DOCSLIB.ORG

(12) Ipatent Application Ipublication (10) Pub. No?: US 2011/0252501A1 Abad Etal

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
(12) Ipatent Application Ipublication (10) Pub. No?: US 2011/0252501A1 Abad Etal US 201 10252501A1 (19) United StateS (12) IPatent Application IPublication (10) Pub. No?: US 2011/0252501A1 Abad etal. (43) IPub. Date: Oct. 13, 2011 (54) TRANSGENICPLANTSWITHENHANCED Savidge, Davis, CA (US): IDale L. AC ()N()MIC "I"|A|("I"S Val, Zamora, CA(US):Wei Zheng, Davis, CA (US): Thomas J. Savage, Sacramento, CA (US): (75) Inventors: Mark Abad, Webster Groves, MO) IRajani Monnanda Somaiah, St. (US):Molian Deng, Grover, MO Louis, MO) (US): Sireekanta Suma, (US):Sephen Duff St. Louis, MO Bangalore(IN): Jindong Sum, (US): Mary Hermandes, St. Louis, Urbana, IIL (US): Tymagondlu MO)(US):Karen K. Gabbert, St. Venkatesh, St. Louis, MC)(US): Louis, MC) (US): Julie A. Alvarez, Nanfei Xu, Cary, NC(US): Woodland, CA (US): Kristen A. Mahindra Amuradha, Bangalore IBennett, Davis, CA (US): IPaolo (IN): Alice Clara Augustine, Castiglioni, Davis, CA (US): Jill Karnataka (IN): IFarah Deeba, Deikman, Davis, CA (US): Jason Bangalore(IN): IRamachandra IFenner, Sacramento, CA (US): IDhanalakshmi, Karnataka (IN): IDanyang Ke, Sacramento, CA Savitha Madappa, Bangalore(IN): IBadami S.IPramesh, Karnataka (US): IBarry S. Goldman, St. (IN): M.S.IRajani, Karnataka (IN): Louis, MC) (US): Qungang Qi, G. IRamamoham, Karnataka (IN): Balwin, MO)(US): Thomas G. S. Sangeetha, Karnataka (IN): Ruff Wildwood, MO) (US): Char Shobha, Karnataka (IN): IRebecca L.Thompason-Mize, St. IPadmini Sudarshana, Bangalore Charles, MO)(US):JingruiWu, (IN): K. R. Vidva, Karnataka (IN): Chesterfield, MO) (US): Thomas R. Srikanth Venkatachalayya, Adams, Stonigton, CT (US): Karnataka (IN): Tymagondlu Robert Bensen, Niantic, CT(US): Venkatesh, St. Louis, MC)(US) Jacqueline IE. Heard, Stonington, ASSignee: MI()NSAN"I'() "I" (CHN()?()(Y CT(US): Donald E.Nelson, (73) Stonington, CT(US): Erin Bell, St. ILLC, ST LOUIS, MO (US) Louis,MO)(US): R.Eric Cerny, (21) Appl. No.: 11/893.915 Chesterfield, MO) (US): Jaishiree M. Filed: Aug. 17,2007 Chittoor-Vijayanath, Wildwood, (22) MO)(US): Bradon J. Fabbri, IRelated U.S.Application Data Chesterfield, MO) (US): (60) Provisional application No. 60/838.415. filed on Aug. IBalasulojini Karumamandaa, 17, 2006. Creve Coeur, MO) (US): John R. LeDeaux, Creve Coeur, MO)(US): IPublication Classification Xianfeng Chen, Christianburg, VA (51) (US): Meghan (2006.01) Galligan-Dommarummo. Westerly, (2006.01) RI(US):Deborah J.Hawkins, (2006.01) Davis, CA (US): Garrett J.Lee. (2006.01) Wayne, NJ(US): Obed Patty, (2006.01) Marysvile, CA(US): Rick A. (52) U.S. Cl. ...... 800/275:435/419:800/298:800/3201: Sanders, Davis, CA(US): Beth 800/314:800/3203:800/3202: 435/6.1 ggKSTOENEPPyFIsyssP3KRITRDP3ISR-W 3530 13661 25924 15894 1.6&t) 9 7383 6880 1824 561 xx, 13Ernsul3 s98912scsissycs:PRRigsEXEGRFPssPXpylCH3DIRRAIRSWQMR -------sy, scs1.ss773SHIRRGSDSEGRFPSSPNEXE DERRTPTERSVR ?xccoccococcocoCxxpoxpoxxxxFxxSextégic PSSPsDi?hsxDLtrtx LIRSV R US 201 1/()2525()1 A1 Page2 plantSare Selected forhaving an enhanced traitSelected from IhiSinvention provideStransgenic plant Cells With recombi the group of traits ConSiSting of enhanced Water use efi Imant DNA for expression of proteins that are useful for ciency, enhanced Cold tolerance, increased yield, enhanced imparting enhanced agronomic trait(S) to transgenic Crop Imitrogenuse eficiency, enhanced Seed protein and enhanced plantS. Ihis invention alSo provides transgenic plants and Seed Oil. AlSo diSClOSed aremethods formanufacturing tranS progeny Seed CompriSing the transgenic plant Cells Where the genic Seed and plants With enhanced traitS. Patent Application Publication Oct. 13,2011 Sheet 1 of 6 US 2()11/()2525()I A1 Figure#1 Page1 of2 SEO ID INO : homo1.og SEQ ID NOs 15651 -------- MTsssPTORTHVSIPPEPGGKSLTOEANEPPVPISVSSPCGKRTRDPEDE-V 21.36 FIFVILCKYCSRYCHESIVSCILELINSSGGKSITQEANEPPVPISVSSPCGKRTRDPEDE-V 3530 - ------- MTPASPIOGTHVSDPPEPRGKTITRESNEAALPISDSSACGNRTIDAEDD-V 1.3661 -------------------------- MGPE:SRSTPISASSPASSSSPSGKIRTRIDPEDDEV 25924 - - - - --------------------------- MGSDSINILGGSPSASSPSAKRTRIDPEEE-V 1.5894 - - - - - - ------------------------- MGSDSNILGCSPSASSPSAKRTRIDPEEE-V 16409 - - - - --------------------------- MGFIDSNILGGSPSSSSPS SKRI'RDPEEE-V 7383 ------------------------------- MGFDSNILGGSPSSSSPTAKRTRIDPEEE-V 1.6880) - - - - - ----------------- MVGGGGGGEAAMSPPS- - - - - --- GCGKRGRIDPIEED-V 1824 - - - - ------------------- MAGGSGEGAAMSPPSSSGVGGGGGGGKIRGRIDPEED-V 561 ------------------------ MAGGSGIEAAMSPIPS SS- - - - - - S(KRCRIDPEED-V COn Sern S11S - - - - - - - - - - - - - - - - - - - - - - xxxxxxxxxxxxxxxxxxxxSXSSXXXkRt.1:DOEXX-V 30 328 YILDNIRSOKRYLSEIMACSINGLIVGDSLPVNMILESPARSE---SFLY----- HIRIDIDII?S- YIDNIRSOKRYLSEIMACSLINGLTVGDSLPVNMILESPARSE---SFLY----- HIRDDI?S- YI?DNILRSHIKRYLINEIVACMXNGLIVGIDSLIPANVXESPERSE---SILLY----- HIRIDIDI?S- YLDNLRSOKRYLSEIMACSLNGLTVGDSLPVNMILDSPSRSD---ILLSPNNHIHIRDDLS YTLDNILRSHIKRYI?SEIMASSILINGLTVGDSLPDNILMESPARSESIMFS-------- FRIDDMS YILDNILRSHIKRYI?SEIMASSILINGLTVGDSLPDNILMIDSPARSESIMFS-------- FRIDDMSF' YVIDNILRSHIKRYI?SEIMASSILINGLIVGDSLPDNILMESPARSESAFS-------- I?RIDIDMS YVDNILRSHIKRYI?SEIMASSILINGILTVGDSLPDNILILESPARSESAFS-------- I?RDDIS YVDNILHSHIKRYLSEIMASSILINGILSVGDSLVIDNIMESPARSENT--------- SYFRIDE?? YVDNILHSHIKRYLSEIMASSI?NGL?SVGDSLADNIMESPARSESS- ------- - SCIRIDEII YVIDNILHSHKRYI?SEIMASSILINGI?SVGDSLPDNIMESPARSETA- - - - ----- SCYRIDEII? YxDNLrShKRYLsEImAxslNGLtVGDSLpxNxxeSPaRSexxxxxxx----xxirdDxSix LOVsPMSEDSDEARFCEDPTATASTSSSQPESRPTSPVS-PYRYORPLISTNSPOPSPTI LOYSPMSEDSDEARFCEDPTATASTSSSQPESRPTSPVS-PYRYQRPLTSTNSPOPSPTI ILODSPMTXOsCELIFCIEEPTITASTMSSKPESRPTSPVS-PYRYHRPLTSIDSPOPSLIV LOYSPMSEDSDEARFCEDP-ITSTSSSQQPESRPTSPVS-PYRYHRPLTSTTS------- LOYSPMSEDSDDLRFCETPVHSCSS---QPDSLPSSPVS-PHIRYQRPONALPS------- LOYSPMSEDSDDLRFCETPVHSCSS---QLDSLPSSPVS-PHIRYORPQNASSS------- LOYSPMSEDSDDSRFCETGLHSCSS---HPDSRPGSPVS-PCRYQRSONTFSS------- LOYSPMSEDSDDSRFCETPVHSCILT---NLDSRPSSPVS-PCRYQRQQNSFSS------- SOYSPMSEDSDDYRCYDTOLP-NGSOTDAMVSPSTSPMSSPHIRFOKPOSGLLS------- sOYSPMSEDSDDYRYFDTOINPNGSOGDAMVSPSTSPMSSPHIRFCKPOAGFLP------- SOYSPMSEDSDDVIRCYDTOINPSGNHPDAMISPSTSPMSSPHRHORPQSSILLP------- 1OySPMsedSdixxrficexxxxxxxxxxxxxxSxpxSPVS-PxRyorpxxxxxs------- LHHSHTCPASMISNAATTTTPOSRORG-SDTEGRFPSSPSDICHSGDLRRTALLRSVQMIR LHHSHTCPASMISNAAITTTPOSRORG-SDTEGRFPSSPSIDICHSGDLRRTALLRSVOMR IHHSHIWPASMSSSAIST"I"TPOSRORGXSDTGRGSPSSPSDICIPSGDLGRTALPRAVQMIR -HHLSNSHSCIPASMSTNATTPOSRPRG-SDTEGRFPSSPSDICHSSDLRRTALLRSVOMR -APSSSSNASY---GSTIACPOPRORG-SDSEGRFPSSPSDICHSADLRRAALLRSVQMIR -APSSSSNASH---VSTVTCPOPRORG-SDSEGRFPSSPSDICHSADLRRAALLRSVQMIR -APSTSLNGSHIGFSVSAVTCSQPRORS-SDSDGRFPSSPSDICHSADLRRAALLRSVOMR -APSTSLNTSHGFPVSAVTCSQPRORS-SDSDGRFPSSPSDICHSADLRRAALLRSVQMR - - - - ---- ANPYPLPSCSILSSVVCSNPRRGSENEGRFPSSPNDMCHGGDLRKTALLRSVOMR -------- SSPYPLPSCSILSSVACSHIPRRGSENEGRFPSSPNDMCHGADLRRTALLRSVOMR ------ SNPYPIPSCSILSSVVCSHARRGSDNEGRFPSSPNDMCHVADLRRTALLRSVQMIR -xxxxxxxxxxxxxxxxxxxxcrxirixRxxScixegrfPSSPsDi ChisxDLIrirxTAIL1RSVQMR Patent Application Publicati0m Oct. 13,2011 Sheet 30f6 LACA/SC+d L:CySO-T LJiCY/SO1.d 68O36NOANdJodeupluselc? Patent Application Publication Oct. 13,2011 Sheet 40f6 US 2()11/()2525()I A1 Figure#3 T-AGRtu.nOS -AGRtu.left border CR-AGRtu.aroA-CP4.nat OR-Ec.orV-RK2 TS-At, ShkC-CIP2 pMON92705 CR-Ecrop SEQ DNO: 30330 11375bp OR-Ec.ori-ColE1 P-Ec.aadA-SPC/STR lctraaAsircism: T-Ec.aadA-SPC/STR IEXP-OS.Act1:1:2 B-AGRturightborder Patent Application Publication Oct. 13,2011 Sheet 50f6 US 2()11/()2525()I A1 Figure #4 T-AGRtu.nOS pMON82053 SEQIDNO: 30331 P-At.Act 7 OR-322 OR-Ec.ori-ColEl B-AGRtu.left border OR-Ec.oriV-RK2 lctron Patent Application Publication Oct. 13,2011 Sheet 60f6 US 2()11/()2525()I A1 Figure #5 pMON99053 SEQ DNO:30376 T-AGRitu.nOS B-AGRitu,left border US 201 1/0252501 A1 Oct. 13, 2011 "I"|ANS(NIC IPIANTIS \WITI"H INIHANCII) from a population are required toidentity thOSetransgenic AC ()N()MIC "I AIS eventSthatarecharacterized bythe enhancedagronomictrait. SUMMARY (DF "I"HH INVIENTII(DN CRC)SS RFIFFIRINCF "I"() RFIAIHID) APPI,ICAII(DNS |0007|| This invention provides plant cell nuclei with recombinant IDNA thatimpartSenhanced agronomic traitSin [0001] This application claimsbenefit under 35USCS119 transgenic plants having the Inuclei in their CellS, e.g. (e) of U.S.provisional application Ser No. 60/838.415. filed enhanced Water use eficiency, enhanced Cold tolerance, Aug. 17,2006. herein incorporated by reference. increased yield, enhanced Initrogen use efficiency, enhanced seed proteinorenhanced Seed oil. Such recombinant DNA in Incorporation Of Sequence Listing a plant Cell InucleuS Of this invention iSprovided in as a ConStruct CompriSing a promoter thatis functional in plant |0002| Two copies of the Sequence listing (Copy 1 and cells and thatis operably linked to DNA that encodes a Copy2) anda computerreadableform(CRF) ofthe sequence protein. Such DNA in the constructis Sometimes defined by listing, all On CD-RS, each Containing the text file Inamed protein domains of an encoded protein targeted for produc 38-21(54146)B_seqListing.txt, which is 103.067,648 bytes tion OrSuppreSSion, e.g.a"Piam domain module”(as defined (measured in MS-WINDOWS), were created on Aug. 16. hereinbelow) from the group of Pfamdomain modulesiden 2007and are herein incorporated by reference. tified in Table 9. Alternatively, e?g. Wherea Pfam domain Imoduleismotavailable, Such IDNA in the constructis defined Incorporation Of Computer Program Listing a ConSenSuSamino acid Sequence Ofan encoded protein that is targeted for production e.g. a protein having amino acid |0003|| Two copies ofthe Computer Program Listing(Copy Sequence Withatleast 90%identity to a ConSenSuSaminoacid
Load more

Recommended publications
  • The Capacity of Long-Term in Vitro Proliferation of Acute Myeloid
    The Capacity of Long-Term in Vitro Proliferation of Acute Myeloid Leukemia Cells Supported Only by Exogenous Cytokines Is Associated with a Patient Subset with Adverse Outcome Annette K. Brenner, Elise Aasebø, Maria Hernandez-Valladares, Frode Selheim, Frode Berven, Ida-Sofie Grønningsæter, Sushma Bartaula-Brevik and Øystein Bruserud Supplementary Material S2 of S31 Table S1. Detailed information about the 68 AML patients included in the study. # of blasts Viability Proliferation Cytokine Viable cells Change in ID Gender Age Etiology FAB Cytogenetics Mutations CD34 Colonies (109/L) (%) 48 h (cpm) secretion (106) 5 weeks phenotype 1 M 42 de novo 241 M2 normal Flt3 pos 31.0 3848 low 0.24 7 yes 2 M 82 MF 12.4 M2 t(9;22) wt pos 81.6 74,686 low 1.43 969 yes 3 F 49 CML/relapse 149 M2 complex n.d. pos 26.2 3472 low 0.08 n.d. no 4 M 33 de novo 62.0 M2 normal wt pos 67.5 6206 low 0.08 6.5 no 5 M 71 relapse 91.0 M4 normal NPM1 pos 63.5 21,331 low 0.17 n.d. yes 6 M 83 de novo 109 M1 n.d. wt pos 19.1 8764 low 1.65 693 no 7 F 77 MDS 26.4 M1 normal wt pos 89.4 53,799 high 3.43 2746 no 8 M 46 de novo 26.9 M1 normal NPM1 n.d. n.d. 3472 low 1.56 n.d. no 9 M 68 MF 50.8 M4 normal D835 pos 69.4 1640 low 0.08 n.d.
    [Show full text]
  • Supplementary Table S4. FGA Co-Expressed Gene List in LUAD
    Supplementary Table S4. FGA co-expressed gene list in LUAD tumors Symbol R Locus Description FGG 0.919 4q28 fibrinogen gamma chain FGL1 0.635 8p22 fibrinogen-like 1 SLC7A2 0.536 8p22 solute carrier family 7 (cationic amino acid transporter, y+ system), member 2 DUSP4 0.521 8p12-p11 dual specificity phosphatase 4 HAL 0.51 12q22-q24.1histidine ammonia-lyase PDE4D 0.499 5q12 phosphodiesterase 4D, cAMP-specific FURIN 0.497 15q26.1 furin (paired basic amino acid cleaving enzyme) CPS1 0.49 2q35 carbamoyl-phosphate synthase 1, mitochondrial TESC 0.478 12q24.22 tescalcin INHA 0.465 2q35 inhibin, alpha S100P 0.461 4p16 S100 calcium binding protein P VPS37A 0.447 8p22 vacuolar protein sorting 37 homolog A (S. cerevisiae) SLC16A14 0.447 2q36.3 solute carrier family 16, member 14 PPARGC1A 0.443 4p15.1 peroxisome proliferator-activated receptor gamma, coactivator 1 alpha SIK1 0.435 21q22.3 salt-inducible kinase 1 IRS2 0.434 13q34 insulin receptor substrate 2 RND1 0.433 12q12 Rho family GTPase 1 HGD 0.433 3q13.33 homogentisate 1,2-dioxygenase PTP4A1 0.432 6q12 protein tyrosine phosphatase type IVA, member 1 C8orf4 0.428 8p11.2 chromosome 8 open reading frame 4 DDC 0.427 7p12.2 dopa decarboxylase (aromatic L-amino acid decarboxylase) TACC2 0.427 10q26 transforming, acidic coiled-coil containing protein 2 MUC13 0.422 3q21.2 mucin 13, cell surface associated C5 0.412 9q33-q34 complement component 5 NR4A2 0.412 2q22-q23 nuclear receptor subfamily 4, group A, member 2 EYS 0.411 6q12 eyes shut homolog (Drosophila) GPX2 0.406 14q24.1 glutathione peroxidase
    [Show full text]
  • CBS Domains Regulate CLC Chloride Channel Gating: Role of the R
    CBS Domains Regulate CLC Chloride Channel Gating: Role of the R-Helix Linker By Sonya Davé Dissertation Submitted to the Faculty of the Graduate School of Vanderbilt University in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in Molecular Physiology and Biophysics December, 2010 Nashville, Tennessee Approved: Dr. Hassane Mchaourab Dr. Jerod Denton Dr. Jens Meiler Dr. Al Beth Dr. Danny Winder - i - I dedicate my thesis to the best parents in the world, Gopali and Suresh Dave’, and my loving friend, Vishwas Sinha. - ii - ACKNOWLEDGEMENTS I am grateful and lucky to have Dr. Kevin Strange as my advisor. He has always been around to guide me and keep my research on track. Kevin has also taught me to communicate science articulately, be it presentations, papers or grants. He has shown me what is important to become an outstanding scientist, both in terms of ideas and performing experiments. His excellent teaching abilities have made me an experienced electrophysiologist. His jokes, friendship and teasing have also made me a better person. Of course, this project could go nowhere without funding Kevin has secured. This work was supported by NIH grants R01 DK51610 to Kevin Strange and R01 GM080403 to Jens Meiler. I am also grateful to American Heart Association’s Predoctoral Training Grant for my stipend. All current and former members of the Strange Laboratory have been very valuable colleagues and enjoyable friends. Our lab manager Rebecca Morrison has always been there with a thorough answer and solution for many questions arising in experiments. Former lab members Dr.
    [Show full text]
  • Mapping Transmembrane Binding Partners for E-Cadherin Ectodomains
    SUPPLEMENTARY INFORMATION TITLE: Mapping transmembrane binding partners for E-cadherin ectodomains. AUTHORS: Omer Shafraz 1, Bin Xie 2, Soichiro Yamada 1, Sanjeevi Sivasankar 1, 2, * AFFILIATION: 1 Department of Biomedical Engineering, 2 Biophysics Graduate Group, University of California, Davis, CA 95616. *CORRESPONDING AUTHOR: Sanjeevi Sivasankar, Tel: (530)-754-0840, Email: [email protected] Figure S1: Western blots a. EC-BioID, WT and Ecad-KO cell lysates stained for Ecad and tubulin. b. HRP-streptavidin staining of biotinylated proteins eluted from streptavidin coated magnetic beads incubated with cell lysates of EC-BioID with (+) and without (-) exogenous biotin. c. C-BioID, WT and Ecad-KO cell lysates stained for Ecad and tubulin. d. HRP-streptavidin staining of biotinylated proteins eluted from streptavidin coated magnetic beads incubated with cell lysates of C-BioID with (+) and without (-) exogenous biotin. (+) Biotin (-) Biotin Sample 1 Sample 2 Sample 3 Sample 4 Sample 1 Sample 2 Sample 3 Sample 4 Percent Percent Percent Percent Percent Percent Percent Percent Gene ID Coverage Coverage Coverage Coverage Coverage Coverage Coverage Coverage CDH1 29.6 31.4 41.1 36.5 10.8 6.7 28.8 29.1 DSG2 26 14.6 45 37 0.8 1.9 1.6 18.7 CXADR 30.2 26.2 32.7 27.1 0.0 0.0 0.0 6.9 EFNB1 24.3 30.6 24 30.3 0.0 0.0 0.0 0.0 ITGA2 16.5 22.2 30.1 33.4 1.1 1.1 5.2 7.2 CDH3 21.8 9.7 20.6 25.3 1.3 1.3 0.0 0.0 ITGB1 11.8 16.7 23.9 20.3 0.0 2.9 8.5 5.8 DSC3 9.7 7.5 11.5 13.3 0.0 0.0 2.6 0.0 EPHA2 23.2 31.6 31.6 30.5 0.8 0.0 0.0 5.7 ITGB4 21.8 27.8 33.1 30.7 0.0 1.2 3.9 4.4 ITGB3 23.5 22.2 26.8 24.7 0.0 0.0 5.2 9.1 CDH6 22.8 18.1 28.6 24.3 0.0 0.0 0.0 9.1 CDH17 8.8 12.4 20.7 18.4 0.0 0.0 0.0 0.0 ITGB6 12.7 10.4 14 17.1 0.0 0.0 0.0 1.7 EPHB4 11.4 8.1 14.2 16.3 0.0 0.0 0.0 0.0 ITGB8 5 10 15 17.6 0.0 0.0 0.0 0.0 ITGB5 6.2 9.5 15.2 13.8 0.0 0.0 0.0 0.0 EPHB2 8.5 4.8 9.8 12.1 0.0 0.0 0.0 0.0 CDH24 5.9 7.2 8.3 9 0.0 0.0 0.0 0.0 Table S1: EC-BioID transmembrane protein hits.
    [Show full text]
  • The Analysis of Myotonia Congenita Mutations Discloses Functional Clusters of Amino Acids Within the CBS2 Domain and the C-Terminal Peptide of the Clc-1 Channel
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by AIR Universita degli studi di Milano The analysis of myotonia congenita mutations discloses functional clusters of amino acids within the CBS2 domain and the C-terminal peptide of the ClC-1 channel Concetta Altamura1 Sabrina Lucchiari2,3 Dalila Sahbani1 Gianna Ulzi2,3 Giacomo P.Comi2,3 Paola D'Ambrosio4 Roberta Petillo4 Luisa Politano4 Liliana Vercelli5 Tiziana Mongini5 Maria Teresa Dotti6 Rosanna Cardani7 Giovanni Meola8 Mauro Lo Monaco9,10 Emma Matthews11 MichaelG.Hanna11 Maria Rosaria Carratù12 Diana Conte1 Paola Imbrici1 Jean-François Desaphy12 1Department of Pharmacy-Drug Sciences, University of Bari Aldo Moro, Bari, Italy 2Dino Ferrari Centre, Neuroscience Section, Department of Pathophysiology and Transplantation (DEPT), University of Milan, Milan, Italy 3Neurology Unit, IRCCS Fondazione Ca’ Grande Ospedale Maggiore Policlinico, Milan, Italy 4Cardiomyology and Medical Genetics, Department of Experimental Medicine, University of Campania, Naples, Italy 5Neuromuscular Unit, Department of Neurosciences, Hospital Città della Salute e della Scienza of Torino, University of Torino, Turin, Italy 6Unit of Neurology and Neurometabolic Disorders, Department of Medicine, Surgery and Neurosciences, University of Siena, Siena, Italy 7Laboratory of Muscle Histopathology and Molecular Biology, IRCCS Policlinico San Donato, Milan, Italy 8Department of Biomedical Sciences for Health, University of Milan, IRCCS Policlinico San Donato, Milan, Italy 9Institute
    [Show full text]
  • Published Version
    Biochimica et Biophysica Acta 1859 (2017) 1859–1871 Contents lists available at ScienceDirect Biochimica et Biophysica Acta journal homepage: www.elsevier.com/locate/bbamem Crystallographic and biochemical characterization of the dimeric architecture of site-2 protease Magdalena Schacherl a,⁎,1, Monika Gompert a, Els Pardon b,c, Tobias Lamkemeyer d,2, Jan Steyaert b,c, Ulrich Baumann a a Institute of Biochemistry, University of Cologne, Otto-Fischer-Str. 14, 50674 Cologne, Germany b Structural Biology Brussels, Vrije Universiteit Brussel (VUB), 1050 Brussels, Belgium c Structural Biology Research Center, VIB, 1050 Brussels, Belgium d Cluster of Excellence in Cellular Stress Responses in Aging-associated Diseases (CECAD), University of Cologne, Cologne, Germany article info abstract Article history: Regulated intramembrane proteolysis by members of the site-2 protease family (S2P) is an essential signal trans- Received 22 June 2016 duction mechanism conserved from bacteria to humans. There is some evidence that extra-membranous Received in revised form 8 May 2017 domains, like PDZ and CBS domains, regulate the proteolytic activity of S2Ps and that some members act as di- Accepted 10 May 2017 mers. Here we report the crystal structure of the regulatory CBS domain pair of S2P from Archaeoglobus fulgidus, Available online 11 May 2017 AfS2P, in the apo and nucleotide-bound form in complex with a specific nanobody from llama. Cross-linking and SEC-MALS analyses show for the first time the dimeric architecture of AfS2P both in the membrane and in Keywords: fi Site-2 protease detergent micelles. The CBS domain pair dimer (CBS module) displays an unusual head-to-tail con guration CBS domain and nucleotide binding triggers no major conformational changes in the magnesium-free state.
    [Show full text]
  • Deep Evolutionary History of the Phox and Bem1 (PB1) Domain
    bioRxiv preprint doi: https://doi.org/10.1101/2020.01.13.903906; this version posted January 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 Deep Evolutionary History of the Phox and Bem1 (PB1) Domain 2 Across Eukaryotes 3 4 Sumanth Kumar Mutte1 and Dolf Weijers1, * 5 1Laboratory of Biochemistry, Wageningen University, Stippeneng 4, 6708WE, Wageningen, 6 the Netherlands 7 8 Sumanth Kumar Mutte: [email protected] 9 * Corresponding author (Dolf Weijers): [email protected] 10 11 12 13 14 15 16 17 18 19 20 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.01.13.903906; this version posted January 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 21 ABSTRACT 22 Protein oligomerization is a fundamental process to build complex functional modules. 23 Domains that facilitate the oligomerization process are diverse and widespread in nature 24 across all kingdoms of life. One such domain is the Phox and Bem1 (PB1) domain, which is 25 functionally (relatively) well understood in the animal kingdom. However, beyond animals, 26 neither the origin nor the evolutionary patterns of PB1-containing proteins are understood. 27 While PB1 domain proteins have been found in other kingdoms, including plants, it is unclear 28 how these relate to animal PB1 proteins.
    [Show full text]
  • Cryo-EM Structure of the Lysosomal Chloride-Proton Exchanger CLC-7 in Complex with OSTM1 Marina Schrecker, Julia Korobenko, Richard K Hite*
    RESEARCH ARTICLE Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1 Marina Schrecker, Julia Korobenko, Richard K Hite* Structural Biology Program, Memorial Sloan Kettering Cancer Center, New York, United States Abstract The chloride-proton exchanger CLC-7 plays critical roles in lysosomal homeostasis and bone regeneration and its mutation can lead to osteopetrosis, lysosomal storage disease and neurological disorders. In lysosomes and the ruffled border of osteoclasts, CLC-7 requires a b- subunit, OSTM1, for stability and activity. Here, we present electron cryomicroscopy structures of CLC-7 in occluded states by itself and in complex with OSTM1, determined at resolutions up to 2.8 A˚ . In the complex, the luminal surface of CLC-7 is entirely covered by a dimer of the heavily glycosylated and disulfide-bonded OSTM1, which serves to protect CLC-7 from the degradative environment of the lysosomal lumen. OSTM1 binding does not induce large-scale rearrangements of CLC-7, but does have minor effects on the conformation of the ion-conduction pathway, potentially contributing to its regulatory role. These studies provide insights into the role of OSTM1 and serve as a foundation for understanding the mechanisms of CLC-7 regulation. Introduction CLC-7 is a member of the CLC family of chloride (Cl-) channels and chloride (Cl-)/proton (H+) trans- porters and is expressed in the lysosome and the resorption lacuna of osteoclasts (Graves et al., *For correspondence: [email protected] 2008; Ishida et al., 2013; Kornak et al., 2001; Weinert et al., 2010). In the membranes of these acidic compartments, CLC-7 uses the large pH gradient to catalyze the uptake of two Cl- ions for Competing interests: The each H+ released (Graves et al., 2008; Leisle et al., 2011; Ludwig et al., 2013).
    [Show full text]
  • Suppl Figure 1
    Suppl Table 2. Gene Annotation (October 2011) for the selected genes used in the study. Locus Identifier Gene Model Description AT5G51780 basic helix-loop-helix (bHLH) DNA-binding superfamily protein; FUNCTIONS IN: DNA binding, sequence-specific DNA binding transcription factor activity; INVOLVED IN: regulation of transcription; LOCATED IN: nucleus; CONTAINS InterPro DOMAIN/s: Helix-loop-helix DNA-binding domain (InterPro:IPR001092), Helix-loop-helix DNA-binding (InterPro:IPR011598); BEST Arabidopsis thaliana protein match is: basic helix-loop-helix (bHLH) D AT3G53400 BEST Arabidopsis thaliana protein match is: conserved peptide upstream open reading frame 47 (TAIR:AT5G03190.1); Has 285 Blast hits to 285 proteins in 23 species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 279; Viruses - 0; Other Eukaryotes - 5 (source: NCBI BLink). AT1G44760 Adenine nucleotide alpha hydrolases-like superfamily protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to stress; EXPRESSED IN: 22 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: UspA (InterPro:IPR006016), Rossmann-like alpha/beta/alpha sandwich fold (InterPro:IPR014729); BEST Arabidopsis thaliana protein match is: Adenine nucleotide alpha hydrolases-li AT4G19950 unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G44860.1); Has 338 Blast hits to 330 proteins in 72 species: Archae - 2; Bacteria - 94; Metazoa - 7; Fungi - 0; Plants - 232; Viruses - 0; Other Eukaryotes - 3 (source: NCBI BLink). AT3G14280
    [Show full text]
  • Deep Evolutionary History of the Phox and Bem1 (PB1) Domain Across Eukaryotes Sumanth Kumar Mutte & Dolf Weijers*
    www.nature.com/scientificreports OPEN Deep Evolutionary History of the Phox and Bem1 (PB1) Domain Across Eukaryotes Sumanth Kumar Mutte & Dolf Weijers* Protein oligomerization is a fundamental process to build complex functional modules. Domains that facilitate the oligomerization process are diverse and widespread in nature across all kingdoms of life. One such domain is the Phox and Bem1 (PB1) domain, which is functionally well-studied in the animal kingdom. However, beyond animals, neither the origin nor the evolutionary patterns of PB1-containing proteins are understood. While PB1 domain proteins have been found in other kingdoms including plants, it is unclear how these relate to animal PB1 proteins. To address this question, we utilized large transcriptome datasets along with the proteomes of a broad range of species. We discovered eight PB1 domain-containing protein families in plants, along with four each in Protozoa and Fungi and three families in Chromista. Studying the deep evolutionary history of PB1 domains throughout eukaryotes revealed the presence of at least two, but likely three, ancestral PB1 copies in the Last Eukaryotic Common Ancestor (LECA). These three ancestral copies gave rise to multiple orthologues later in evolution. Analyzing the sequence and secondary structure properties of plant PB1 domains from all the eight families showed their common ubiquitin β-grasp fold, despite poor sequence identity. Tertiary structural models of these plant PB1 families, combined with Random Forest based classifcation, indicated family-specifc diferences attributed to the length of PB1 domain and the proportion of β-sheets. Thus, this study not only identifes novel PB1 families, but also provides an evolutionary basis to understand their diverse functional interactions.
    [Show full text]
  • Latest Release of Uniprotkb
    Pfam Documentation Pfam Team May 12, 2021 CONTENTS 1 Contents: 3 2 License 81 3 Citing Pfam 83 4 Get in touch 85 i ii Pfam Documentation Pfam is a large collection of protein families, each represented by multiple sequence aligments and profile hidden Markov models (HMMs). CONTENTS 1 Pfam Documentation 2 CONTENTS CHAPTER ONE CONTENTS: 1.1 Summary Proteins are generally comprised of one or more functional regions, commonly termed domains. The presence of different domains in varying combinations in different proteins gives rise to the diverse repertoire of proteins found in nature. Identifying the domains present in a protein can provide insights into the function of that protein. The Pfam database is a large collection of protein domain families. Each family is represented by multiple sequence alignments and a profile hidden Markov model (HMM). Each Pfam family, sometimes referred to as a Pfam-A entry, consists of a curated seed alignment containing a small set of representative members of the family, profile HMMs built from the seed alignment, and an automatically generated full alignment, which contains all detectable protein sequences belonging to the family, as defined by profile HMM searches of primary sequence databases. Pfam entries are classified in one of six types: Family A collection of related protein regions Domain A structural unit Repeat A short unit which is unstable in isolation but forms a stable structure when multiple copies are present Motifs A short unit found outside globular domains Coiled-Coil Regions that predominantly contain coiled-coil motifs, regions that typically contain alpha-helices that are coiled together in bundles of 2-7.
    [Show full text]
  • Functional and Structural Conservation of CBS Domains from CLC Chloride Channels
    J Physiol 557.2 (2004) pp 363–378 363 Functional and structural conservation of CBS domains from CLC chloride channels Raul´ Estevez´ 1, Michael Pusch2, Carles Ferrer-Costa3, Modesto Orozco3 and Thomas J. Jentsch1 1Zentrum f¨ur Molekulare Neurobiologie Hamburg (ZMNH), Hamburg University, Falkenried 94, D-20246 Hamburg, Germany 2Istituto di Biofisica, Via de Marini 6, I-16149 Genova, Italy 3Departament de Bioqu´ımica i Biolog´ıa Molecular, Facultat de Quimica, Universitat de Barcelona, Marti i Franques 1, Barcelona 08028, and Institut de Recerca Biom´edica, Parc Cient´ıfic de Barcelona, Josep Samitier 1–5, Barcelona 08028, Spain All eukaryotic CLC Cl− channel subunits possess a long cytoplasmic carboxy-terminus that contains two so-called CBS (cystathionine β-synthase) domains. These domains are found in various unrelated proteins from all phylae. The crystal structure of the CBS domains of inosine monophosphate dehydrogenase (IMPDH) is known, but it is not known whether this structure is conserved in CLC channels. Working primarily with ClC-1, we used deletion scanning mutagenesis, coimmunoprecipitation and electrophysiology to demonstrate that its CBS domains interact. The replacement of CBS domains of ClC-1 with the corresponding CBS domains from other CLC channels and even human IMPDH yielded functional channels, indicating a high degree of structural conservation. Based on a homology model of the pair of CBS domains of CLC channels, we identified some residues that, when mutated, affected the common gate which acts on both pores of the dimeric channel. Thus, we propose that the structure of CBS domains from CLC channels is highly conserved and that they play a functional role in the common gate.
    [Show full text]