxidative stress is con- groups are the major targets of redox signaling and regulation. nected to Grx2-mediated redox modifications of specific cysteine Thioredoxins and glutaredoxins catalyze reversible thiol-disulfide residues of mitochondrial complex I (16). exchange reactions and are primary regulators of the protein thiol Although the importance of cellular redox control during redox state. Here, we demonstrate that embryonic brain develop- embryonic development is well-established, no specific thiol re- ment depends on the enzymatic activity of glutaredoxin 2. Zebrafish dox regulation events have been identified so far. Here, we have with silenced expression of glutaredoxin 2 lost virtually all types of discovered an essential role of the vertebrate-specific oxidore- neurons by apoptotic cell death and the ability to develop an axonal ductase Grx2 for brain development. Using the powerful model scaffold. As demonstrated in zebrafish and in a human cellular organism zebrafish (zf), Danio rerio, as well as a human cellular model for neuronal differentiation, glutaredoxin 2 controls axonal model, we discovered that regulation of axonal outgrowth, survi- outgrowth via thiol redox regulation of collapsin response mediator val of neuronal cells, and subsequent formation of a functioning protein 2, a central component of the semaphorin pathway. This neuronal network depends on the enzymatic activity of cytosolic study provides an example of a specific thiol redox regulation essen- Grx2. tial for vertebrate embryonic development. Results The genome of zebrafish is fully sequenced and its latest annota- embryonic development ∣ axonogenesis tion (zv9) contains open reading frames for two dithiol Grxs. Sequence analysis revealed that the protein encoded by the gene he development of any multicellular organism depends on the 436677 (zgc: 92698) is the zebrafish homologue to hGrx2 (17). It Tcomplex interaction of fundamental cellular processes like lacks a mitochondrial target sequence and is most closely related proliferation, differentiation, migration, and apoptosis. Intensive to hGrx2c (Fig. S1A). In contrast to hGrx2, zfGrx2 possesses the research during the last decade has established an essential role common Grx active site motif C-P-Y-C. The two conserved extra of the cellular redox state in all these processes and thereby in structural cysteines are present, which connected zfGrx2 to a embryonic development (1, 2). It has been shown that the redox vertebrate-specific group (Fig. S1B). We determined with the state regulates differentiation of neural progenitors, naturally Grx-specific hydroxyethyl disulfide (HED) assay an enzymatic occurring death of postmitotic neurons during development, and k ¼ 4 23 Æ 1 08 −1 activity of cat . s , which is comparable to mamma- neuronal function via redox regulated transcription factors (3, 4). lian Grx2 (18). Currently, we experience a paradigm shift from the importance ZfGrx2 was expressed in the four cell stage and ubiquitously of a global cellular oxidant/antioxidant balance toward specific distributed in zebrafish embryos throughout development signaling events mediated by reversible redox modifications of (Fig. 1A, Fig. S2). Silencing of the zfGrx2 expression by injection protein thiol groups (5, 6). The oxidoreductases that control the of a specific antisense morpholino (Fig. 1 A and B) induced apop- redox state of these thiol groups are thioredoxins (Trxs) and glu- tosis in the CNS from midsomitogenesis until approximately taredoxins (Grxs). They are members of the thioredoxin family 30 hours post fertilization (hpf) (Fig. 1 C–F). Apoptotic cells were of proteins which are characterized by a common fold of three confined to the eye, the anterior brain, the hindbrain, and the beta sheets and four alpha helices including a cis-proline and a spinal cord in all embryos lacking zfGrx2 (n ¼ 125), whereas C-X-X-C (where C is cysteine and X any other amino acid) active uninjected control embryos showed only few scattered apoptotic site motif (7). Grxs reduce protein disulfides using both cysteinyl cells (n ¼ 76). residues of their active site, whereas the reduction of disulfides Knockdown of zfGrx2 was accompanied by extensive loss of between protein thiols and glutathione depends only on the early differentiated neurons at 24 hpf in 97% (n ¼ 34) of ana- N-terminal cysteinyl residue (6). The genome of most vertebrates lyzed embryos (Fig. 2A). The number and distribution of newborn encodes four Grxs, the dithiol Grxs 1 and 2 and the monothiol neurons did not substantially differ between morpholino injected Grxs 3 and 5, with the latter being a subfamily characterized by a C-X-X-S active site motif (6). Author contributions: L.B., C.H.L., and C.B. designed research; L.B., L.D.S., J.R.G., T.P., and Human Grx2 contains an atypical active site motif (C-S-Y-C, M.G. performed research; G.H. contributed new reagents/analytic tools; L.B., C.H.L., and consensus sequence: C-P-Y-C) and two extra cysteines forming a C.B. analyzed data; and L.B., A.H., C.H.L., and C.B. wrote the paper. – structural disulfide bond (8 10). Alternative splicing and tran- The authors declare no conflict of interest. scription initiation of the human gene GLRX2 gives rise to three This article is a PNAS Direct Submission. different isoforms, the mitochondrial Grx2a and the cytosolic 1To whom correspondence may be addressed. E-mail: [email protected] or horst@ Grx2b and Grx2c (11). It was proposed that under conditions lillig.de. ½2 2 2þ of oxidative stress Grx2a is activated by the loss of its Fe S This article contains supporting information online at www.pnas.org/lookup/suppl/ cluster, which might therefore serve as a redox sensor (12, 13). doi:10.1073/pnas.1110085108/-/DCSupplemental. 20532–20537 ∣ PNAS ∣ December 20, 2011 ∣ vol. 108 ∣ no. 51 www.pnas.org/cgi/doi/10.1073/pnas.1110085108 Downloaded by guest on September 30, 2021 reacted to the stimulus but swam away slowly in an uncoordi- nated, circlewise fashion (Movie S1). The onset of neuronal degradation coincides with the time window of initial axon tract formation. Therefore we visualized the axon scaffold and revealed a severe reduction of tracts in nearly all zfGrx2 knockdown embryos at 24 hpf (94%, n ¼ 49) compared to uninjected controls (n ¼ 21). Both anterior brain commissures as well as the major longitudinal axon tracts were strongly reduced in knockdown embryos and the trigeminal gang- lion was almost undetectable (Fig. 2C). Already the maturation of axon tracts was disturbed as essentially no axons could be detected at 18, 20, and 22 hpf, the time frame when the scaffold developed in wild-type embryos (Fig. 2C). Length and number of branching points of single axons were significantly reduced in embryos lacking zfGrx2 (32.86 Æ 5.50 μm, 0.18 Æ 0.09) com- pared to wild-type embryos (133.76 Æ 7.73 μm, 2.04 Æ 0.29) (mean Æ SEM, n ¼ 25, Fig. 3 A and B). To confirm the effect of cytosolic Grx2 on the outgrowth of neurites in a cellular system, we chose the human cell line SH-SY5Y as a model for neuronal differentiation. Cells were transfected with constructs allowing transient expression of the cytosolic isoform of human Grx2, hGrx2c. Morphology of control cells and hGrx2c overexpressing cells was compared with and Fig. 1. Knockdown of zfGrx2 induced apoptosis in central nervous system. þ Injection of a morpholino blocking zfGrx2 translation reduced the levels without induction of differentiation by RA (Fig. 3C). hGrx2c of the corresponding protein as visualized by whole mount immunohisto- SH-SY5Y cells displayed significantly longer neurites with chemistry (A and B). Loss of zfGrx2 induced apoptosis in the central nervous 42.2 Æ 2.7 μm(37.4 Æ 1.4 μm without RA) compared to those of system as demonstrated by in vivo caspase 3 measurements (C and D) and wild-type cells with 31.1 Æ 1.2 μm(24.0 Æ 0.7 μm without RA). TUNEL staining (E and F). Scale bar, 50 μm. The number of branching points per neurite increased signifi- cantly from 0.46 Æ 0.059 (0.52 Æ 0.08 without RA) in control – A and uninjected embryos at 16 22 hpf (Fig. 2 ), indicating that cells to 1.12 Æ 0.11 (0.95 Æ 0.19 without RA) in hGrx2cþ cells the majority of neurons were lost between 22 and 24 hpf. In fact, (Fig. 3D). neurons were identified as the predominant cell type undergoing We verified that the above described phenotypes in zebrafish apoptosis at 24 hpf following knockdown of Grx2 (Fig. S3). embryos were caused specifically by the loss of zfGrx2 by injection To investigate if specific neuronal subpopulations were af- of zfGrx2 capped mRNA together with the morpholino (Fig.
Recommended publications
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus

    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
  • Dissecting the Transcriptional Phenotype of Ribosomal Protein Deficiency: Implications for Diamond-Blackfan Anemia

    Dissecting the Transcriptional Phenotype of Ribosomal Protein Deficiency: Implications for Diamond-Blackfan Anemia

    Gene 545 (2014) 282–289 Contents lists available at ScienceDirect Gene journal homepage: www.elsevier.com/locate/gene Short Communication Dissecting the transcriptional phenotype of ribosomal protein deficiency: implications for Diamond-Blackfan Anemia Anna Aspesi a, Elisa Pavesi a, Elisa Robotti b, Rossella Crescitelli a,IleniaBoriac, Federica Avondo a, Hélène Moniz d, Lydie Da Costa d, Narla Mohandas e,PaolaRoncagliaf, Ugo Ramenghi g, Antonella Ronchi h, Stefano Gustincich f,SimoneMerlina,EmilioMarengob, Steven R. Ellis i, Antonia Follenzi a, Claudio Santoro a, Irma Dianzani a,⁎ a Department of Health Sciences, University of Eastern Piedmont, Novara, Italy b Department of Sciences and Technological Innovation, University of Eastern Piedmont, Alessandria, Italy c Department of Chemistry, University of Milan, Italy d U1009, AP-HP, Service d'Hématologie Biologique, Hôpital Robert Debré, Université Paris VII-Denis Diderot, Sorbonne Paris Cité, F-75475 Paris, France e New York Blood Center, NY, USA f International School for Advanced Studies (SISSA/ISAS), Trieste, Italy g Department of Pediatric Sciences, University of Torino, Torino, Italy h Department of Biotechnologies and Biosciences, Milano-Bicocca University, Italy i University of Louisville, KY, USA article info abstract Article history: Defects in genes encoding ribosomal proteins cause Diamond Blackfan Anemia (DBA), a red cell aplasia often as- Received 3 December 2013 sociated with physical abnormalities. Other bone marrow failure syndromes have been attributed to defects in Received in revised form 4 April 2014 ribosomal components but the link between erythropoiesis and the ribosome remains to be fully defined. Several Accepted 29 April 2014 lines of evidence suggest that defects in ribosome synthesis lead to “ribosomal stress” with p53 activation and Available online 15 May 2014 either cell cycle arrest or induction of apoptosis.
  • Lapatinib Activates the Kelch-Like ECH- Associated Protein 1-Nuclear Factor Erythroid 2-Related Factor 2 Pathway in Hepg2 Cells

    Lapatinib Activates the Kelch-Like ECH- Associated Protein 1-Nuclear Factor Erythroid 2-Related Factor 2 Pathway in Hepg2 Cells

    Updates in Pharmacology Book Chapter Lapatinib Activates the Kelch-Like ECH- Associated Protein 1-Nuclear Factor Erythroid 2-Related Factor 2 Pathway in HepG2 Cells Noëmi Johanna Roos1,2,3, Diell Aliu1,2, Jamal Bouitbir1,2,3 and Stephan Krähenbühl1,2,3* 1Division of Clinical Pharmacology & Toxicology, University Hospital, Switzerland 2Department of Biomedicine, University of Basel, Switzerland 3Swiss Centre for Applied Human Toxicology (SCAHT), Switzerland *Corresponding Author: Stephan Krähenbühl, Division of Clinical Pharmacology & Toxicology, University Hospital, Basel, Switzerland Published October 26, 2020 This Book Chapter is a republication of an article published by Stephan Krähenbühl, et al. at Frontiers in Pharmacology in June 2020. (Roos NJ, Aliu D, Bouitbir J and Krähenbühl S (2020) Lapatinib Activates the Kelch-Like ECH-Associated Protein 1- Nuclear Factor Erythroid 2-Related Factor 2 Pathway in HepG2 Cells. Front. Pharmacol. 11:944. doi: 10.3389/fphar.2020.00944) How to cite this book chapter: Noëmi Johanna Roos, Diell Aliu, Jamal Bouitbir, Stephan Krähenbühl. Lapatinib Activates the Kelch-Like ECH-Associated Protein 1-Nuclear Factor Erythroid 2-Related Factor 2 Pathway in HepG2 Cells. In: Nosheen Akhtar, editor. Updates in Pharmacology. Hyderabad, India: Vide Leaf. 2020. © The Author(s) 2020. This article is distributed under the terms of the Creative Commons Attribution 4.0 International 1 www.videleaf.com Updates in Pharmacology License(http://creativecommons.org/licenses/by/4.0/), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Data Availability Statement: All datasets for this study are included in the figshare repository: https://doi.org/10.6084/m9.figshare.12034608.v1.
  • WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT

    WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT

    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization I International Bureau (10) International Publication Number (43) International Publication Date WO 2019/079361 Al 25 April 2019 (25.04.2019) W 1P O PCT (51) International Patent Classification: CA, CH, CL, CN, CO, CR, CU, CZ, DE, DJ, DK, DM, DO, C12Q 1/68 (2018.01) A61P 31/18 (2006.01) DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, HN, C12Q 1/70 (2006.01) HR, HU, ID, IL, IN, IR, IS, JO, JP, KE, KG, KH, KN, KP, KR, KW, KZ, LA, LC, LK, LR, LS, LU, LY, MA, MD, ME, (21) International Application Number: MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, NO, NZ, PCT/US2018/056167 OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, RW, SA, (22) International Filing Date: SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, TM, TN, 16 October 2018 (16. 10.2018) TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, ZM, ZW. (25) Filing Language: English (84) Designated States (unless otherwise indicated, for every kind of regional protection available): ARIPO (BW, GH, (26) Publication Language: English GM, KE, LR, LS, MW, MZ, NA, RW, SD, SL, ST, SZ, TZ, (30) Priority Data: UG, ZM, ZW), Eurasian (AM, AZ, BY, KG, KZ, RU, TJ, 62/573,025 16 October 2017 (16. 10.2017) US TM), European (AL, AT, BE, BG, CH, CY, CZ, DE, DK, EE, ES, FI, FR, GB, GR, HR, HU, ΓΕ , IS, IT, LT, LU, LV, (71) Applicant: MASSACHUSETTS INSTITUTE OF MC, MK, MT, NL, NO, PL, PT, RO, RS, SE, SI, SK, SM, TECHNOLOGY [US/US]; 77 Massachusetts Avenue, TR), OAPI (BF, BJ, CF, CG, CI, CM, GA, GN, GQ, GW, Cambridge, Massachusetts 02139 (US).
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD

    Supplementary Table S4. FGA Co-Expressed Gene List in LUAD

    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
  • Role of GSH and Iron-Sulfur Glutaredoxins in Iron Metabolism—Review

    Role of GSH and Iron-Sulfur Glutaredoxins in Iron Metabolism—Review

    molecules Review Role of GSH and Iron-Sulfur Glutaredoxins in Iron Metabolism—Review 1, 1, 1 1 Trnka Daniel y , Hossain Md Faruq y , Jordt Laura Magdalena , Gellert Manuela and Lillig Christopher Horst 2,* 1 Institute for Medical Biochemistry and Molecular Biology, University Medicine, University of Greifswald, 17475 Greifswald, Germany; [email protected] (T.D.); [email protected] (H.M.F.); [email protected] (J.L.M.); [email protected] (G.M.) 2 Christopher Horst Lillig, Institute for Medical Biochemistry and Molecular Biology, University Medicine Greifswald, Ferdinand-Sauerbruch-Straße, 17475 Greifswald, Germany * Correspondence: [email protected]; Tel.: +49-3834-865407; Fax: +49-3834-865402 These authors contributed equally to this work. y Academic Editor: Pál Perjési Received: 29 July 2020; Accepted: 22 August 2020; Published: 25 August 2020 Abstract: Glutathione (GSH) was initially identified and characterized for its redox properties and later for its contributions to detoxification reactions. Over the past decade, however, the essential contributions of glutathione to cellular iron metabolism have come more and more into focus. GSH is indispensable in mitochondrial iron-sulfur (FeS) cluster biosynthesis, primarily by co-ligating FeS clusters as a cofactor of the CGFS-type (class II) glutaredoxins (Grxs). GSH is required for the export of the yet to be defined FeS precursor from the mitochondria to the cytosol. In the cytosol, it is an essential cofactor, again of the multi-domain CGFS-type Grxs, master players in cellular iron and FeS trafficking. In this review, we summarize the recent advances and progress in this field. The most urgent open questions are discussed, such as the role of GSH in the export of FeS precursors from mitochondria, the physiological roles of the CGFS-type Grx interactions with BolA-like proteins and the cluster transfer between Grxs and recipient proteins.
  • Genomic Evidence of Reactive Oxygen Species Elevation in Papillary Thyroid Carcinoma with Hashimoto Thyroiditis

    Genomic Evidence of Reactive Oxygen Species Elevation in Papillary Thyroid Carcinoma with Hashimoto Thyroiditis

    Endocrine Journal 2015, 62 (10), 857-877 Original Genomic evidence of reactive oxygen species elevation in papillary thyroid carcinoma with Hashimoto thyroiditis Jin Wook Yi1), 2), Ji Yeon Park1), Ji-Youn Sung1), 3), Sang Hyuk Kwak1), 4), Jihan Yu1), 5), Ji Hyun Chang1), 6), Jo-Heon Kim1), 7), Sang Yun Ha1), 8), Eun Kyung Paik1), 9), Woo Seung Lee1), Su-Jin Kim2), Kyu Eun Lee2)* and Ju Han Kim1)* 1) Division of Biomedical Informatics, Seoul National University College of Medicine, Seoul, Korea 2) Department of Surgery, Seoul National University Hospital and College of Medicine, Seoul, Korea 3) Department of Pathology, Kyung Hee University Hospital, Kyung Hee University School of Medicine, Seoul, Korea 4) Kwak Clinic, Okcheon-gun, Chungbuk, Korea 5) Department of Internal Medicine, Uijeongbu St. Mary’s Hospital, Uijeongbu, Korea 6) Department of Radiation Oncology, Seoul St. Mary’s Hospital, Seoul, Korea 7) Department of Pathology, Chonnam National University Hospital, Kwang-Ju, Korea 8) Department of Pathology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul, Korea 9) Department of Radiation Oncology, Korea Cancer Center Hospital, Korea Institute of Radiological and Medical Sciences, Seoul, Korea Abstract. Elevated levels of reactive oxygen species (ROS) have been proposed as a risk factor for the development of papillary thyroid carcinoma (PTC) in patients with Hashimoto thyroiditis (HT). However, it has yet to be proven that the total levels of ROS are sufficiently increased to contribute to carcinogenesis. We hypothesized that if the ROS levels were increased in HT, ROS-related genes would also be differently expressed in PTC with HT. To find differentially expressed genes (DEGs) we analyzed data from the Cancer Genomic Atlas, gene expression data from RNA sequencing: 33 from normal thyroid tissue, 232 from PTC without HT, and 60 from PTC with HT.
  • Regulating Enzyme, Glutaredoxin 2 in Porcine Ocular Tissues

    Regulating Enzyme, Glutaredoxin 2 in Porcine Ocular Tissues

    University of Nebraska - Lincoln DigitalCommons@University of Nebraska - Lincoln Dissertations & Theses in Veterinary and Veterinary and Biomedical Sciences, Biomedical Science Department of 8-2012 Expression and Distribution of Thiol- regulating Enzyme, Glutaredoxin 2 in Porcine Ocular Tissues Bijaya Prasad Upadhyaya University of Nebraska-Lincoln, [email protected] Follow this and additional works at: https://digitalcommons.unl.edu/vetscidiss Part of the Veterinary Medicine Commons Upadhyaya, Bijaya Prasad, "Expression and Distribution of Thiol- regulating Enzyme, Glutaredoxin 2 in Porcine Ocular Tissues" (2012). Dissertations & Theses in Veterinary and Biomedical Science. 12. https://digitalcommons.unl.edu/vetscidiss/12 This Article is brought to you for free and open access by the Veterinary and Biomedical Sciences, Department of at DigitalCommons@University of Nebraska - Lincoln. It has been accepted for inclusion in Dissertations & Theses in Veterinary and Biomedical Science by an authorized administrator of DigitalCommons@University of Nebraska - Lincoln. EXPRESSION AND DISTRIBUTION OF THIOL- REGULATING ENZYME, GLUTAREDOXIN 2 IN PORCINE OCULAR TISSUES by Bijaya Prasad Upadhyaya A THESIS Presented to the Faculty of The Graduate College at the University of Nebraska In Partial Fulfillment of Requirements For the Degree of Master of Science Major: Veterinary Science Under the Supervision of Professor Marjorie F. Lou Lincoln, Nebraska August, 2012 EXPRESSION AND DISTRIBUTION OF THIOL- REGULATING ENZYME, GLUTAREDOXIN 2 IN PORCINE OCULAR TISSUES Bijaya Prasad Upadhyaya, M.S. University of Nebraska, 2012 Advisor: Marjorie F. Lou Glutaredoxin 2 (Grx2), a thiol-regulating enzyme of oxidoreductase family and a mitochondrial isozyme of glutaredoxin 1, was discovered 11 years ago in our laboratory. Grx2 is present in the lens where it shows dethiolase, peroxidase, and ascorbate recycling activities.
  • Sputum Proteomics and Airway Cell Transcripts of Current and Ex-Smokers with Severe Asthma in U-BIOPRED

    Sputum Proteomics and Airway Cell Transcripts of Current and Ex-Smokers with Severe Asthma in U-BIOPRED

    Sputum proteomics and airway cell transcripts of current and ex-smokers with severe asthma in U-BIOPRED: an exploratory analysis Kentaro Takahashi 1,2, Stelios Pavlidis3, Francois Ng Kee Kwong 1, Uruj Hoda 1, Christos Rossios1, Kai Sun3, Matthew Loza4, Fred Baribaud4, Pascal Chanez5, Steve J Fowler6, Ildiko Horvath7, Paolo Montuschi8, Florian Singer9, Jacek Musial10, Barbro Dahlen11, Sven-Eric Dahlen11, N. Krug12, Thomas Sandstrom13, Dominic E. Shaw14, Rene Lutter 15, Per Bakke16, Louise J. Fleming1, Peter H. Howarth17, Massimo Caruso18, Ana R Sousa19, Julie Corfield20, Charles Auffray21, Bertrand De Meulder21, Diane Lefaudeux21, Ratko Djukanovic17, Peter J Sterk16, Yike Guo3, Ian M. Adcock1,3, Kian Fan Chung1,3 on behalf of the U-BIOPRED study group# 1National Heart & Lung Institute, Imperial College London, & Biomedical Research Unit, Biomedical Research Unit, Royal Brompton & Harefield NHS Trust, London, United Kingdom; 2Research Centre for Allergy and Clinical Immunology, Asahi General Hospital, Japan; 3Department of Computing & Data Science Institute, Imperial College London, United Kingdom; 4Janssen Research and Development, High Wycombe, Buckinghamshire, United Kingdom; 5 Assistance Publique des Hôpitaux de Marseille - Clinique des bronches, allergies et sommeil, Aix Marseille Université, Marseille, France 6 Centre for Respiratory Medicine and Allergy, Institute of Inflammation and Repair, University of Manchester and University Hospital of South Manchester, Manchester Academic Health Sciences Centre, Manchester, United Kingdom
  • (B6;129.Cg-Gt(ROSA)26Sor Tm20(CAG-Ctgf-GFP)Jsd) Were Crossed with Female Foxd1cre/+ Heterozygote Mice 1, and Experimental Mice Were Selected As Foxd1cre/+; Rs26cig/+

    (B6;129.Cg-Gt(ROSA)26Sor Tm20(CAG-Ctgf-GFP)Jsd) Were Crossed with Female Foxd1cre/+ Heterozygote Mice 1, and Experimental Mice Were Selected As Foxd1cre/+; Rs26cig/+

    Supplemental Information SI Methods Animal studies Heterozygote mice (B6;129.Cg-Gt(ROSA)26Sor tm20(CAG-Ctgf-GFP)Jsd) were crossed with female Foxd1Cre/+ heterozygote mice 1, and experimental mice were selected as Foxd1Cre/+; Rs26CIG/+. In some studies Coll-GFPTg or TCF/Lef:H2B-GFPTg mice or Foxd1Cre/+; Rs26tdTomatoR/+ mice were used as described 2; 3. Left kidneys were subjected to ureteral obstruction using a posterior surgical approach as described 2. In some experiments recombinant mouse DKK1 (0.5mg/kg) or an equal volume of vehicle was administered by daily IP injection. In the in vivo ASO experiment, either specific Lrp6 (TACCTCAATGCGATTT) or scrambled negative control ASO (AACACGTCTATACGC) (30mg/kg) (Exiqon, LNA gapmers) was administered by IP injection on d-1, d1, d4, and d7. In other experiments anti-CTGF domain-IV antibodies (5mg/kg) or control IgG were administered d-1, d1 and d6. All animal experiments were performed under approved IACUC protocols held at the University of Washington and Biogen. Recombinant protein and antibody generation and characterization Human CTGF domain I (sequence Met1 CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFC), domain I+II (sequence Met1CPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCCIFGGT VYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEE) were cloned and expressed in 293 cells, and purified by Chelating SFF(Ni) Column, tested for single band by SEC and PAGE, and tested for absence of contamination. Domain-IV (sequence GKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGVCTDGRCCTPHRTTTLPVEFKCPDGE VMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMY) was purchased from Peprotech. Mouse or human DKK1 was generated from the coding sequence with some modifications and a tag. Secreted protein was harvested from 293 cells, and purified by nickel column, and tested for activity in a supertopflash (STF) assay 4. DKK1 showed EC50 of 0.69nM for WNT3a-induced WNT signaling in STF cells.
  • ROS Overproduction Sensitises Myeloma Cells to Bortezomib-Induced Apoptosis and Alleviates Tumour Microenvironment-Mediated Cell Resistance

    ROS Overproduction Sensitises Myeloma Cells to Bortezomib-Induced Apoptosis and Alleviates Tumour Microenvironment-Mediated Cell Resistance

    cells Article ROS Overproduction Sensitises Myeloma Cells to Bortezomib-Induced Apoptosis and Alleviates Tumour Microenvironment-Mediated Cell Resistance Mélody Caillot 1 , Florence Zylbersztejn 1, Elsa Maitre 1,2 ,Jérôme Bourgeais 3, Olivier Hérault 3,4 and Brigitte Sola 1,* 1 INSERM, UNICAEN, Normandie Université, F-14000 Caen, France; [email protected] (M.C.); [email protected] (F.Z.); [email protected] (E.M.) 2 Laboratoire d’Hématologie, CHU Côte de Nacre, F-14000 Caen, France 3 Service d’Hématologie Biologique, CHRU de Tours, F-37000 Tours, France; [email protected] (J.B.); [email protected] or [email protected] (O.H.) 4 LNox, CNRS, Université de Tours, F-37000 Tours, France * Correspondence: [email protected]; Tel.: +33-2-3156-8210 Received: 15 September 2020; Accepted: 25 October 2020; Published: 26 October 2020 Abstract: Multiple myeloma (MM) is a plasma cell neoplasm that remains incurable due to innate or acquired resistance. Although MM cells produce high intracellular levels of reactive oxygen species (ROS), we hypothesised that they could remain sensitive to ROS unbalance. We tested if the inhibition of ROS, on one hand, or the overproduction of ROS, on the other, could (re)sensitise cells to bortezomib (BTZ). Two drugs were used in a panel of MM cell lines with various responses to BTZ: VAS3947 (VAS), an inhibitor of NADPH oxidase and auranofin (AUR), an inhibitor of thioredoxin reductase (TXNRD1), an antioxidant enzyme overexpressed in MM cells. We used several culture models: in suspension, on a fibronectin layer, in coculture with HS-5 mesenchymal cells, and/or in 3-D culture (or spheroids) to study the response of MM primary cells and cell lines.
  • LETTER Doi:10.1038/Nature18618

    LETTER Doi:10.1038/Nature18618

    LETTER doi:10.1038/nature18618 Mitochondrial and nuclear DNA matching shapes metabolism and healthy ageing Ana Latorre-Pellicer1,2, Raquel Moreno-Loshuertos3, Ana Victoria Lechuga-Vieco1,4, Fátima Sánchez-Cabo1, Carlos Torroja1, Rebeca Acín-Pérez1, Enrique Calvo1, Esther Aix1, Andrés González-Guerra1, Angela Logan5, María Luisa Bernad-Miana6, Eduardo Romanos6, Raquel Cruz2, Sara Cogliati1, Beatriz Sobrino7, Ángel Carracedo2,7,8, Acisclo Pérez-Martos3, Patricio Fernández-Silva3, Jesús Ruíz-Cabello1,4,9, Michael P. Murphy5, Ignacio Flores1, Jesús Vázquez1 & José Antonio Enríquez1,3 Human mitochondrial DNA (mtDNA) shows extensive within- Extended Data Fig. 3a, b); including ovary preservation, with less lipo- population sequence variability1. Many studies suggest that fuscin accumulation at 12 months in BL/6NZB mice (Extended Data mtDNA variants may be associated with ageing or diseases2–4, Fig. 3e, f). Telomeres in one-year-old animals were on average approx- although mechanistic evidence at the molecular level is lacking5,6. imately 11% longer in BL/6C57 mice, whereas in two-year-old animals Mitochondrial replacement has the potential to prevent this was inverted, with BL/6NZB telomeres slightly longer (Fig. 1d). This transmission of disease-causing oocyte mtDNA and to improve is due to a BL/6C57 telomere-length-reduction rate that is double than fertility by ‘rejuvenating’ oocytes of sub-fertile or infertile women. that of BL/6NZB mice (Fig. 1e). Liver necropsy revealed a higher inci- However, extension of this technology requires a comprehensive dence of tumours in BL/6C57 mice at death (Fig. 1f and Extended Data understanding of the physiological relevance of mtDNA sequence Fig.