Whitewood Inn Restaurant, Bar & Grill Open - In Town Deleivery Available j33199;!8ধ2+!;¤Wj,32'f¤ff¤
$150 PER COPY (GST included) www.heraldsun.ca
Publications Mail Agreement No. 40006725
-YPKH`:LW[LTILY Serving Whitewood, Grenfell, Broadview and surrounding areas • Publishing since 1893 =VS 0ZZ\L Whitewood Grand plans for new Highway 1 business New Can Am owners to construct new gas station; add new food franchises By Elaine Ashfield employing the same stated that the person Grasslands News staff,” Ken Patel stated. had been there more than Hours are presently 5 10 days previously and a.m. to 12 p.m. with 24 that they are continually Can Am Travel Stops hour service discontin- disinfecting and taking at Whitewood has new ued during the pandemic. the extra precautions owners and within a few This will change as con- as set out by the health months, construction will ditions improve with the department so they feel begin on the new largest pandemic situation, the their business is as safe travel centre in western owners commented. as necessary for stopping Canada. any contamination. Ken and Daxa Patel “We are reaching the and their son Jay took end of the precautionary over ownership of Can days since the person Am, the present Petro was here and none of the Canada gas station, “The new expansive staff have been affected restaurant and conve- building will have a restu- so I’m quite confident for nience store, on Septem- arant, a large convenience people to continue to use ber 1. our services,” explained In an interview with store, showerss and an all Ken Patel. Grasslands News, the paved parking lot with 50 “We do have custom- friendly new owners spots for truckers.” ers that are concerned though,” Jay Patel added. shared their future plans - New owner, Jay Patel that are guaranteed to be Some customers prefer to “A great addition to the purchase items from the community as well as the In regards to the re- convenience store and travelling public,” says cent announcement from leave rather than stop- Jay Patel. Saskatchewan Health ping and utilizing the “The operations will that a person who may restaurant services. stay the same at present be infected with COVID- Not the most welcom- with the same hours, 19 had been in their es- ing news to receive at the Ride hard. Fall hard. CHRIS ASHFIELD | GRASSLANDS NEWS same menu and we are tablishment, the Patel’s start of a new business but the owners agree that Connor Bear lands hard after being bucked off during the junior bareback safety for everyone is im- event at the High School Rodeo that was held in Whitewood on Sept. 12 portant and the concerns and 13. See more on page 12. will pass. In the mean- time, they will continue to concentrate on the matters to begin their and an all paved park- ness. The pandemic has once again open for peo- new construction. ing lot with 50 spots for increased travel within ple, other than for nec- The exciting and new truckers.” the country for tourism essary crossings that are developments will begin Once completed, which and it is hoped that peo- being enforced at present. in March of next year the owners are hoping ple will continue in the The Patels reside in when the construction of will happen by Septem- future to make their plans Whitewood and also have a new truck stop plus a ber or October of next to include cross country two more sons. They Subway and Dairy Queen year, they will employ 60 travel within Canada as moved from Strasbourgh will be constructed on to 70 people and will op- well as an increase in the where one of their sons the northern edge of the erate 24 hours a day. transportation of goods currently continues to property they own that “People are going to that companies and gov- operate the Tempo Gas will face and will be ad- see more competitive ernments now see as station there and there jacent to the number one pricing, especially with needing to be developed is also one son who op- highway. fuel and we will be of- and produced within the erates the Barbistro in The present 84-seat fering full service,” Ken country. Moose Jaw, SK. restaurant and building Patel stated. The junction of high- There is nothing in the was constructed in 1987 Jay Patel confirmed way #1 and #9 will also plans but down the road, when the Gulf sign was with Grasslands News undoubtedly see an in- the Patels also mentioned removed and changed to that the location of their crease in travellers as that it would be nice to the present Petro Canada new investment will be well once the closure to see a motel developed as signage. beneficial for the busi- the United States are well. Jay Patel expanded on the sketched plans for the new facilities that he had available but were not INSIDE ready to release as they Fall Harvest are still in the working THIS ELAINE ASHFIELD | GRASSLANDS NEWS stages. New owners “The new expansive Ken and Daxa Patel and their son Jay are pleased to building will have a AG EDITION ISSUE be in Whitewood as the new owners at Can Am. Ex- restaurant, a large con- tensive plans are also in the works for the business. venience store, showers 2 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Brooks tutors students to help learn, understand
By Emily Jane Fulford for that class, for that year, was between began last week, so I don’t know with Grasslands News the first and last chapter. These days, certainty that COVID has caused a it’s not uncommon for a course to be greater need for tutoring. I do, however, completely void of a textbook, at least at Tutoring; it was something that believe that students need extra support the high school level, therefore making was a much needed commodity prior in this time, whether they are in kinder- homeschooling a difficult undertaking to COVID-19 but after the school year garten or university. The early closure if one does not have access to the full of schools last semester may mean that ended abruptly in March, many became curriculum. some students have fallen behind, and concerned that children would fall be- “I have tutored my peers and class- hind in their studies. Some parents mates in the past. This year, I helped the new proto- and guardians decided to switch to several classmates in physics, calculus, cols in school en- homeschooling all together. and algebra,” said Brooks. “I have also vironments may “For me, schooling is entirely done reading programs with elemen- add another level online, and it is certainly a differ- tary students. I have always enjoyed of concern for ent and difficult experience,” tutoring. It’s always rewarding to see students. Teach- explains University of Sas- concepts finally click in a student’s ers are doing all katchewan (U of S) stu- mind. It’s like watching the light bulb dent, Tapanga Brooks. that they can to finally turn on. I’ve also found that provide as much “My sister is start- it helps me in my own schooling. It ing high school this help as possible year, which can be to their students, an overwhelming but it’s simply time under normal Tutor helping students not possible to circumstances. This Tapanga Brooks has many inter- pretend like this year’s circumstances ests, from the arts to nuclear phys- is a normal se- are exceedingly ab- ics to medicine, but her passion for mester. It’s going normal, and I can learning is something that she has to require some only imagine the always loved to share with others of adaptations.” stress that students all ages. *5$66/$1'61(:6 Tapanga offers and teachers are en- both in-person or during. The ‘block system’ used by the remote tutoring high school greatly with the proper shortens the amount safety precau- of time that students tions. Which type have to internal- of options are ize the information available depends thrown at them. I only hope to be able tions, obtain clarifying information on never hurts to review high school math- on a student’s access to technology ver- to help students be successful this year, things that may have been difficult to ematics, and explaining abstract ideas sus whether they are comfortable meet- and I hope to be able to take some stress understand in the book, or do lab work, to children and teens helps to keep my ing in person. away from them.” the books themselves provided a solid own mind sharp.” “I love school, that’s no secret, but If you went to school back in the Tapanga attended St. Henry’s and school can be a source of immense pre-millenium days, you might remem- grounds for study preparation and guide then Melville Comprehensive School. stress and anxiety, and I really don’t ber carrying around a heavy backpack through the course with practice tests She is now enrolled in the Physics pro- want that for students, especially kids,” filled with textbooks. While class time as well as a set of important terms. You gram at the U of S specializing in Nu- says Brooks. “If I could help one student provided an opportunity to ask ques- would know that everything required clear Science with a double minor in understand one thing that they were Mathematics and Philosophy. She has hopes to one day be accepted into the struggling with, or if I could make one Medicine or Medical Physics program. student more confident in their ability “In my free time, I volunteer and do to succeed, then I will have succeeded.” improve through the university,” says For more information on tutoring, Brooks, “I have yet to do any tutoring Tapanga can be reached via email at: in Melville this year. School only just [email protected]
7,3 VDVNFULPHVWRSSHUVFRP
OFFICE ASSISTANT Rural Municipality of Cana No. 214
7KH50RI&DQD1RLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQ RI SDUWWLPH 2IILFH $VVLVWDQW LQ WKH PXQLFLSDO DGPLQLVWUDWLRQ 20093sf0 RIILFH7KLVLVDSDUWWLPHSRVLWLRQIRUDSSUR[LPDWHO\WKUHHGD\V SHUZHHNVHYHQKRXUVSHUGD\0RQGD\WKURXJK)ULGD\DP WRSP 7KHVXFFHVVIXOFDQGLGDWHPD\KDYHYDULRXVW\SHVRIH[SHUL HQFHLQRIILFHDVVLVWDQWDGPLQLVWUDWLRQDQGSRVVHVVZHOOGHYHO RSHG LQWHUSHUVRQDO FRPPXQLFDWLRQ DQG RUJDQL]DWLRQDO VNLOOV 3OHDVHFRQWDFWWKHPXQLFLSDORIILFHIRUDGHWDLOHGMREGHVFULSWLRQ 3UHIHUHQFHZLOOEHJLYHQWRFDQGLGDWHVZKRSRVVHVVWKHIROORZ LQJ &HUWLILFDWHIURPDEXVLQHVVUHODWHGSURJUDPRUUHODWLYHZRUN H[SHULHQFH 3URILFLHQF\ZLWK0LFURVRIW2IILFHSURJUDPV .QRZOHGJHLQEDVLFDFFRXQWLQJSULQFLSOHVDQGSUDFWLFHV ([FHOOHQWFRPPXQLFDWLRQVNLOOVERWKYHUEDODQGZULWWHQ $ELOLW\WRGHDOHIIHFWLYHO\ZLWKWKHJHQHUDOSXEOLFDQGWRZRUN LQGHSHQGHQWO\ 7KH50RI&DQDRIIHUVFRPSHWLWLYHVDODU\EHQHILWVSDFNDJH DQGSHQVLRQSODQ7KHVXFFHVVIXODSSOLFDQWVWDUWGDWHZLOOEHDV DJUHHGXSRQ $SSOLFDQWV DUH LQYLWHG WR VXEPLW D UHVXPH GHWDLOLQJ TXDO LILFDWLRQ H[SHULHQFH WKUHH UHIHUHQFHV DQG H[SHFWHG ZDJH 'HDGOLQH IRU UHFHLYLQJ DSSOLFDWLRQV LV 7KXUVGD\ 2FWREHU WR WKH IROORZLQJ DGGUHVV HPDLO UPFDQD#VDVNWHOQHW RU ID[ RU PDLO WR 50 RI &DQD 1R 32 %R[ 0HOYLOOH6.6$3 The RM of Cana wishes to thank all applicants, but only those selected for an interview will be contacted. www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 3 Author MaryAnn Ward Faith in God influences writer’s two new books
By Sarah Pacio lives, together in ways we could never co-ordinate our- Grasslands News selves,” she concluded. “I am blessed.” By the time Ward completed the interviews, she had MaryAnn Ward sat on the couch in her living room compiled a document with over 400,000 words. As she reading aloud from one of her new books, Unmasking reviewed the content, she began organizing it accord- Myths. The self-published author recently released two ing to various themes that she observed and eventu- new books and is working on a third one. The series ally separated it into three books. features stories about prayer from individuals all over Ward said her first book describes the relationship the globe. necessary for prayer. “I believe prayer is based on The pages that Ward read during her interview relationship with God, so Unmasking Myths is about with Grasslands News described a woman’s struggle developing that relationship,” she explained. The to accept her father’s sudden death and Ward’s eyes cover art for this volume was provided by photogra- filled with tears as she read the excerpt: “Who could pher Helen Gwilliam from Wolseley. The second book, trust such a wild, reckless, and uncontrollable God? Unlocking Legacy, describes the important role of hu- Yet somehow, she knew. She knew, though she strug- mility and faith in prayer, which Ward said leads to gled to believe, God is and always will be loving, gentle confidence. The final book, Unstoppable, will be pub- and kind.” lished next year and include stories of healing and Ward’s career as an author began unexpectedly, but provision through prayer. Ward is also compiling a now her faith in God directly influences her writing. 30-day devotional workbook called Undeniable, as a She spent more than 55 years farming near Grenfell, companion to the books. until she and her husband moved to Balgonie. Al- Support and advice from other writers has been in- though she enjoyed reading, English was a struggle valuable for Ward while she worked on these projects. for her in school and as an adult, assisting with farm “It takes a lot of hours to write a book, having people work and raising five sons kept her busy so she had no in your court is important,” she said. “I’ve become a plans to become an author. However, a few years ago turtle on a fencepost – I sure didn’t get there on my she wrote and illustrated a book called Olivia & Me. own!” She initially intended the picture book only for her Inspiring books 6$5$+3$&,2_*5$66/$1'61(:6 Ward’s books can be purchased through Indi- grandchildren, but friends encouraged her to share the Author MaryAnn Ward, originally from Grenfell, go-Chapters or can be requested from the local library. They are also available through the author’s website work with a broader audience. has released two new books, Unmasking Myths After Olivia & Me was published in 2017, Ward felt www.maward.ca and Unlocking Legacy. that God wanted her to write another book, this time focusing on the topic of prayer. Her own shelves al- ready held a large selection of books about prayer so listened to their stories.” LANE REALTY The people interviewed ranged in age from 9 to 90 she was slightly intimidated by the task. Although it For all of your buying or selling needs....Contact: seemed daunting, her efforts were rewarded. years old and Ward said the variety of perspectives The resulting work is based on interviews with 70 makes their experiences relatable for readers. “Every DOUG JENSEN: 306-621-9955 people from countries all over the world, including interview was different, we wept together and we JASON BEUTLER: 306-735-7811 China, Africa, India, Mongolia, and elsewhere. The au- laughed together,” Ward recalled. “Some stories were thor asked them to tell her about their personal expe- triumphant; some were painful and raw. They were rience and share how prayer has shaped their journey genuine.” through life. “These two books are their voices, their Ward said it was remarkable the way that she was brought into contact with each person whose com- WITH OVER 38 YEARS IN THE BUSINESS stories; I felt it an honour and privilege to carry their PH: 306-569-3380 EMAIL: [email protected] stories,” she said. “I was changed, I was humbled as I pelling story she could share. “God weaves threads,
www.lanerealty.com UG:HHN Melville: There’s an App for that
By Emily Jane Fulford and isn’t recyclable, and the program by the end Grasslands News there are 12,000 items of the summer. While the that residents can search app has many features New this year, the for. The app also includes and tools, the Recycle information on local city of Melville released Coach component was 430 Main St. - P.O. Box 1240, Melville, SK S0A 2P0 weather, council meeting its own App, available the driving force behind • Phone (306) 728-6840 • Fax (306) 728-5911 for both Android and iP- minutes, council meeting the software release. :HEVLWH ZZZPHOYLOOHFD hone. The free download agenda packages, service “Recycling is essen- lets residents know about request submissions, tial, and we wanted to all sorts of goings on in local notices, community enable our residents to the city as well as use- events, maps and local make better-informed NOTICE OF CALL ful reminders for things businesses. decisions when it comes Besides special cam- such as garbage collec- to recycling,” said van tion day, etc. However, paigns aimed at helping FOR NOMINATIONS Zyl. “Jeniffer Mann and the app’s crowning glory the public understand I were part of the pro- is all about recycling and particular issues, there cess from the start, and 2020 MUNICIPAL ELECTION how to be informed. is also a “Report a Prob- “The City of Mel- lem” tool which allows we assisted (the team at FORM H (Section 66 of the Act) ville launched its Single Recycle Coach) with the residents to report issues PUBLIC NOTICE is hereby given that nominations of candidates for the Stream Curbside Recy- such as fallen branches, launch and integration of cling program in July. potholes, missed garbage the app.” offi ce(s) of: To raise more aware- collection etc. If you have any ques- 1. Mayor of the City of Melville ness and to encourage The app officially tions regarding the app residents to recycle, we launched on June 8th and or the Recycle Coach partnered with Recycle 2. Councillor for the City of Melville, went live on June 29th tool, please feel free to (Number to be Elected – 6) Coach,” said Yvette van where it began to gain contact Yvette Van Zyl, Zyl, Project Coordinator traction quickly, as over Project Manager at 306- of Public Works & Plan- 450 people downloaded 728-6865. Will be received by the undersigned on the 7th day of October, 2020 ning Services for the City from 9 a.m. to 4 p.m. at the General Offi ce of the Melville City Hall, 430 Main of Melville. “They are a Toronto based company St. and during regular business hours from 9 a.m. to 4 p.m. commencing that assists over 3000 cit- NOTICE OF CALL Thursday, September 10, 2020 to Wednesday, October 7, 2020 ies and towns to improve FOR NOMINATIONS Nomination forms may be obtained at the following location: General daily recycling practices Form H (Section 66 of the Act) Offi ce of Melville City Hall, 430 Main Street and online at and educate residents on RM of Stanley No. 215 how to recycle correctly. http://melville.ca/p/election2020 Public notice is hereby given that nominations of candi- Dated this 8th day of September, 2020. 6.8 million people use the GDWHVIRUWKHRI¿FH V RI Recycle Coach app.” Reeve Ron McCullough However, the app does Councillor for Division No. 1 Returning Offi cer a lot more than just help Councillor for Division No. 3 when it comes to recy- Councillor for Division No. 5 cling Q&A. The program will be received by the undersigned on the 7th day of Oc- tober, 2020, from 9 a.m. to 4 p.m. local time at 238 Third is user friendly and easy $YHQXH:HVW0HOYLOOH6.DQGGXULQJUHJXODUSRVWHGRI¿FH ELECTION WORKERS NEEDED to navigate, designed to hours on September 17 to October 7, 2020. help people find infor- Nominations forms may be obtained at the municipal of- mation quickly and con- ¿FH 7KLUG$YHQXH:HVW0HOYLOOH6.DQGRQOLQHKWWS The City of Melville is seeking people interested in working the veniently. An automated VWDQOH\FDSHOHFWLRQV 2020 Municipal Election. If you are interested, please call Amber Orr at calendar provides waste Dated this 17th day of September, 2020. Dawn Oehler 306-728-6849 or e-mail [email protected] for more information. collection reminders as 5HWXUQLQJ2I¿FHU well as tips for what is 4 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Firefighters to receive Protective Services Medal
By Chris Ashfield fore moving to Melville, Wenet Grasslands News spent two years with White- wood Fire Department and now has 28-years with Melville Fire Three long time firefighters for a total of 30 years in the fire from Melville and Whitewood service. Still an active member, will be recognized by the Sas- he holds the rank of Captain. katchewan government for This year’s recipients come their years of service when they will be presented with the from 26 rural and urban com- Saskatchewan Protective Ser- munities from across the vices Medal for 2020. province. They will receive Lieutenant Governor of Sas- a circular medal surmounted katchewan Russ Mirasty ear- by St. Edward’s Crown and a lier this week announced 103 certificate signed by the Lieu- recipients of the Saskatchewan tenant Governor, Premier and Protective Services Medal for Provincial Secretary. The 2020. Amongst the recipients medal bears the motto Qui civi- are fire chief Bernard Brûlé of tatem tuentur (who guard the Whitewood and fire captains Bernard Brûlé Allan Callfas Don Wenet citizenry). While public health orders Allan Callfas and Donald Wenet well-deserved honour.” services. a member of Mosaic Esterhazy of Melville. due to COVID-19 will prevent The medal honours per- Bernard Brûlé has been Emergency Response team “In challenging times such the traditional presentation sonnel with at least 25 years with the Whitewood Fire De- since 1984, performing the roles as this, it is more important ceremonies normally held for than ever to recognize the valu- of exemplary service in Sas- partment for nearly 30 years, of firefighter, captain, deputy this medal in Regina and Saska- able work of our protective ser- katchewan in protective ser- having joined in 1991. During chief and eventually chief. toon, each nominating agency vices personnel,” Mirasty said. vices fields, including police, his time with the department, Melville’s Callfas had 27- will receive a medal package “I wish to thank each medal fire, correctional and border he has held various positions years of service and held the po- and certificate for presentation recipient for their outstanding services, the Canadian Armed including firefighter, captain, sition of firefighter for several to their recipient(s) in a phys- service to our province and Forces, as well as mobile crisis deputy chief and on Jan. 1, 2013 years and retired as a captain, ically-distanced internal cere- I congratulate them on this and family violence outreach he became fire chief. He is also a title he held for 15 years. Be- mony. 2020 ABEX Awards recipients include local area chief and businesses A local first nation cellence since 1984. In This year’s awards will the chamber’s 100th anni- accomplishments and teerism and philanthropy. chief and two businesses light of the COVID-19 be taking place virtually versary, the theme of this they should be too,” said The individual must also that services communi- pandemic, the 2020 ABEX on Nov. 14, and the Sas- year’s awards is Roaring Steve McLellan, Saskatch- have taken a lead role in ties throughout the area Awards will be shifting katchewan Chamber of Twenties and viewers at ewan Chamber of Com- developing solutions to are both recipients of the from its traditional cele- Commerce is encourag- home are encouraged to merce CEO. social challenges in Sas- 2020 ABEX Awards. bration of Saskatchewan ing nominees, recipients host 1920’s-themed view- Selected for the Com- katchewan. The ABEX Awards are business success to rec- and the public to host ing parties of their own. munity Leader of the Also winning an award Saskatchewan’s largest ognizing businesses and viewing parties in ac- Saskatchewan is nav- Year Award this year is this year is the Indian and longest-running busi- individuals who have cordance with Saskatch- igating the challenges Chief Cadmus Delorme Head Bakery, who will re- ness awards program, become Saskatchewan’s ewan Health Authority brought about by the of Cowessess First Na- ceive the Service Award, celebrating business ex- everyday heroes. guidelines. In honour of global pandemic and eco- tion. The award honours and Flaman Group of nomic slowdown by work- and recognizes someone Companies, which will ing together, supporting who has made a positive be inducted into the Sas- communities, and look- contribution to our com- katchewan Business Hall ing ahead with optimism. munity through volun- of Fame. The Saskatchewan spirit Borderland www.borderlandcoop.crs of resilience is more ev- ident than ever and the ABEX Awards will be cel- WHITEWOOD ebrating the businesses and individuals who have LEGION &DUHHU2SSRUWXQLW\ exhibited this spirit of re- silience. Borderland Co-op is hiring a Yard Attendant at our Home Centre in Whitewood, SK. In March 2020, the Sas- BRANCH #87 Who we are: katchewan Chamber of IS LOOKING FOR Co-op does business differently. As a co-operative, we believe in working together to Commerce encouraged serve Western Canadians, delivering profi ts back to our communities and investing in the public to nominate sustainable growth. To learn more about who we are and how you can help bring our businesses that supported 6XEPLVVLRQIRUZRUNWREHGRQHRQ brand to life, visit us at www.borderlandcoop.com the community, demon- WKH:KLWHZRRG/HJLRQH[WHULRU What you’ll do: strated resilience, or The yard attendant is responsible for the following duties on a daily basis: have been strategic and FRQVLVWLQJRISDLQWLQJDQGPHWDOZRUN • Assist customers innovative in their ap- • Deliver product proach to serving clients Contact • Clean and maintain the yard and engaging customers. Ray Giroux at 306-735-7165for • Safely operate equipment and tools Over the coming weeks information Why it matters: leading up to November Our team provides a range of products and services to support our member-owners. 14, nominees and their Through the work that we do, we help to build, fuel, feed and grow Western Canadian stories will be featured on communities together. the ABEX Awards social Who you are: media channels and the You are looking for a career in Home & Building Products and: recipients will be hon- • You have a basic understanding and knowledge of various building materials oured during the virtual • You’re familiar with the operation of a forklift awards show. • You’re honest and trustworthy, are results-oriented and strive to be the best in what “Congratulations to you do. this year’s ABEX Awards • You believe in building relationships and collaborating to deliver solutions that recipients. They went matter most, and you recognize the value that different perspectives bring to meet above and beyond when shared objectives our community needed • Have a valid Class 5 drivers licence. them most and I admire the perseverance and in- Our Team Members receive competitive salaries, a comprehensive benefi ts package novation displayed by and an employer-contributed pension plan. We encourage our Team Members to take these Saskatchewan busi- free estimates, 24 hour emergency service advantage of learning opportunities, to grow and develop and to foster a culture of nesses. The chamber is teamwork and innovation. certainly proud of their Danny Currie Journeyman Electrician At Co-op, we embrace diversity and inclusion, and we’re working to create a workplace that is as diverse as the communities we serve. We support and provide an environment [email protected] that allows all to bring their whole selves to work. SUBSCRIBE 306-331-6588 Apply via email or in person or contact us at [email protected] TODAY! or more information. echoelectric.ca Subscribe for as little Apply early as recruitment for this position is ongoing. as $37.80 a year! locally owned and operated serving fort qu’appelle and surrounding area We thank all candidates for their interest; however, only those selected Call toll free call or email today! to continue in the recruitment process will be contacted. 1-844-GNG-NEWS www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 5 Protecting gardens from frost extends growing By Emily Jane Fulford With the final frost of spring happening near to the online at weather.gc.ca and the site is frequently up- Grasslands News end of May and the first of winter occurring in the first dated. If frost is imminent, bring potted plants indoors two weeks of September, it was a bad year for the back- for the night. For plants grown in the ground, roots yard vegetable garden. It also gives credence to why can sometimes be protected by adding a layer of mulch Home based agricultural enthusiasts across the re- supermarket shelves are not packed with Saskatche- around them on the garden bed. gion got a rude shock shortly after labor day when a wan grown cauliflower, chili peppers and cucumber. Always make sure to water in the afternoon rather late night frost left nearly all plant life, with the excep- Even pumpkins, which are intended to be picked than close to the evening hours prior to a cold night. If tion of seemingly indestructible grass and weeds, dead off the vine in late October, died promptly as the 2020 you do not have access to a Cloche to cover up plants as a doornail. school year started. As a result, grocery stores could through the night, you can always try to make do see a shortage of locally produced pumpkins this fall. with clear plastic garbage bags. A clear plastic paint- Although it is possible for plants to come back after ers drop sheet can also work well, just make sure to being impacted by a frost, in cases where the roots firmly secure the sides or the plastic will likely blow or crowns have been damaged, the outlook is bleak. away. Trees can also be wrapped either in plastic and In these situations, sometimes produce such as green evergreen shrubs can be wrapped in burlap and tied tomatoes can be salvaged and ripened indoors in paper with string. bags, but anything which has not grown close to matu- Lastly, portable greenhouses are available at many rity doesn’t stand a chance. building supply, hardware and agro centre stores and If you don’t have access to a greenhouse, living off often will not require a permit to assemble. However, the land may be difficult, especially if the weather if you’re on a budget, hot houses for smaller plants continues to be this unpredictable. However, there are such as tomatoes can be made easily and cheaply using some tips and tricks so that even the hobby gardeners old window panes and picture frames. A greenhouse, out there can avoid losing any more investment than whether store bought or home made, will serve the absolutely necessary. dual purpose of extending the growing season and First, check the weather forecast, this can be found keeping the rabbits away.
September frost (0,/<-$1()8/)25'_*5$66/$1'61(:6 RM of Willowdale No. 153 Gardening enthusiasts awoke to a nasty shock after PUBLIC NOTICE Labor Day after unseasonably overnight cold tempera- Notice of Call for Nominations Rural Municipality of Lipton No. 217 tures reaped havoc on local horticulture. Regular Election (Term of Offi ce - Four Years) Notice of Discretionary PUBLIC NOTICE is hereby given that Use Application nominations of candidates for the offi ce(s) of: NOTICE OF CALL Pursuant to Section 55 of the Planning and Reeve: RM of Willowdale Development Act 2007, the Council of the RM of Lipton No. 217 gives notice that discretionary use FOR NOMINATIONS Councillor: Division No. 1 applications have been received and the details are RM of Cupar No. 218 Councillor: Division No. 3 as follows: Form H (Section 66 of the Act) Councillor: Division No. 5 Discretionary Use Permit: Gravel Operation- NE and SE ¼s 23-24-13 W2M Public notice is hereby given that nominations of can- will be received by the undersigned during regular GLGDWHVIRUWKHRI¿FH V RI Gravel Operation: The applicant is making an Reeve business hours September, 22 to October 6, 2020, application to operate a gravel pit and crushing Councillor for Division No. 1 and from 8:30 a.m. to 4:00 p.m. on the October 7, operation on the NE and SE ¼s 23-24-13 W2M. Councillor for Division No. 3 Public Hearing: Council will discuss the above Councillor for Division No. 5 2020 at the RM of Willowdale Offi ce. noted Discretionary Use Permit at 9 a.m., Tuesday, ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHGDWWKHPXQLFLSDORI¿FH October 6, 2020, in the Lipton Seniors Center, GXULQJQRUPDORI¿FHKRXUVXQWLO:HGQHVGD\2FWREHU Nomination forms may be obtained at the RM of Main Street, Lipton Saskatchewan. For further 2020 at 4 p.m. local time. Willowdale Offi ce. information please call Frank Kosa, Administrator $QGRQ1RPLQDWLRQ'D\:HGQHVGD\2FWREHU at 306-336-2244. from 9 a.m to 4 p.m. Dated this 10th day of September, 2020. Dated at the Village of Lipton, in the Province of Nomination forms may be obtained from the municipal Saskatchewan, this 14th day of September, 2020. RI¿FHORFDWHGDW/DQGVGRZQH6WUHHWLQ&XSDU6. Andrea Smyth, Frank Kosa, Dated this 9th day of September, 2020 Returning Offi cer 1LNNL&]HPHUHV5HWXUQLQJ2I¿FHU Administrator Directory
Fisher & Schmidt Miller Moar Grodecki Kreklewich & Chorney CHARTERED PROFESSIONAL ACCOUNTANTS – www.millerandco.ca Phyllis Armstrong CPA, CGA /DZ2IÀFH MELVILLE OFFICE – 306-728-4525 FORT QU’APPELLE OFFICE – 306-332-6651 128 - 4th Ave. East, Melville, SK 32&!@;3 8-&!@¥V!W1W;3V6W1WTf8&='W W '&2'9&!@V!W1W;3332T316!2@='WW Chartered Professional Accountant !=-&W 83&'$0-TT-2!ħ'2&!2$' 0LFKDHO)LVKHU4& For your٘ ESTERHAZY OFFICE – 306-745-6611 INDIAN HEAD OFFICE – 306-695-2303 8!2&='W Accounting '&2'9&!@V6W1W;3V6W1WT 8-&!@¥V!W1W;3V6W1WT!-2;W +RQV 32&!@;3 DUQHW)LVKHU%$* ٘ //%&ROODERUDWLYH/DZ\HU GRENFELL OFFICE – 306-697-3558 !=-&W 83&'$0-TT-2!ħ'2&!2$' TAXATION Needs 32&!@;3 8-&!@¥V!W1W;3V6W1WT¤'9132&;W BALCARRES OFFICE – 306-334-2923
'$'&2'9&!@V!W1W;3V6W1WT!£$!88'93>2ă -2!ħ'2&!2$' UDQW6FKPLGW//% !88@W-££'8TTT* ٘ Wednesday and Thursday £!-8W !2!'9''£'TTT-2!ħ'2&!2$' Michael Fisher & Garnet Fisher Grant Schmidt 306-735-2284 Summer Hours 306-728-4581 306-728-5481 WHITEWOOD OFFICE – 306-735-2385 ITUNA OFFICE – 306-795-3190 ,<89&!@V!W1W;3V6W1WT2&8'>+'2$-'9<-£&-2+ <'9&!@V!W1W;3V6W1WT3( ;<2!ă$' 707 Lalonde St. Tuesday to Friday Melville and Esterhazy Melville !8@W8'0£'>-$,TTT-2!ħ'2&!2$' )9,'8£!>|9!90;'£W2'; 93£!>|9!90;'£W2'; !=-&W,382'@TT-2!ħ'2&!2$' Whitewood, SK 10 a.m. to 4 p.m.
BOCK & COMPANY Balcarres LAW OFFICE DIRECTORY LYNNETTE BOCK, B.A., J.D. Agencies Ltd. Phone 306-332-4666 1-800-563-4608 ADVERTISING 122 Company Ave. S., Fort Qu’Appelle, SK 0DSOH6WUHHW32%R[ Off ering a wide selection of products and expertise $ (VWHUKD]\6.6$; • Personal Insurance • Commercial Insurance For all your Insurance needs! for only 10* / week PHONE: (306) 745-3952 • Specialty Products • Agri-Business Representing: • SGI Canada 0XVWEHSUHSDLGSOXV*67 • Wawanesa • SMI • Wynward Insurance Company 5HJXODUUDWHLVSOXV*67SHU\HDU FAX: (306) 745-6119 216 Main St. Balcarres, SK • Germania Mutual • Aviva • Oasis • Intact (PDLO ERFNODZ#VDVNWHOQHW Phone: 306-334-2401 Fax: 306-334-2705 • HUB Life and Financial Services Grasslands News Group Email: [email protected] • Portage Mutual • Group Medical Services %UDQFK2IÀFH • Red River Mutual and Many More. Rocanvile, Friday Afternoons www.balcarresagencies.saskbrokers.com • Saskatchewan Blue Cross 1-844-464-6397 • SGI Motor License Issuer Phone: (306) 645-4552 ext 230 GARY MOORE LL.B. Buying a newly Barrister, Solicitor, Notary Public Box 610, 616 Main St., PATTY WELCH built home? 306-728-4358 | 148-3rd Ave. E., Melville &RQVXOWDQW Broadview, SK S0G 0K0 306-745-6450 | 513 Main St., Esterhazy Phone: (306) 728-4998 Contact me today. 0RQGD\)ULGD\DIWHUKRXUVE\DSSRLQWPHQW It’s just another part of the H&R Block Advantage. WK$YH(DVW0HOYLOOH EDFNGRRUHQWUDQFH Laura Wittig SUB-OFFICE: Get Whats Yours™ SDWW\ZHOFK#LQYHVWRUVJURXSFRP :KLWHZRRG7KXUVGD\DIWHUQRRQ Click, call or come over. Time... to think about keeping the family dream home, Mobile Mortgage Advisor no matter what )ODWODQG3OXPELQJ%XLOGLQJ hrblock.ca 800-HRBLOCK 306 531-3346 from simple to complex 7UDGLWLRQDOPRUWJDJHOLIHLQVXUDQFHLVGHVLJQHGVSHFLÀFDOO\WRUHWLUHRQO\WKHEDODQFH RZLQJWRWKHPRUWJDJHOHQGHULIVRPHWKLQJKDSSHQVWR\RX,QYHVWRUV*URXSFDQVKRZ 1 866 293-3616 CALL FOR APPOINTMENTS: No matter how complicated your situation is, we can provide you with: \RXKRZDQLQGLYLGXDOSODQWKDWSXWV\RXLQFRQWUROFDQKHOSHQVXUHWKDWLQWKHHYHQW Q tax planning strategies. GHDWKGLVDELOLW\RUFULWLFDOLOOQHVV\RXUIDPLO\FDQVWLOOOLYHLQWKHLUKRPH [email protected] Q audit assistance. /HWXVVKRZ\RXKRZEXLOGLQJLQVXUDQFHLQWR\RXUSODQFDQSUHVHUYHÀQDQFLDOVHFXULW\ 306-696-2454 or 306-696-6704 Q complex return preparation including the areas of: All mortgages are subject to credit approval. Certain conditions Q small business Q rental Q corporate Q trust and estate Q U.S. 7UDGHPDUNVRZQHGE\,*0)LQDQFLDO,QFDQGOLFHQVHGWRLWVVXEVLGLDU\FRUSRUDWLRQV and restrictions apply. The CIBC logo is a trademark of CIBC. 6 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News
“For the cause that needs assistance; for the wrong that needs resistance; the future in the distance and the good that we can do.” There’s lots of worthy nominees out there
The “Municipal Governance 101: Town Hall” free palities to have a town meeting prior to the election formation that may disinform you on matters being online session was held last week. I registered, not where every nominee who will appear of the ballot debated. Everyone is also entitled to be heard. Crit- because I plan to submit my name for the election has to present themselves to the public. People should icism of others has no place at a council table and that is coming soon but because I was sure that the know a few things about the names they are choosing Codes of Ethics are developed for this exact reason. Municipalities of Saskatchewan would put forward from on a ballot. If there is no election required and As the elected officials, you all sit at the same an educational presentation for anyone interested in acclamation decides the winners, the meeting should table for the benefit of the community and never for municipal politics or who is thinking of running for still be held. No question period, just a short intro- yourself. Know your role at a council table and re- council in a town. duction of what each nominee does, their interests spect the opinions of others, even if they vary from Municipal governance is defined in the Saskatch- and what they expect if elected. People can ask their your own opinion. Communication must take place. ewan Municipal Act (that consists of a multitude of questions outside of this meeting. Section 119 of The Municipalities Act states: “An pages). For people wishing to submit their names Possibly having a short question sheet available to act or proceeding of council is not effective unless for nomination, don’t be discouraged by your lack be answered by each person attending this meeting it is authorized or adopted by a resolution at a duly of knowledge as a new official; and on the other side or even placed outside the voting area on Election constituted public meeting of the committee of coun- of the table, if you are a returning elected official, Day would also help to inform those who are suc- cil.” The term ‘act or proceeding’ is deliberately take the time to continue to educate yourselves on cessfully elected. On this question sheet, the citizens broad to ensure public accountability is maintained. a regulation if you are about to act upon something. should list their top 3 priorities, in order of impor- This means no emails, texts or phone calls to council Agenda being presented for each meeting in ad- tance, so that councils can be guided to interests that members to carry out a vote. Your community is all vance will allow time for research and is the first im- their voters want or expect. in this together at one open table. portant step in governance that will lead to informed Once elected, councillors should use the abun- There are a lot of citizens in every community that discussions and decisions. dance of materials for reference to policy and proce- would be worthy of a seat at a council table. Don’t be If you are interested in your town, then you are dures. Even the old experienced ‘guys or gals’ at the discouraged by some things that may have happened just as qualified as the next guy to sit at a council table will learn something as materials are updated. in the past. By submitting your name, you are taking table. It is interesting, educational and can be re- Policy and procedure is at the top of the list for an a step to make changes that could correct past mis- warding. open, accountable, democratic government. takes, or implement new ideas that could lead to a Now getting back to an election year – I wish it Check your facts. Don’t always ‘follow the leader’ more enjoyable and beneficial term of office. would be mandatory for all towns, cities or munici- per say as you may sometimes receive inaccurate in- - Elaine Ashfield, Grasslands News Province united behind Saskatchewan Party
By Murray Mandryk gle, right-wing alternative to Grasslands News the NDP – broke through with three urban seats. But since the Sask. Party The province isn’t quite as win in 2007, it’s grown its divided as we sometimes think, urban base to the point where which is bad news for Ryan it’s far less distinguishable Meili and the NDP. from its rural base. For years, we have thought There were 31 Sask. Party of Saskatchewan to be a prov- seats in 2016 in which its can- ince divided between urban didates won by 2,500 votes or and rural … and not without more. The significance of this good reason. is two-fold: You need 31 seats It just wasn’t that long ago in Saskatchewan’s 61-seat legis- in Saskatchewan that it was lature to form a majority gov- just a given that the four big- ernment and winning a seat gest cities would vote NDP and by 2,500 votes in the previous the smaller cities, towns and election is a pretty solid bench- farms would vote for anyone mark when it comes to holding else. that seat in the next election. It was a trend that started In Saskatchewan’s entire in the late 1970s when the NDP history going back to 1905, was already starting to lose there has been 1,703 MLAs farm votes but still had bed- elected or re-elected in general rock support in Regina, Sas- elections or by-elections. In katoon, Moose Jaw and Prince all that time, there has been a ous election by 2,500 votes. cities. In fact, the Sask. Party eral MP in this province – was Albert. total of six riding elections in In fact, winning any Sas- won a third of the all city seats voted out of office a year ago in That all changed in 1982 which a party that registered a katchewan seat by 2,500 had in the one-time NDP stronghold the federal election. So when when Grant Devine’s Progres- 2,500-vote win the next election. been a rather unusual event that no other party could pene- Premier Scott Moe takes on sive Conservatives not only Interestingly, this rarity in election rates … or at least, trate by more than 1,000 votes. federal Prime Minister Justin swept most of the countryside happened four times in 1982 it was until the arrival of the A thousand votes is a very Trudeau over support for oil but also every seat in the four when Grant Devine’s Progres- Sask. Party and its stronghold tough thing for any candidate and agriculture as he recently major cities except for two in sive Conservatives shocked on rural seats. to overcome. did in advance of the federal Regina’s core. the NDP in the home of North However, it’s not just rural It likely has a lot to do with throne speech (and likely, the That city vote would revert America’s first social dem- seats in which the Sask. Party the fact that all voters in the provincial election) there are back to the NDP in 1986 and re- ocrats by knocking off NDP has established a huge voter province – rural and urban – city people cheering. mained solid NDP for the next heavyweights like Roy Roma- base that makes suddenly los- have benefitted from the pros- But, mostly, it’s a reflection four elections, including 2003 now. ing that seat unlikely. perity that has paralleled the of how rural and city people when the Saskatchewan Party In the 38 years since, no Of those 31 seats in 2016 that Sask. Party years in power. are maybe a bit more similar – former in 1997 via a merger of party has come close to win- the Sask. Party won by 2,500 It’s worth remembering that in their politics right now than PC and Liberal MLAs as a sin- ning a seat it lost in the previ- votes or more, six were in the Ralph Goodale – the last Lib- some assume.
SUBSCRIPTION RATES: All subscription expire Dec. 31. Pick-Up Boxes: Prices shown are based on one full year. $37.80 per year Subsciptions will be pro-rated. Mailed in Saskatchewan: Melville Advance, Whitewood Grenfell Herald Sun, Fort Qu’Appelle Times Chris Ashfi eld Tammy Oryschak Michelle Walz Lloyd Schmidt Pat Gattinger Prices include GST. Publisher Accounts Advertising Production Classifi eds $50.40 per year Issued Fridays by Grasslands News Group from the office Make cheques payable to Grasslands News Group at 218 - 3rd Ave. West, P.O. Box 1420 Melville, SK., S0A 2P0 Send e-transfers to [email protected] Mailed in Canada: Ph: 306-728-5448 • Fax 306-728-4004 • Whitewood: 306-735-2230 $70.00 per year
Toll Free: 1-844-GNG-NEWS Electronic Edition: www.grasslandsnews.ca • [email protected] $37.80 per year
Wendy Krobath Emily Fulford Elaine Ashfi eld Sarah Pacio Alan Hustak © Copyright (c) News and advertising content of this newspaper are protected by copyright. Offi ce Assistant Melville Whitewood Grenfell Fort Qu’Appelle 2020 There may be no reproduction of content without permission of the publisher. www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 7 Better emergency services Kahk begins Community Safety Patrol By Sarah Pacio Grasslands News
In January 2019, Kahkewistahaw’s Chief Evan Tay- potat told Grasslands News that ensuring better emer- gency services was a priority for the upcoming year. The First Nation has taken steps toward achieving that goal by developing its own Community Safety Patrol. The initiative started in July 2019 as a three-month Safety patrol 68%0,77('_*5$66/$1'61(:6 pilot project and had an immediate impact on the Members of the Community Safety Patrol are providing an important and valuable service to the Kah- community. The project was extended and twenty vol- kewistahaw First Nation. Left to right: Bobbi Alexson, Dano Bobb, David Bobb, Tanya Delorme, Christine unteers assisted throughout the past year. In August 2020, the Community Safety Patrol became an official Lerat, and Demitri Bobb. department of Kahkewistahaw First Nation, which tion or dealing with assault. to several individuals who needed a ride home in in- fully funds the program. There are currently four full- The patrol team responds to calls from individu- clement weather and have conducted multiple traffic time and two part-time employees. als in physical distress and provides support during stops. Alexson said their presence has resulted in a Councilor Cory Alexson, who oversees the program, community events such as powwows or other social described the Safety Patrol as a “watchdog” that moni- significant decrease to impaired driving in the area. gatherings. Because they share common geographical tors activities on the reserve. “We’re not there to take Kahkewistahaw band members acknowledge the any matters physically into our hands,” he explained, boundaries with Cowessess and Ochapowace First Na- importance and value of the Safety Patrol. “It’s not “but rather to observe and report; hence the imme- tion, the Kahkewistahaw Safety Patrol also supports driven by any one person or particular group, but com- diate connection and relationship that we have with those nations by assisting with border patrol or secu- munity-driven,” Alexson said. “It’s something that’s Broadview RCMP.” Alexson said they appreciate the rity at large gatherings. been a long-standing issue so they’re very pleased and prompt response of the RCMP to various incidents The Kahkewistahaw team regularly patrols roads supportive of what we have started.” over the past year. on their land, including the provincial Highway 201. All Safety Patrol members have received security Members patrol on foot or in one of the department’s guard and private investigator training, as well as first two service vehicles, which are equipped with first aid aid. Some have additional training in suicide preven- kits and dash cams. They have provided assistance NOTICE OF CALL FOR NOMINATIONS NOTICE of CALL NOTICE OF CALL The Rural Municipality of Kingsley No. 124
FOR NOMINATIONS For NOMINATIONS PUBLIC NOTICE is hereby given that nominations (Municipal Elections) Town of Grenfell of candidates for the offi ce(s) of: Municipal Elections 2020 38%/,& 127,&( LV KHUHE\ JLYHQ WKDW QRPLQDWLRQV RI Reeve 38%/,&127,&(LVKHUHE\JLYHQWKDWQRPLQDWLRQRIFDQ FDQGLGDWHVIRUWKHRIILFH V RI Councillor for Division 1 GLGDWHVIRUWKHRIILFH V RI MAYOR: Village of Goodeve Mayor (1): Town of Grenfell COUNCILLORS: Village of Goodeve Councillor for Division 3 Councillor (6), Town of Grenfell, Number to be elected: 2 Councillor for Division 5 ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHGRQWKHWKGD\RI2F ZLOO EH UHFHLYHG E\ WKH XQGHUVLJQHG RQ WKH WK GD\ RI WREHUIURP DPWRSPDWWKH7RZQ2IILFHDQG will be received by the undersigned at the 2FWREHUIURP DPWR SPDW0DLQ Municipal Offi ce during normal offi ce hours until GXULQJUHJXODUEXVLQHVVKRXUVRQ6HSWHPEHUWR 6WUHHW6RXWK9LOODJHRI*RRGHYHRIILFHDQGGXULQJUHJX 2FWREHUWKDW7RZQ2IILFH'HVPRQG6WUHHW ODUEXVLQHVVKRXUV SPWR SPRQ7XHVGD\V Wednesday, October 7, 2020 at 4 p.m. local time. *UHQIHOO6.6*% 6HSWWR2FWDW0DLQ6WUHHW6RXWK Nomination forms may be obtained from the 1RPLQDWLRQ IRUPV PD\ EH REWDLQHG DW WKH IROORZLQJ 9LOODJHRI*RRGHYHRIILFH municipal offi ce at 603 Main St., Kipling, SK. ORFDWLRQ Town of Grenfell Office 1RPLQDWLRQIRUPVPD\EHREWDLQHGDWWKHIROORZLQJORFD 800 Desmond Street, WLRQ 0DLQ6WUHHW6RXWK9LOODJHRI*RRGHYHRIILFH Dated this 18th day of September, 2020. Grenfell, Saskatchewan 'DWHGWKLVWKGD\RI6HSWHPEHU 'DWHGWKLVWKGD\RI6HSWHPEHU Brittany Knoll, $QJHOD5RPDQVRQ %UHQQD$FNHUPDQ5HWXUQLQJ2IILFHU Nomination Officer Returning Offi cer Join Grasslands News 12,000 weekly readers
SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun
Name:
Address:
Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone:
Email Address: WHY SUBSCRIBE? • Stay informed about your community. Payment by: ❑ Visa ❑ Mastercard Expiry • You support local businesses who support you back. ❑ Cheque or Money Order (enclosed) Signature • The newspaper is the community’s only historical record. Please make cheques out to Grasslands News Group Telephone Orders: 306-728-5448 (ext. 227) • A viable newspaper shows a strong community. • It’s less than buying one cup of coffee per week Forms should be mailed to Grasslands News Group, Box 1420, Melville, SK., S0A 2P0
-$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! W W¤ W
CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-2$;3#'8T;,3<+,;3'$WTW 2$£<&'&W 8 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Dog Park etiquette 101 - Rules and regulations By Emily Jane Fulford small children and tod- the tag from your veter- on at all times. Grasslands News dlers to the dog park is not inarian with the current For more information worth the risk. year as well as the copy of on the dog parks visit Tuesday is not Date your receipt. When walk- www.melvilleregional- There’s nothing like a Night. While nobody ever ing your dog off the leash park.com, www.town- good brisk walk through said the dog park is a at the dog park, it’s a good ofwhitewood.ca and for the park with your dog to bad place to meet fellow idea to have the leash on more tips and tricks on get the blood pumping and humans with similar in- your person for easy ac- dog park etiquette visit: the oxygen flowing. With terests, bringing a dog in cess in an emergency but www.hillspet.ca and use dog parks across the re- heat to the park is not the it’s even more vital that the keyword search “dog gion including in Melville municipal canine answer your dog’s collar remain park.” and Whitewood, it’s a good to speed dating. Much like opportunity for owners in the wild, it will likely and their furry friends to end at worst in a nasty flex their muscles and get via colorful scented bag- on end, especially if your fight for the female or at in some exercise off the gies, all with their own furry friend is large, hyper best with you footing the leash. However, as with brand of dispenser from or obtrusive towards other bill for a litter of puppies. many things, rules and the luxurious and com- dogs, ruins the fun for So let’s end things off guidelines are there for plex to the basic. For those other people. with a riddle: If diamonds a reason and sometimes less than enthused by the Don’t be a Patty are a girl’s best friend idea of custom poop sacks, Picknicker. Bringing food Proudly presents plain old common sense and a dog is man’s best can also play a part in there is now a use for those to a dog park is just a bad friend, what is a dog’s making sure it’s a positive allegedly “single use” plas- idea all around. Not only best friend? A collar with experience for everybody. tic bags that the free world is the temptation often too proper ID tags of course. HAUL-R-DAZE! were so concerned over much for many dogs, some With many people get- This includes tags for the prior to March 2020. Pick food may be toxic to ani- ONE DAY ONLY ting out of their more City of Melville as well as up after your dog and you mals. This is a good way sedentary activities and en- the most up to date rabies reduce the risk of spread to cause a problem either Sunday, September 27 joying the great outdoors, vaccination as well as a dealing with a “Tommy of disease and the unpleas- to yourself, your pet or tag with your contact in- 10 a.m. to 4 p.m. Texter” as Cineplex put it, ant result of stepping in somebody else’s. Instead, formation. Remember, if may be replaced by other doo-doo. treat the park as a golden your dog had a rabies vac- forms of nuisance to which Take turns, don’t be a opportunity to either work FEE-FREE DAY! cine, make sure to obtain the local dog park is not Harry Hog. While a brisk off those calories you just Exclusively for Member Municipalities exempt. Here is a list of walk through the dog park had for lunch or work up a For residential (not commercial) refuse that includes everything but tires and railroad ties. some of the common do’s is an excellent addition to high metabolic rate before Loads must be covered & tied down to prevent littering. dinner. and don’ts that will help any afternoon, it is a facil- LANDFILL Pre-sort into: Metal, compost, trees, other everyone enjoy the park, ity meant to be shared by Babies and Fur Babies )25748·$33(//( (or sorting fee will be charged) provided in part by the the community. Like that don’t always mix: Some- City of Melville as well as favorite piece of equip- times dogs can be ram- 6800(5+2856 some suggestions by Hills, ment at the local gym, bunctious and off-leash • May 1 to October 31 • the manufacturers of Sci- the average acceptable time can be exciting, but Monday to Saturday 8:00 a.m. - 5:00 p.m. ence Diet pet foods. amount of time hovers sometimes excitement can Sunday 10:00 a.m. - 4:00 p.m. around the 30 to 60 minute lead to accidents happen- Don’t be a Party Pooper, Closed Statutory Holidays be a Stoop and Scooper. mark, much beyond this ing. An excited animal Minimum Load Charge is $10 Yes, it is one of the pitfalls may not be healthy for the who’s not used to living We now Accept: www.4callinglakes.ca/regional/our-communities of dog ownership but it is animal. Treating the dog with little kids might run NP1RUWKRI)RUW4X·$SSHOOHRQ+Z\ what it is, and now that park like a personal back over to say hello and send F business can be dealt with yard to socialize for hours a child tumbling. Bringing
Town of Fort Qu’Appelle
136 Boundrary Avenue. - P.O. Box 309 S0G 1S0 NOTICE OF CALL Phone: 306-332-5266 Email: [email protected] Website: www.fortquappelle.com FOR NOMINATIONS PRECAUTIONARY DRINKING MUNICIPAL ELECTION WATER ADVISORY 38%/,&127,&(LVKHUHE\JLYHQWKDWQRPLQDWLRQVRI September 14, 2020 FDQGLGDWHVIRUWKHRIILFH V RI
2YHUWKHFRXUVHRIWKHQH[WVHYHUDOZHHNV3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVR ULHVZLOOEHLVVXHGIRUWKHDUHDVDORQJWKH%URDGZD\$YHQXHFRUULGRUDQGVRPHQHDUE\ VWUHHWV$VSDUWRILWVSURMHFWWRUHSODFHDJLQJLQIUDVWUXFWXUHDORQJ%URDGZD\$YHQXH 0$<25 7RZQRI)RUW4X·$SSHOOH WKH7RZQLVUHSODFLQJYDOYHVDQGK\GUDQWV:DWHU6HFXULW\$JHQF\SURWRFROLVWRSODFH V\VWHPVXQGHUD3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVRU\ZKHQZDWHUYDOYHDQGK\GUDQW UHSODFHPHQWUHVXOWVLQGHSUHVVXUL]DWLRQXQWLOVXFKWLPHDVWKHV\VWHPLVRSHUDWLQJZLWK LQUHJXODWHGYDOXHVDQGZDWHULVSURYHQVDIHIRUKXPDQFRQVXPSWLYHXVH3UHFDXWLRQ AND DU\'ULQNLQJ:DWHU$GYLVRULHVZLOOEHLVVXHGDQGUHPDLQLQHIIHFWXQWLOWKHVDIHW\RIWKH DIIHFWHGSRUWLRQVRIWKH7RZQRI)RUW4X·$SSHOOH·VGLVWULEXWLRQV\VWHPFDQEHHQVXUHG &281&,//25 7RZQRI)RUW4X·$SSHOOH DWDOOWLPHV 1XPEHUWREH(OHFWHG 6L[ :KLOH3UHFDXWLRQDU\'ULQNLQJ:DWHU$GYLVRULHVDUHLQHIIHFWUHVLGHQWVDQGEXVL QHVVHVDUHDGYLVHGWR D%RLODOOZDWHUXVHGIRUGULQNLQJSXUSRVHVIRUDWOHDVWRQH PLQXWHDWDUROOLQJ ERLOSULRUWRXVH ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHG0RQGD\WKURXJK)ULGD\ E%RLOZDWHUWREHXVHGIRURWKHUDFWLYLWLHVZKHUHLWPD\EHLQJHVWHGLQFOXGLQJ L%UXVKLQJWHHWKRUVRDNLQJIDOVHWHHWK IURP DPWR SPXQWLOWKHWKGD\RI2FWREHU LL:DVKLQJIUXLWVDQGYHJHWDEOHV DW%RXQGDU\$YHQXH6RXWK)RUW4X·$SSHOOH6. LLL)RRGRUGULQNZKLFKZLOOQRWEHVXEVHTXHQWO\KHDWHG DQG LY,FHFXEHV 6*6 F1RWXVHWKHZDWHUIRUZDVKLQJGLVKHVXQOHVVWKHZDWHUKDVEHHQERLOHGRU WKHGLVKHVDUHVDQLWL]HGLQDQRWKHUIDVKLRQ:DVKHGGLVKHVDQGXWHQVLOVFDQ EHVRDNHGLQDEOHDFKZDWHUVROXWLRQ DSSUR[LPDWHO\WDEOHVSRRQVRIEOHDFK 1RPLQDWLRQ IRUPV PD\ EH REWDLQHG 0RQGD\ WKURXJK SHUJDOORQRUPORIEOHDFKSHUOLWHURIZDWHU IRUDWOHDVWWZRPLQXWHVDIWHU EHLQJZDVKHGWRNLOODQ\EDFWHULDZKLFKPD\EHSUHVHQW1RWH 'RQRWPL[ )ULGD\ IURP DP WR SP DW %RXQGDU\ EOHDFKZLWKVRDSVRUGHWHUJHQWV $YHQXH6RXWK)RUW4X·$SSHOOH6.6*6DQGRQOLQHDW G1RWGULQNIURPDQ\SXEOLFGULQNLQJIRXQWDLQVVXSSOLHGZLWKZDWHUIURPWKH SXEOLFZDWHUVXSSO\ www.fortquappelle.com H(QVXUH\RXQJHUFKLOGUHQDQGLQIDQWVDUHVSRQJHEDWKHG I8VHDQDOWHUQDWLYHZDWHUVRXUFHNQRZQWREHVDIHLIWKH\GRQRWZLVKWRERLO WKHZDWHU DQG 'DWHGWKLVWKGD\RI6HSWHPEHU J&RQVXOWZLWK\RXUSK\VLFLDQLI\RXKDYHFXWVRUUDVKHVWKDWDUHVHYHUHEHIRUH XVLQJWKHZDWHU 9*RRGPDQ 8QGHUPRVWFLUFXPVWDQFHVWKHUHLVQRQHHGWRERLOZDWHUXVHGIRURWKHUKRXVHKROG SXUSRVHV$GXOWVDGROHVFHQWVDQGROGHUFKLOGUHQPD\VKRZHUEDWKHRUZDVKXVLQJ 5HWXUQLQJ2IILFHU WDSZDWHUEXWVKRXOGDYRLGVZDOORZLQJWKHZDWHU/DXQGU\PD\EHZDVKHGLQWDSZDWHU HLWKHUE\KDQGRUE\PDFKLQH www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 9 Gene Hauta It’s A Strange World A Columbian Uber driver discovered his wife was having an affair when he was unwittingly hired to pick up her and her lover to take them to a hotel. The woman, named only as Yeimy, and her boyfriend, Jesus Barrios, booked an Uber to move their date to a more private location. Yeimy was not aware that her husband, Leonardo, was moonlighting as an Uber driver and using a friend’s car - and account - in the process. It is not sure what happened after the discovery, but Leon- ardo and his friend could face being banned by the app for breaching Uber’s policy of providing inac- curate information. The latest idiotic TikTok stunt is the Benadryl Challenge, which involves ingesting enough of the allergy medication, Benadryl, to hallucinate and then posting the footage on social media. The
68%0,77('_*5$66/$1'61(:6 pharmaceutical giant Johnson & Johnson recently 7LP+RUWRQV·6PLOH&DPSDLJQ issued a warning to parents about the dangers )RUW4X·$SSHOOH)RRG%DQNVWRSSHGE\DQGWKDQNHGWKH)RUW4X·$SSHOOHGHWDFKPHQWIRUWKHIURQWOLQH after a 15-year-old Oklahoma girl died during VHUYLFHE\SURYLGLQJVPLOHFRRNLHVWR6JW'UHZ:DJQHU&VW/DXUHQ%RXFKHU&VW-DVRQ*DPDUUDDQG the stunt. Poison Control experts &VW$QGUHZ0HWKYHQ explained that the drug is diphenhydramine, an anti- histamine over-the-counter Fort Qu’Appelle RCMP drug, widely available, and widely perceived as safe. It is definitely the dose that makes the difference. Large amounts Car window broken to make arrest of Benadryl can cause sei- zures and, particularly, Sgt. Drew Wagner without a valid license. male and did not want charges, just problems with the heart. Fort Qu’Appelle Detachment Another collision involving two that he be removed. The male was The heart tends to go out of rhythm and not pump vehicles resulted in a 17-year-old released the next day after sobering blood effectively. Having driver being charged for proceed- up. Reporting period: 30 seconds on TikTok isn’t really worth the conse- ing from a stop sign before safe to A 19-year-old female was ar- Sept. 8 to Sept. 14 quences. rested after a 911 call was made by Traffic do so. Todd Osmundson has apologized for his role in A 19-year-old female had her her complaining about her mother. Fargo, ND, protests over George Floyd’s mur- A complaint of an erratic, pos- license suspended for three days The 19-year-old admitted to tak- der by police. He admitted he was carrying an sibly impaired driver on High- after a driving complaint was ing acid and told the operator her open beer can while marching, and yelling “F**k way 10 resulted in the arrest of a made. She admitted to consuming mother was across the street, but the cops!” and other slogans during the peaceful 24-year-old female. Officers located alcohol at a Regina bar and had had been kidnapped. The female protests. Early in the day, he was in uniform — the westbound vehicle between enough alcohol to warrant a sus- was held in cells to sober up. he’s the Deputy Chief of Police in Fargo — but Balcarres and Fort Qu’Appelle and pension. A 43-year-old female was ar- at least he had the sense to change into civilian attempted to stop it. The suspect Traffic tickets issued for: Drive rested inside a restaurant after a clothes, with a face mask and sunglasses — and failed to pull over. Additional offi- while disqualified, operate unreg- complaint that she was acting odd. add the beer can, which he claims was empty. In cers were summoned and set up a istered trailer/vehicle, disobey Officers believed she was intoxi- his apology, Osmundson claimed he was trying to spike belt just east of Fort Qu’Ap- stop sign, speeding, exceed 60km/h cated on alcohol and drugs. She “infiltrate” protestors, even though he was not as- pelle. The suspect then stopped when passing emergency vehicle was held in cells to sober up. signed such duties. short of the spike belt. The lone with lights activated, driver fail to A 22-year-old male was arrested Dennis Dickey set off a 47,000-acre wildfire in female occupant refused to unlock wear seatbelt, inadequate muffler, for mischief after he damaged his Arizona that cost $8 million, and now, he is on the doors and began to consume drive without valid license, and own car, bedroom, and threatened the hook for $220,000 in penalties. The so-called meth in front of the officers. Of- unlawful window tint of front side his family members. Family did Sawmill Fire occupied about 800 firefighters for ficers had to break a window to windows. not want charges, just that he be a week. In rural areas of northern California, effect the arrest. The vehicle was Mischief removed to sober up. He was re- farmers are largely being left to fight wildfires on found to have been stolen from leased after a night in cells. their own because fire crews are tapped out and the Melville area. The female faces A dispute between neighbours being required to respond to more heavily popu- charges of flight from police, theft lead to an officer speaking to both Crimes Against the Person/Property lated areas. There have been an estimated 14,000 over $5,000, possession of property parties. Each neighbour was found A complaint of an assault in still lightning strikes in California since mid-August. obtained by crime, possession of a to be stirring the pot and were told being investigated. A 22-year-old fe- A 17-year-old employee at Sesame Place was controlled substance and driving to stop. male alleged she was assaulted by forced to undergo surgery after a mask dispute without a license. She remains in A complaint of harassment will her 35-year-old female neighbour. A at the Pennsylvania theme park ended in an al- custody pending further court ap- be followed up on. A 28-year-old dispute between the two appears to tercation. The worker had asked a couple to put pearances. female complained of a vehicle fol- have escalated into an assault. No on their masks earlier in the day; then, later, he A 55-year-old male was arrested lowing her while she walked. The injuries were reported. encountered the man and woman again at a ride for impaired driving after a com- registered owner of the vehicle has A 31-year-old male is facing a and repeated his reminder. He was aggressively plaint was made about him being been identified and will be spoken domestic assault charge on his punched in the face by both the female and the parked in front of a residence that to. 31-year-old female spouse. This was male, and was knocked to the ground. The teen was not his. As officers responded, A 44-year-old male well known the third occurrence in eight days ended up with a displaced jaw and injuries to the male left and began driving in to police attended the detachment involving this couple. No injuries his teeth. Pope Francis urged the faithful to steer clear a field. Officers located the male intoxicated. He was lodged in cells were reported and the male has of gossip, calling it a worse plague than the coro- passed out behind the wheel. He for the night and released the next been released to appear in court. navirus and saying it could be used to divide the refused to provide breath samples. day. Officers have reached out to A complaint of intimate images Roman Catholic Church. “The devil is the great He faces impaired driving and re- the male’s family to seek assistance of an adult being posted to social gossip. He is always saying bad things about oth- fusing breath sample charges. in getting him a stable residence to media without consent is still under ers because he is the liar who tries to split the live in. investigation. A complaint of drivers passing Church,” Francis added. The pope has regularly A complaint of a broken window A B&E into a residence is still school buses and driving through warned of the risks of gossiping and has also areas restricted. A reminder that on a vehicle that was left parked being looked into. The complainant railed against Internet trolls. school is back in so please be con- has not identified any suspects. does not think anything was stolen, I’ve seen the warning, and I realize hand sani- siderate of the students when drop- The owner left it for the day and but someone did enter the residence tizer is mostly alcohol, but a woman in Texas lit ping and picking up. returned in the evening to find the and cook some food. herself on fire while trying to light a candle. A collision involving a deer damage. A 25-year-old female was arrested Kate Wise had just put the off-brand sanitizer resulted in minor injuries to the A 22-year-old male was arrested and charged for violating her re- on her hands, when the alcohol caught fire from driver. To add salt to the wound for breaking a window in a resi- lease conditions by contacting a vic- the candle. The sanitizer bottle was near enough he was issued a ticket for driving dence. The homeowner knows the tim she had previously assaulted. to the candle that it exploded. With her face and hands burned and her clothes on fire, she man- aged to get her disabled daughter and pets of out her house. RE-OPENED Mounties in central Alberta, specifically Melville Community Works TO THE PUBLIC! Thorsby, are looking for a thief who might be in some hot water. That’s because seven hot tubs • Thrift Shop open - Tuesday and Thursday 12 - 4 p.m. were stolen from an Arctic Spas manufacturing • Gift Shop open - Tuesday and Thursday 1 - 3 p.m. site. A transport truck listed as being from Cha- • Kidsville open - Monday to Friday 9 - 11:30 a.m. teauguay, Que., simply pulled into the property - 1st and 3rd Saturdays 10 a.m. - 12 noon and loaded the spas. • Weight Watchers - Weigh in Tuesdays 6:15 p.m. Meeting 7 p.m. Eden Dranger: “I’m at the stage of quarantine • Canadian Mental Health Association - Melville Branch where I’m gonna ask this warm pile of laundry - Meeting 1st Wednesday of every month 7 p.m. to marry me.” I’m sure glad we followed the rules www.prairiecoop.com so that the virus never really got away from us in • Magic Moments Playschool is currently full and accepting names for www.facebook.com/prairiecoopretail Canada. the 2020 - 2021 school year wait list. Please contact Chantel Fahlman Sponsored by Prairie Co-op I’m not nearly desperate enough to propose to for more info at 306-730-6272 or via Facebook messenger. the laundry, either clean or dirty… keep reading between the lines… 10 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Southeast College Heavy Equipment Operator Program gets funding
Provincial News (HEO) program has been a long-time are very pleased with the collaboration of province to receive this training. Grasslands News goal of Southeast College. The funding between the Province and the Southeast The timeline for completion of the will assist in the development of spe- Coal Transition Board that has made project is March 31, 2021 with the first cialized curriculum that will be used this funding possible for Southeast Col- cohort of Heavy Equipment Operator Southeast College is proud to an- to facilitate training and retraining op- lege. The funding towards the Heavy students starting in April/May 2021. nounce that it is the recipient of $100,000 Equipment Operator project will help Approximately eighteen to twenty four in funding from the recently established portunities. The project will also have provide key skilled employees to help students per year will benefit from this Provincial Transition Funding Commit- another unique advantage of support- fulfill this important labour market training with the majority of students tee for Economic Development. This ing the City of Estevan with various need.” relocating to Estevan for the duration committee, chaired by Estevan mayor infrastructure projects as part of the Employment estimates in 2019 topped of their program. Roy Ludwig, was formed to administer hands-on practical training for the HEO almost 5,300 positions with the future Southeast College is proud to be the eight million dollars announced in the students. job prospects rated as fair. (Relevance Trainer of Choice in Southeast Saskatch- fall of 2019 by Premier Scott Moe and “There has been a number of pro- Magazine 2020 – Saskatoon Industry ewan. The College offers innovative and Estevan MLA Lori Carr. The intent is vincial projects announced in Sas- Education Council) Most students inter- flexible programming that encourages to assist in the funding of projects that katchewan recently that will require ested in this program have to travel out students to learn where they live. will offset the effects of coal transition an increase in experienced and skilled in southeast Saskatchewan. Heavy Equipment Operators in our The establishment of an industry province,” said Patrick Stoddart, Presi- accredited Heavy Equipment Operator dent and CEO of Southeast College. “We Become a Red Cross volunteer
Provincial News an incredibly rewarding experience,” Grasslands News said Kim MacLean, acting vice pres- ident of the Canadian Red Cross in Saskatchewan. “It is an opportunity to The Canadian Red Cross is recruit- help your neighbours and communities, ing new volunteers in Saskatchewan to close to home or across the province, in help people affected by community-wide times of disaster and uncertainty.” emergencies or personal disasters. Disasters – large and small – haven’t The most pressing need is for vol- stopped during the COVID-19 pandemic. unteer members of the Emergency Joining the Red Cross is a fulfilling Management and Personal Disaster As- way to make a meaningful contribution sistance teams. Volunteers with these while using or developing highly trans- $100,000 of funding 68%0,77('_*5$66/$1'61(:6 teams provide support to people affected ferable skills, said MacLean. “As part of Janice Giroux, Southeast College Board of Governors Chair; Lori Carr, Minis- by large-scale disasters, such as flood- the largest humanitarian organization ter of Government Relations, Minister Responsible for First Nations, Metis and ing or wildfires, or those affected by a in the world, the Red Cross allows peo- Northern Affairs, Minister Responsible for the Provincial Capital Commission, personal disaster, such as a house fire. ple from a variety of age groups, in com- There are also opportunities with the munities all over the province, to help MLA for Estevan; and Roy Ludwig, Mayor of Estevan. Safety and Wellbeing team, which pro- when and where it’s needed most.” vides emotional support for those expe- For more information about volun- riencing crisis or disaster. teer opportunities with the Red Cross, “Volunteering with the Red Cross is visit www.redcross.ca/volunteer. 3ধ$'3(!££(3831-2!ধ329 $,33£3!8& £'$ধ329 Good Spirit School Division Notice of Call for Nominations -9,'8'#@+-='2;,!;231-2!ধ323($!2&-&!;'9(38;,'3ă$'3(V BOARD OF EDUCATION: Prairie Valley School Division No.208 PUBLIC NOTICE LVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHVIRUWKHRIÀFH V RI 2'3!8&'1#'8(38'!$,9<#&-=-9-32V Board Members:*RRG6SLULW6FKRRO'LYLVLRQ1R Subdivision No. 1g'9;3$0T'8399T'££-,'8T !8£ 8'@T3<;,'@T!80-2$,T<6!8T 1XPEHURI%RDUG0HPEHUVWREHHOHFWHG²PHPEHUSHUVXEGLYLVLRQ @9!8;!2&9<883<2&-2+!8'!9 Subdivision No. 2 Sub-Division No. 1 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI$UUDQ3HOO\ g8!='2T<19&'2T'+-2!'!$,T';,<2'T -2&£!;'8T-9£'@T 8!2& DQG7RJRWKH7RZQVRI.DPVDFNDQG1RUTXD\DQGDVVRFLDWHGUXUDODUHDV 3<£''T'29'!2&9<883<2&-2+!8'!9 Sub-Division No. 2 5HSUHVHQWLQJWKHLQFRUSRUDWHGDUHDRIWKH9LOODJHVRI(QGHDYRXU+\DVDQG Subdivision No. 3g-6;32T!£$!88'9T 38;
Nomination forms for Sub-Divisions 1 to 8 and for City of Yorkton at Large may be obtained at: -££#'8'$'-='&V *RRG6SLULW(GXFDWLRQ&RPSOH[ (OHFWLRQ+HDGTXDUWHUV²&LW\&OHUN·V2IÀFH @;,'(3££3>-2+231-2!ধ3293ă$'89(831V!W1W;36W1W32 '&2'9&!@T$;3f %6FKUDGHU'ULYH Mayor’s Corner “Working Together... to Grow Melville There is certainly a flurry of political reorganization activities ranging from rural and urban mu- nicipal elections, to school board and provincial elections as well as the possibility of a federal elec- tion. Elections are a part of our democratic process allowing for individual participation in determ- ing leadership placement. We have 6$5$+3$&,2_*5$66/$1'61(:6 the opportunity to have our say &RPPXQLW\6SDFHVJUDQW 'XVWLQ'HFOHUFT FHQWUH IURP+RPHWRZQ&RRSSUHVHQWHGDFKHTXHWR3UHVLGHQW5DQG\'XURYLFN 675((/$6.< – Please VOTE in the upcoming elections! ULJKW DQG9LFH3UHVLGHQW-HVVLFD&ULGGOH OHIW IURP6XQVHW%HDFK5HFUHDWLRQ,QFIRUDQHZSOD\JURXQG Slowly and cautiously our province has moved DQGSLFNHOEDOOFRXUWV to open our economy while steadfastly messaging COVID-19 precautions and care – discouraging inter-provincial travel, utilizing the “bubble” re- lationship model and keeping that distance. With the start of school we empathize with Hometown Co-op donates $43,000 teachers, students and parents as each have mo- mentous challenges to face – teachers tasked with the many groups and in- donations from the RM and after construction. establishing a safe climate for learning, students By Sarah Pacio dividuals who have made of Grayson, Cowessess They are also thankful learning in a restricted environment, parents Grasslands News weighing an in-school learning opportunity op- it possible to rejuvenate First Nation and nearby for the opportunity to the recreation facilities. hamlets. Others, like provide families with a posed to on-line instruction. We do not envy the Dustin Declercq pre- difficulty the dilemma imposes on each. sented a $43,000 cheque to “We want to thank Co-op Dustin Ast from C & E new facility. “I grew up With the record-breaking cold snap of Septem- members of Sunset Bach Community Spaces for Maintenance, will donate there, so it’s nice to have ber 8th, we realize that any further flower, gar- Recreation Inc. in front the generous donation. equipment and a crew to something better for my den or crop growth has ended and that we will of Hometown Co-op’s We also got lots of gen- construct the playground. three-year-old to play on,” hopefully experience a speedy harvest before yet C-Store in Broadview on erous support from local Owen Thiedig is the con- commented Jessica Crid- another season sets in. September 15. The fund- donors,” he said. “Sunset tractor who will create dle, vice-president of Sun- We welcome many aspiring young SJHL ing comes from Feder- Beach is very fortunate new pickleball courts at set Bach Recreation Inc. hockey players to our Millionaire Camp on the ated Co-op’s Community and blessed.” the beach. Due to COVID-19, con- September 11th weekend. We wish Coach Rooney, Spaces grant program and In addition to the do- The recreation com- struction has been de- the Millionaire executive and all our players the will be used for two new nation from Co-op, the mittee is enthusiastic layed until next spring, very best as we hopefully prepare for a season of pickleball courts and new group has raised $47,000 about potential economic but Durovick expects the exciting hockey. playground equipment at through various fundrais- spinoff from the newly de- project will be completed Did you know that our Melville Fire Depart- Sunset Beach, at the east ing events, grants, and signed park, both during by the May long weekend. ment, under the leadership of Fire Chief Mogen- end of Crooked Lake. son, has attended in excess of eighty children’s Randy Durovick, pres- birthday parties to present the birthday child ident of Sunset Bach NOTICE OF CALL FOR with small tokens regarding fire awareness? Recreation Inc., said that During this difficult time of restricted birthday not only is existing play- NOMINATIONS gatherings a fire truck complete with sirens and ground equipment aging, )RUP+ lights has brought many delighted smiles to each flooding in 2014 caused (Section 66 of the Act) child. significant damage to CHRIST THE TEACHER RCSSD NO. 212 Walter Streelasky, Mayor of Melville the area. Durovick ex- SCHOOL DIVISION ELECTIONS pressed appreciation for 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHVIRUWKHRIÀFHRI BOARD MEMBER: CHRIST THE TEACHER ROMAN CATHOLIC SEPARATE SCHOOL DIVISION NO. 212 1XPEHUWREH Will the voters know who you are? Elected ߦ0HOYLOOH²&LW\DW/DUJH ߦ6XEGLYLVLRQ1R 7KHRGRUHDQGVXUURXQGLQJUXUDODUHD ߦ6XEGLYLVLRQ1R *HRJUDSKLFDUHDVXUURXQGLQJ0HOYLOOH ߦ6XEGLYLVLRQ1R 5XUDODUHDVXUURXQGLQJ Junior Poles - Dakota Van Metre Junior Team Roping - Ellie Bendickson and Kylie Rasmunson Junior Bull Riding - Jace Beierbach Junior Barrels - Emery Redlick Junior Chute Dogging - Lucas Ozirney Young cowboys and cowgirls lined up on a fence watching the performances. www.grasslandsnews.ca Whitewood Grenfell Herald Sun September 18, 2020 13 Terry Fox Marathon of Hope Annual run tripped up by global pandemic By Chris Ashfield Grasslands News As the Terry Fox Mar- athon of Hope celebrates 40 years this year, the annual fundraiser has a new set of challenges to overcome. This year, the Run’s theme is “One Day. Your Way.” But due to public health concerns, many runs will be done in spirit, not in person this year. Co-op Fuel Good Day SARAH PACIO | GRASSLANDS NEWS Many school and com- Volunteers served up hamburgers during the annual Fuel Good Day munities throughout the area have decided to ei- campaign at the Grenfell C-Store on Sep. 15. Drive-thru barbeques were ther cancel their runs this also hosted at Hometown and Borderland Co-op stores in Broadview, year or hold smaller modi- Kipling, Whitewood, Moosomin, and Rocanville, with proceeds going to fied Runs, including those local KidSport committees. Co-op will also donate ten cents per litre to in Melville, Grenfell, KidSport from fuel sales on Tuesday. Broadview, Whitewood and Fort Qu’Appelle. In Melville, there will be no city-wide Terry Fox Prompt Payment Legislation costly to hometowns Run and both Davison Annual run School and Melville Com- This year celebrates the 40th Annual Terry Fox Municipalities of Sas- a new dispute resolution lations. The regulations prehensive High School 0DUDWKRQRI+RSH7KLV\HDU·VWKHPHLV´2QH'D\ katchewan is calling on process. were brought before Cab- have also decided not to the Government of Sas- “We value and support inet in August. Your Way”. hold events this year. The katchewan to reconsider our local businesses, and “As the order of gov- schools still participat- prompt payment legisla- our hometowns often pay ernment closest to the ing will all hold smaller their individual Phys. Heather Hallam shared tion and regulations that invoices within 30 days,” people, we are responsi- modified events to limit Ed classes, ensuring they with Grasslands News. have the potential to cost said President Barn- ble for ensuring safe in- contact with others. St. maintain contact only In Fort Qu’Appelle, municipalities millions hart. “But it is our duty frastructure projects that Henry’s Senior School with their cohort. During the community event has in taxpayers’ dollars and to ensure infrastructure enhance the quality of life will be holding a Terry the week of September been cancelled so orga- harm good governance projects meet and ex- for our residents while Fox event on Sept. 18 as 21-25, each classroom nizers are encouraging practices. ceed public safety stan- being financially respon- a classroom cohort based teacher at Broadview people to unite in spirit “Our municipalities dards, and funding is not sible with our taxpayers’ walk while both Miller School will take students but not in person by are responsible for the wasted. Under the new dollars,” said Barnhart. School and St. Henry’s Ju- on a walk or run. holding their own Run infrastructure projects legislation, municipali- “Our hometowns deserve nior School will be hold- In Whitewood, stu- around their neighbour- that build better lives ties will have less time to be consulted on legis- ing a low-key version on dents in PreK to Grade hood, backyard, down for 80 per cent of Sas- to ensure projects meet lation that impacts those Sept. 25. 12 will be participating the street, or around the katchewan’s residents,” standards and we could responsibilities.” Each year, schools in in the Terry Fox walk block over the weekend. said Municipalities of end up spending more Grenfell, Broadview and on September 29th and Fort Elementary School Saskatchewan President money to take part in a Whitewood participate in 30th. The 30th is the ac- is still determining Gordon Barnhart. “The legislated adjudication the Terry Fox Run Fund- tual school run day. Each whether they will hold Builders’ Lien (Prompt process to recover fund- raiser. Traditionally, all class will walk during an event while Bert Fox Payment) Amendment ing on projects that are the students and staff their physical education High School stated they Act and accompanying discovered to be incom- members run laps around class. On the 29th, White- would not hold an event regulations potentially plete.” the field outside Grenfell wood School will encour- this year. expose our hometowns Municipalities of Help keep your Elementary Community age all of the students to In 2019, Saskatche- to millions of dollars of Saskatchewan is disap- community’s School (GECS). In Broad- wear red. wan raised over $800,000 losses in both dollars pointed in the lack of view and Whitewood, the “We would like to en- through The Terry Fox and time as municipal- consultation on the act history alive. event is usually school- courage all of our com- Foundation. To date, over ities are forced to rush and regulations. Multiple wide as well, with stu- munity members to go $750 million has been payment on projects that requests for consultation SUBSCRIBE TO YOUR dents and staff from all for a walk on either of raised across the globe may not be complete or were made to the Govern- LOCAL NEWSPAPER! grades running a desig- those days as well! We for cancer research in meet standards.” ment of Saskatchewan, nated route through the will post pictures on our Terry’s name. The new legislation including a letter sent community. This year Facebook page and en- For more information requires project owners on July 23 to Saskatche- Call Toll Free: will be different. courage our community on the Terry Fox Run or to pay invoices from gen- wan Justice Minister Don 1-844-GNG-NEWS On September 18, stu- members to do the same! to register you own Run, eral contractors within Morgan asking for mu- dents at GECS will do a They can post pictures in visit the official website 28 days of receiving an nicipal consultation on [email protected] “Terry Fox Run” during the comments,” teacher at http://terryfox.org invoice and introduces the development of regu- 20093CC3 £'$ধ32!2&-&!;'9 Let VOTERS know who you are Kickstart your campaign with a newspaper 683)£'('!;<8'!8ধ$£'T!&='8ধ9-2+!2&68-2ধ2+R V 20 (18” x 20”) Lawn Signs ORlW\?¥Wm £399 £@'89T lc¥6!+'m'>96!6'8&9!2& !'>96!6'883)£' '!;<8'8ধ$£' $ 00 !££(38 395 ,-;'>33& 8$32;!$;<9;3!+'; 0!ধ2+£<# $<9;316!$0!+' 9ধ1!;'3&!@R ø'89!20!;'!2&;!80!;' '68-2;!>2-+29T39;'89T £@'89c83$,<8'9T<9-2'99!8&9T 683+8!19>-;,0!;'!2!&!!2& 338 !2+'89!2& R 0!;'!2!&!!90!;$,'>!2W (-2;'8'9;'&>'$!2!£933ø'8 !23>'80!;'!2&@2$830!ধ2+W 83+8!19$!2#'3ø'88'&;30-&9!2& !&<£;9W 38138'-2(381!ধ32$32;!$; <9!;V>,-;'>33&(9$|+1!-£W$31 14 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News Shuffleboarder wins triple crown By Alan Hustak “Not long ago people in the Grasslands News league travelled from Regina to Fort Qu’Appelle to play at the Squire. Now shuffleboard is a Table shuffleboard is a dying sport. Kids are getting hands-on game that is a fixture into darts and pool instead,” in most Legion Halls, beer par- she said. She and her husband lours and many bars across the hope to mentor players who country. It’s a lot like curling but on a much smaller scale; might be interested in learning a game that is as much about the game. the camaraderie as it is about “I won’t play,” she laughs, “I competition. don’t want to intimidate any- Just ask Charlene Lucas, one. I’m just here to coach the the first player in the league’s players. I love to watch young 50-year history to win the tri- players. I call them ‘hungry green dogs’ because that’s what ple crown in all three compet- $/$1+867$._*5$66/$1'61(:6 itive events: The Ladies Single I was when I started playing.” 7ULSOHFURZQVKXIÁHERDUGHU Title, Ladies Doubles Title with Lucas was drawn to the &KDUOHQH/XFDVRI)RUW6DQLVWKHÀUVWSOD\HULQWKHVKXIÁHERDUGOHDJXH·V\HDUKLVWRU\WR partner Liz Patrick, and Mixed game 45 years ago when she ZLQWKHWULSOHFURZQLQDOOWKUHHFRPSHWLWLYHHYHQWV 7KH/DGLHV6LQJOH7LWOH/DGLHV'RXEOH Doubles with her partner, Rod was a civil servant in Regina. 7LWOHDQG0L[HG'RXEOHV7LWOH Betker. “I started playing bankboard Lucas, who lives in Fort San, (which is played on a shorter don’t take is seriously, I have partner Robyn Holt won the But that’s my goal.” holds 14 Canadian champion- board and players must angle fun for the night. But when I go Ladies Doubles event at the Ca- Rod Betker, who has just ship titles. their shots) for beers at the into competition it becomes a nadian Shuffleboard Champion- written 50 years: A History Six years ago, she was in- Pig and Whistle. When we won job. I am a whole different per- ships held at the Polish Legion Shuffleboard in Canada, has ducted into the Canadian Shuf- against the favourites to beat son; I remain focused, focused, in Kitchener. Regina was to often teamed up with Lucas for fleboard Congress Hall of Fame. and the bar cheered, I was focused, focused.” play host to the championships mixed double competitions. He When the chill of winter ar- hooked.” Her husband, Larry, agrees this year, but because of pan- says Lucas is “a good shot. She rives, the game is a welcome There is no Canadian league that his wife is “very good at demic the event was cancelled. is one of the best female players alternative to other outdoor in bankboard so Lucas, want- the game. I enjoy playing too, “I have a goal. I want to beat to have ever played the game.” activities. So Lucas and her ing a competitive challenge, but I’m not in her league. the record held by Vancouver’s Anyone interested in join- husband, Larry, hope to start a switched to straightboard. Whenever I manage to beat her, Joannie Miller who passed a ing the mini league is asked mini-shuffleboard night at the “For me, once I learned the it’s a fluke.” year ago,” she said. “Miller got to show up at the Legion in Legion this year to revive local game it was like riding a bi- Last October, Charlene 15 titles, I have 14. But I’m 65 Fort Qu’Appelle at 6:30 p.m. on interest in the game. cycle. When I’m just playing I Lucas and her Ladies Doubles and it gets harder and harder. Thursday, Sept. 24. Severson in virtual run to support frontline workers The New Jersey Devils, in frontline workers and staff, Healthcare Heroes on the front program with videos from RW- collaboration with the Team’s and manages ongoing prepa- lines, while supporting our JBarnabas Health Wellness Official Healthcare Provider ration to protect surrounding mission of promoting healthy Experts including strength, RWJBarnabas Health, an- communities for any poten- living in the communities agility and conditioning tips. nounced that Melville’s Damon tial resurgence of the virus or we serve,” said Barry H. Os- Additionally, participants will Severson, along with Travis other emergencies. Registrants trowsky, President and Chief have access to nutrition tips Zajac and NHL All-Star Kyle can designate which RWJBarn- Executive Officer, RWJBarna- from RWJBH Dieticians and Palmieri will lead a contingent abas Health facility to be the bas Health. Wellness Experts. of New Jersey Devils’ players, beneficiary of their fundraising The new virtual format is Fans and members of the alumni and wives/girlfriends efforts. designed to encourage greater community can register and in a virtual RWJBarnabas The current player team participation as individuals join one of the New Jersey Health “Running with the Dev- consists of Travis Zajac (5K can run or walk within their Devils-based teams as they ils 5K Run and Walk” which Captain), Cory Schneider, Will communities, or even in their compete “virtually” to capture takes place from Oct. 1 to 25, Butcher, Kyle Palmieri, Con- own homes, over an extended bragging rights to the fund- 2020. nor Carrick, Mirco Mueller period of time. Exciting fund- raising crown. Registration for The event celebrates the he- and Damon Severson; The Dev- raising incentives are being of- a 5K “virtual runner” ages 12+ roic efforts of frontline workers ils Alumni team includes Ken fered for individuals and teams is $25, and registration for a that continue the battle against Daneyko (5K Captain) Bruce based on benchmarks of $100, walker ages 12+ is $20. Chil- the COVID-19 pandemic. 100% Driver, Grant Marshall, Bryce $250, $500 and $1000, and in- dren 11 and under are FREE. of proceeds from the event will Salvador and Colin White and 0HOYLOOH·V'DPRQ6HYHUVRQ clude signed and custom New For more information on the benefit RWJBarnabas Health’s the She Devils team features Jersey Devils’ merchandise event, or to register for the 2020 Emergency Response Fund, Nikki Zajac (5K Captain), Jill “Participation from cur- and a Virtual Video Confer- Virtual RWJBarnabas Health which provides the necessary Schneider, Tayler Butcher, rent players, alumni, wives ence with current players and “Running with the Devils 5K resources to help treat the Ashlee Palmieri, Lexi Carrick, and girlfriends is fantastic alumni, among others. Run and Walk” from October most critical patients; ensures Kristin Mueller and Drey Sev- and reinforces the spirit of our All paid entries will have 1-25, please visit rwjbh.org/ the safety of all caregivers, erson. partnership, as we celebrate access to a custom training runningwiththedevils. MORE LOCAL COVERAGE than any other newspaper in Southeast and Central Saskatchewan! Melville Advance | Fort Qu’Appelle Times | Whitewood Grenfell Herald Sun www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 15 Sports Column – Darcy Gross Gross Misconduct Whitewood and Grenfell arenas There have been a plethora of ways that people have described the sport of golf over the years. ready to fire up for the season It’s been said that golf is a good walk spoiled -- by a little, white dimpled ball, one would suppose. hockey players, but the At the time of speaking It’s also been said that the word ‘golf’ was the only We’re all excited to strap By Sarah Pacio GAA is still waiting for with Sparvier (last week), four-letter word left to describe a sport so painfully Grasslands News on our skates and carry direction from Skate Can- she commented “Reg- unforgiving to the player. on the great tradition ada regarding the local istration has only been It’s a game where you can go to the most beau- in Grenfell of Spitfire The uncertainty sur- CanSkate program. open for a week but our tiful locales with the best weather and all you can hockey.” rounding team sports due “There’s a lot of un- numbers are low in all see for the entire day is indescribable ugliness as Ryan Dale, White- to COVID-19 was develop- knowns right now, and age groups. We hope that you try to knock that dimpled ball into the hole 18 wood’s recreation direc- ing fear in some people we’re having a slower with harvest in full swing times. tor and facility operations that the winter recre- start to registration,” and the busyness of back The frustration – as well as the struggle – is manager, has confirmed ational season would be GAA representative Jen- to school that it’s just tak- real, folks. his department will be in- cancelled in most commu- nifer Kraushaar told ing time for people to reg- From the first time that I teed up a ball as a stalling ice with an Octo- nities, but with diligent Grasslands News. “We ister. If you are wanting child to the rare occasions that I play a round on ber 7 opening date of the research and restructur- currently have four your child/children in the local links, the time spent swinging a club and arena. Dale also compiled ing by officials and or- team rosters filling up hockey - now is the time chasing the ball around the course has enraged and received council ap- ganizers, the arenas will nicely.” Volunteers are to get registered!!” me more often than it’s made me smile and yet, I proval for a Re-open Plan be opening. Although the still needed to help with Teams will start prac- always come back to it. with the new rules and sports will operate in a coaching and other as- tices in mid to the later Not only do I always return to the sport, I en- restrictions that must be fashion immensely dif- pects of the minor hockey part of October. sure that I’m always prepared with enough balls, followed. ferent than most years, program. tees, a towel, an extra cleat or three and some de- The kitchen in the people are thankful to get The canteen at the cent clubs, because I feel that if I’m going to at- Whitewood Community back to the ice for any arena, which is typically tempt to tame the monster known as golf, I’d best Centre will be operational form of winter recreation. open during games, must be armed and ready for the challenge, even if I’m this year but will obvi- The Grenfell Athletic remain closed, resulting willing to take it on far less than I used to. ously see a much lower Association (GAA) and in a significant decrease On the weekend, I decided to get a few swings intake of revenue until LET US municipal officials are in revenue for the organi- in and shamefully, it was the first time this season the Canadian Hockey As- preparing for the 2020- zation. To offset this loss that I was able to sneak away and see what I had sociation allows games to 21 hockey season. Like and to compensate for ad- take place. KNOW left in the tank, if anything at all. other sports programs ditional staff that must be As i dropped my driver headcover near the first Whitewood Minor and facilities, these plans hired to meet COVID-19 tee and pulled on my windbreaker to shield me Hockey moved to online are being affected by the sanitation rules, minor from a few drops of rain falling on a cool, Septem- registration for the 2020- Do you know something that COVID-19 pandemic. hockey registration fees ber Saturday, I could feel the tightness in the old 21 season. Registration The GAA typically op- were increased by $110 muscles and bones where there used to be strength was open, without pen- would makea great news story? erates the Grenfell Recre- per player this year. and some suppleness. alty until September 15. ational Park Arena from In spite of these chal- About an event... or a person... I took only a few practice swings, because at “Our projected numbers October 1 through the lenges, organizers are this stage of my life, I’m not prepared to miss a for this year (based on remainder of the winter optimistic about the up- or an organization. Let us know. good one and let it go uncounted or at the very last years registrations) season. They organize coming season. “All of least unadmired. were really good, look- public skate times and our Spitfire athletes, their My first tee shot jumped off the club face of my ing like we would have run hockey and CanSkate families, and the GAA, three wood and zoomed wide of the fairway, but a team in each age group programs for the commu- are anxious to get back still in play. from U7-U18,” Jenna nity. The partnership is onto the ice,” Kraushaar “Straight block right,” I said under my breath, Sparvier from the White- based on a Memorandum said. “Last season ended wood Minor Association Toll Free: 1-844-GNG-NEWS almost laughing to myself slightly. It’s tough to fol- Email: [email protected] of Understanding signed too early, and abruptly. low through when you don’t loosen up a lot and it’s told Grasslands News. by the GAA and the town, cool and you’ve put more than 55 birthdays in the but additional paperwork bank. It was pretty much what I expected. will be included this year. My next shot was a more lofted club and once “The GAA is required again, I made solid contact, but the ball veered to submit and have ap- right. I still had an up and down for par, but ended Automotive and Service proved, a COVID-19 up blowing that and taking a bogey. Transmission Prevention It’s a result with which I am able to survive and Plan to council prior to I’d go on to make three more bogeys and a double Directory beginning operations,” in the round. explained Andrea Nich- That’s six over par already, but thanks to one oll, Grenfell’s Director of birdie, where I could have almost holed out an ace, Swathers, Combines, Haybines: Cutting Parts Recreation and Culture. Sulberg Guards and imports made in Germany I ended the round at a respectable plus five for “It will be the responsi- nine holes. GUARDS - ALL MAKES *V Belts (A, B, C, D) all sizes bility of the GAA to ad- prices on request The cursing that would have gone on 30 years Macdon, IHC, Hesston, MF, here to and enforce all Versatile, Honeybee *Swather and Haybine ago if I’d made a similar score would have been Knives (sickles) COVID-19 regulations as PRICES: $10 - $23 legendary, but I understand that a lack of practice *Used Canvas *Roller Chains outlined by the Provincial *Baler Belting 4” - 14” for splicing No. 40, 50, 60, 80 Ervin Wolfe and dedication has made me more of a weekend *Kondex Bolts & Sections Re-Open Saskatchewan *New & Econ Batteries *Boss Oil hacker than I’ve ever been. - all makes Product Advisor Plan.” The GAA’s preven- We Also BUY Scrap Batteries prices from $15 - $22.50 Am I pleased to shoot a score so much higher [email protected] tion plan will be reviewed than I did in the days of my youth? Of course I Eric Sagan at the next town council Cell 306-533-5945 am not. I also understand that I’m not as young 306-728-2580 meeting. Mon-Fri 8:30 - 5:00 as I once was and my swing isn’t as powerful as 655 Broad Street, Regina, Sask In the meantime, the Hwy. #15 West, it was in days gone by. My putting is borderline Melville, SK GAA began accepting 1-800-667-9976 – taylorautogroup.ca brutal, something I blame on a lack of practice and registrations for its minor old eyes with progressive, corrective lenses in my hockey program on Au- eyeglasses. gust 19. An information OW TOWING SERVICES As the round went on, I hit some good shots, Wholesale Transmission and registration evening one great shot and several that were slightly above 24 Hour Service & Differential was held last week, and mediocre. Cell: 306-331-8833 all registrations are due Wholesale Prices At this point in my life, it’s more important to ,PSRUWV 'RPHVWLFV2YHUKDXOV)UHH5RDG7HVWV by September 30, since :UHFNPDVWHU&HUWLÀHG me to not embarrass myself on the links – I’d at All Makes & Models Rebuilt in Our Own Shop practices are expected to 6*,6WRUDJH&RPSRXQG the very least, want to look competent, and for the + Differential +CVA Joints + Clutches + start by mid-October. )UHH8QZDQWHG&DU5HPRYDO most part, I was. /RFNRXWVERRVWLQJDQGZLQFKLQJ + Universal Joints + Drive Shafts + 4X4 Transfer Cases + In a letter issued It was the first round in a number of years with registration forms, ´7KH3ULFH:H4XRWH··LVWKH3ULFH Despite the 26th consecutive year without a Cana- ers such as David Hearn, Michael Gligic and Roger No. 1 target, DeAndre Hopkins, left town for the NFL dian franchise winning the Stanley Cup, and despite Sloan have full- or part-time Tour status, too. Brooke equivalent of some off-brand soup.” the Canadian Football League going dark for the 2020 Henderson came within a whisker of winning the LP- • Comedy guy Steve Burgess of Vancouver, on Twit- season — thanks a lot, coronavirus — the state of GA’s first major, the ANA Inspiration, but she lost in ter after No. 1 seed Novak Djokovic was disqualified sports in Canada is pretty darn good. a playoff. from the U.S. Open after a ball he smashed in anger Three Canadian men made the round of 16 at the And then there’s Canada’s baseball sweethearts, the injured a line judge: “Bah! John McEnroe once beat U.S. Open tennis championship in New York, con- Blue Jays, who are young, filled with potential and an umpire to death with a piano leg and was assessed firming the developmental efforts put forth by Tennis on the verge of qualifying for this season’s playoffs, a double fault.” Canada are bearing fruit. Denis Shapovalov, Vasek which have been ex- • Baseball writer Mark Bowman on Twitter during Pospisil and Felix Auger-Aliassime were the Canucks panded and modified the Braves’ 29-9 demolition of Miami Marlins Sept.9: making noise at the Flushing Meadows Tennis Cen- beyond recognition Sports Column “Braves lead 29-9 in the seventh. This seems safer tre, and they’re all young and on the verge of better due to COVID-19. By Bruce Penton than 28-3 in the fourth.” things. Don’t forget, too, that Bianca Andreescu was Even without star • NOT SPORTS CENTRE, on Twitter: “BREAKING: the defending U.S. Open women’s champ and unable slugger Bo Bichette Texans fans have opted out of the 2020 season, citing to defend her title due to injury. While the Open was for a good portion safety concerns of what watching Bill O’Brien coach in progress, Eugenie Bouchard of Montreal lost in the of the 2020 season, for 15 more games might do to their physical and men- final of the Istanbul Cup, a World Tennis Association the Blue Jays (2020 tal health.” event. home base: Buffalo) • Comedy writer Brad Dickson of Omaha, on the eve In basketball, the entire country was on the Rap- are a solid second in of the NFL’s first game: “The 2020 NFL season kicks off the A.L. East and are tors bandwagon as they strived for two NBA titles in tonight. I’m really looking forward to the next 12 days successive years. Their thrilling seven-game Eastern due to give Canadians until the 2020 NFL season ends.” Conference semi-final series with Boston Celtics cap- some exciting playoff • RJ Currie of sportsdeke.com: “The Raptors set a tivated Canadians, but they came up five points short. action. Slugger Teos- franchise record with 18 turnovers — 18! — in losing Canadians on the PGA Tour are no longer viewed car Hernandez, take a bow. You, too, pitcher Hyun Jin Game 7 to the Celtics. Much of the night they were as oddities. At last count, there were seven Canadian Ryu. Will Buffalo get the parade if the Jays shock the bum Raps.” regulars on the Tour. One of them, Mackenzie Hughes, world and win the World Series? qualified for the 2020 Tour Championship — the top So while the overall situation in Canada is glum • Currie again: “Sorry Houston Texans: 20 points 30 in the Fed-Ex Cup standings earn the right to play — thanks to the virus, the economy and uncertainty wasn’t enough to beat the Chiefs on Thursday Night in this exclusive event — and wound up 14th, earn- about the future — Canadian athletes and Canadi- (in the NFL opener). And it wouldn’t have been enough ing $620,000. Next year, the Canadian contingent on an-based teams continue to provide entertainment and to beat the Atlanta Braves, who scored 29 the night the Tour will be increased by one as Ontario’s Taylor positivity to a nation in need of uplifting news. before.” Pendrith will have full status thanks to his great play • Patti Dawn Swansson, the River City Renegade, • At Fark.com: “Padres’ Eric Hosmer suffers frac- on the developmental Korn Ferry Tour. And while after Saskatchewan premier Scott Moe declared Sept. 6 tured finger. On the other hand, he’s fine.” Hughes, Adam Hadwin, Nick Taylor and Corey Con- to be Roughriders’ Day across the province and for ev- • Chris Carlin of 98.7 ESPN New York, on the ners all have PGA Tour victories to their credit, play- eryone to wear green and white: “A melonhead needs COVID face shield worn by Chiefs coach Andy Reid: urging to wear green and white like a priest needs a “It’s foggin’ up like teenagers makin’ out in a car. reminder to say prayers on Sunday.” Please, someone, get him a windshield wiper at half- • Jay Busbee of yahoo.com, on Houston Texans’ QB time.” Fort pickerball Deshaun Watson: “Watson can’t be thrilled that his Care to comment? Email [email protected] court repaired By Alan Hustak Grasslands News Jacob Kingston and Jonatan Ens have been at work this week installing a new fence around the Pickle- ball court in Fort Qu’Appelle. The town has chipped in $3,500 towards about half the cost of the improvements. Club members volunteered to help dismantle the old rusting fence. Pickleball is a mashup of tennis, badminton and ping pong. It was invented in 1965 and is said to be named for a dog named Pickle, that was owned by one of the people who wrote the rules. Serves are diago- nal and underhand, the ball needs to bounce on each side before a volley, and players are not allowed to hit when the are close to the net in an area called “the kitchen.” The first side to score 11 points by a mar- gin of at least two wins. In recent years the game’s popularity has soared, and during the pandemic has become a perfect pastime for enthusiasts who want to exercise and safe distance at the same time. There are an estimated 300,000 “picklers” in Can- ada, making it one of the country’s fastest growing sports. The club in the Fort has about 50 due-paying members, many of them cottagers who play on the weekends. The court was resurfaced two years ago. TOWN OF ITUNA FORM H [Section 66 of the Act] Notice of Call for Nominations (Municipal Elections) PUBLIC NOTICE is hereby given that nominations of candidates for the office(s) of: Mayor: Town of Ituna – Number to be Elected: 1 Councillor: Town of Ituna – Number to be Elected: 6 will be received by the undersigned on the 7th day of October, 2020, from 9:00 a.m. to 4:00 p.m. (Nomination Day) at the #7 – 1st Avenue NE (Municipal Office) Nomination packages may be obtained during regular office hours at: Town of Ituna Municipal Office #7 – 1st Avenue NE Ituna, Saskatchewan Nominations Forms must be accompanied by a signed Public Disclosure Statement and a Criminal Record Check (Bylaw 01-2012). Dated this 14th day of September, 2020. Crystal Campbell Returning Officer www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 17 Grasslands Lifestyle changes to help you through cold and flu season 1& )DOOXVXDOO\EULQJVWKHH[FLWHPHQW DQGYHJHWDEOHVLVEHQHILFLDOIRUVRPDQ\ RIDQHZURXWLQHQHZVFKRRO\HDUH[WUD- UHDVRQVEXWGLG\RXNQRZWKDWWKHLUDQWL- FXUULFXODUDFWLYLWLHVDQGWKHFRROZHDWKHU R[LGDQWVDUHYHU\LPSRUWDQWIRURXULPPXQH ZH·UHDOOOLNHO\FUDYLQJDIWHUVXPPHUKHDW V\VWHPDVZHOO"9LWDPLQ&LVMXVWRQH ZDYHV:KLOHWKLQJVPD\ORRNDOLWWOHGLI- DQWLR[LGDQWWKDWKDVDSURWHFWLYHHIIHFW6R IHUHQWWKLV\HDUDVZHVHWWOHLQWRRXUQHZ VWRFNXSRQQXWULWLRXVIDYRXULWHVOLNHUHG QRUPDOWKHGUHDGHGFROGDQGIOXVHDVRQ EHOOSHSSHUVEURFFROLVSLQDFKJDUOLFNLZL ZLOOEHXSRQXVEHIRUHZHNQRZLW DQGFLWUXVIUXLWV VWUHQJWKHQRXULPPXQHV\VWHP"/RRNIRU WRPDQDJHVWUHVV5HVWJLYHVRXUERGLHV 0DNLQJDIHZVPDOOOLIHVW\OHFKDQJHV 'RQ·WIRUJHW\RXUSURWHLQV0DQ\ \RJXUWDQGNHILUZLWKDGGHGSURELRWLFVWR WKHFKDQFHWRUHFXSHUDWHDQGILJKWRII OLNHDGGLQJSOHQW\RILPPXQHERRVWLQJ FRPPRQIRRGVRXUFHVRISURWHLQOLNHILVK PDNHVXUH\RXKDYHDVWURQJSRSXODWLRQRI SRWHQWLDOLQYDGHUV IRRGVFDQJRDORQJZD\LQKHOSLQJXVVWD\ EHHIR\VWHUVHJJVEHDQVQXWVDQGVHHGV IULHQGO\EDFWHULDLQ\RXUJXW:HFDQDOVR 5. Get your flu shot.5HJDUGOHVVRIRXU JHWSURELRWLFVIURPVXSSOHPHQWV,WLVEHVW DKHDGRIWKHIOX7KHVHVLPSOHVWHSVIURP DUHDOVRULFKLQ]LQF%RWKSURWHLQDQG]LQF IRRGDQGOLIHVW\OHFKRLFHVJHWWLQJWKHIOX -DFNO\Q9LOOHQHXYHUHJLVWHUHGGLHWLWLDQFDQ DUHLPSRUWDQWQXWULHQWVIRURXULPPXQH WRWDONWR\RXUGRFWRURUSKDUPDFLVWLI\RX VKRWLVVRPHWKLQJZHVKRXOGDOOEHGRLQJ KHOSXVUHGXFHRXUFKDQFHVRIJHWWLQJWKH KHDOWK$LPWRLQFOXGHDVRXUFHRISURWHLQ DUHFRQVLGHULQJWDNLQJDVXSSOHPHQW IOXDQGVSUHDGLQJLWWRRWKHUV DWHDFKPHDODQGVQDFN 4. Remember to rest.1RIRRGVFDQDFW HDFK\HDU7KHPRUHSHRSOHZKRJHWWKH 1. Fill up half your plate with pro- 3. Welcome probiotics. 'LG\RX DVDVXEVWLWXWHIRUJHWWLQJDJRRGQLJKW·V IOXVKRWWKHOHVVOLNHO\WKHIOXLVWREHZLGH- duce. :HNQRZWKDWHDWLQJSOHQW\RIIUXLWV NQRZWKDWSURELRWLFVLQ foRGFDQKHOSXV VOHHSDQGPDNLQJVXUH\RX·UHILQGLQJZD\V VSUHDGDQGDIIHFWWKHPRVWYXOQHUDEOH 3 powerful, low-cost ways to update your space 1& *LYLQJ\RXUKRPHDPDNHRYHU NLWFKHQµ GRHVQ·WKDYHWREUHDNWKHEDQN)URPWDFN- 'RQ·WUHSODFHUHSDLQW,QVWHDGRI OLQJZHHNHQG',<SURMHFWVWRWUDQVIRUPLQJ UHSODFLQJZRRGHQIXUQLWXUHFRQVLGHU WKHIXUQLWXUH\RXDOUHDG\RZQWKHUHDUH UHSDLQWLQJLWWRJLYH\RXUKRPHDUHYDPS PDQ\ZD\VWRPDNHELJFKDQJHVRQD )URPZRRGHQFKDLUVWRFRIIHHWDEOHVDQG VPDOOEXGJHW+HUH6KDURQ*UHFKD GUHVVHUV\RXFDQHDVLO\XSGDWHIXUQLWXUH FRORXUDQGGHVLJQH[SHUWVKDUHVKHUWRS \RXUVHOIWRJLYHLWDIUHVKQHZORRN´3DLQW WKUHHWLSVIRUUHIUHVKLQJ\RXUKRPHRQD LVDOVRDQH[FHOOHQWFKRLFHIRUSDLQWLQJ EXGJHW IXUQLWXUH$OZD\VPDNHVXUHWRVDQGFOHDQ Beautiful DIY kitchen upgrades. DQGWKRURXJKO\SUHSDUHDQ\VXUIDFHEHIRUH 7UDQVIRUP\RXUNLWFKHQZLWKRXWWKHFRVWRI SDLQWLQJWRHQVXUHEHDXWLIXOUHVXOWVµVD\V DIXOOUHQRYDWLRQE\UHSDLQWLQJNLWFKHQFDEL- QHWV´ 1& :LWKFRROHUHYHQLQJVDQGIDOOLQJ XVHDQGZKDW\RXGRQ·WJURXSLQJLWHPV 6KRS\RXUOLVWDQGDYRLGLPSXOVHSXUFKDV- VWRFNHGLQWKHLUSDQWU\ OHDYHVDURXQGWKHFRUQHUZHFDQORRNIRU- WRJHWKHULQGLIIHUHQWFDWHJRULHV7KHQ HVVR\RXVWD\RUJDQL]HGDQGRQEXGJHW 4. Freeze frame)UR]HQIUXLWVDQG ZDUGWRVHDVRQDOFRPIRUWVOLNHJHWWLQJFR]\ SXUJHZKDW\RXGRQ·WXVHDQGGRQDWHLWWR 3. Stock up on value.3DQWU\LWHPV YHJHWDEOHVDUHDPXVWLQ\RXUIUHH]HU E\WKHILUHDQGFRRNLQJZDUPDQGKHDUW\ \RXUORFDOIRRGEDQN KDYHDORQJVKHOIOLIHVRZKHQDNH\VWD- SDQWU\$GGFRORXUDQGQXWULWLRQWRPHDOV PHDOV$QGDIWHUPRQWKVVSHQWRXWGRRUV 2. Review recipes and make your list. SOHWKDW\RXXVHJRHVRQVDOHLW·VDJRRG LQDIODVK7KLQNIUR]HQIUXLWIRUPRUQLQJ QRZ·VWKHSHUIHFWWLPHWRUHYLVLWDQGRUJD- )OLSWKURXJKFRRNERRNVDQGZULWHGRZQ LGHDWRVWRFNXS2OLYHRLOVSLFHVDQG VPRRWKLHV\RJXUWERZOVRUIUXLWILOOHGPXI- QL]HWKHNLWFKHQVWDUWLQJZLWK\RXUSDQWU\ SDQWU\VWDSOHVIURP\RXUIDYRXULWHUHFLSHV SDVWDVDXFHVDUHJRRGLWHPVWRSXUFKDVH ILQV)UR]HQYHJHWDEOHVFDQDOVREHHDVLO\ 'RQ·WNQRZZKHUHWRVWDUW"7KHVH %HDQVSDVWDRLOVVSLFHVFDQQHGYHJH- RQVDOH,W·VDOVRDWLPHWRWXUQWRDEUDQG DGGHGWRVKHHWSDQGLQQHUVVWLUIULHV VLPSOHWLSVZLOOKHOS\RXVDYHPRQH\DQG WDEOHVDQGOHJXPHVDUHDOONH\LQJUHGLHQWV OLNH1R1DPHRIIHULQJTXDOLW\SURGXFWV VRXSVSRWSLHVRUSDVWDGLVKHV2UZKLS VWUHVVLQWKHNLWFKHQ WRPDNHHDV\ZHHNGD\PHDOV:DQWWRWU\ DWDJUHDWYDOXH%DNLQJH[SHUWVORYH XSDTXLFNYHJJLHVLGHGLVK²MXVWKHDW 1. Organize what you have.6WDUWE\ VRPHWKLQJQHZEXWDOZD\VPLVVLQJWKDW WKHEUDQG·VFRFRDSRZGHU²LW·VRQHRI DGGEXWWHUDQGVHDVRQZLWKGULHGVSLFHVRU OLVWLQJZKDW\RXKDYHLGHQWLI\LQJZKDW\RX FHUWDLQVSLFH"$GGLWWR\RXUJURFHU\OLVW PDQ\EDNLQJLQJUHGLHQWV\RX·OOILQGDOZD\V KHUEV Kim Wieme Massage Therapy PERSONAL CARE HOME 306-736-3374 Phone / Text Wellness, Beauty and Holistic Melville, SK Private bedrooms/bathrooms for RMT - Recognized by Health Insurance Companies Singles and Couples. • Specializing in Th erapeutic Massage Corinne Pauliuk - Owner/Operator Directory • Muscle Fascia Cupping 306.699.2548 • Th ai Yoga Massage website: carehomes.ca/homes/sunrise-country-haven/ • Th ai Hand and Foot Refl exology • Rapid Adhesion Release Technique Located on acreage between McLean & Qu’Appelle For all your denture needs: Yorkton Hearing Services Simply Divine #18 First Avenue North, Yorkton, Sask. S3N 1J4 Your ears deserve an audiologist! Tru-Fit Denture Clinic LizelleLizelle - HairstylistHHairstylist • Hearing Tests • Hearing Aids 306-730-5748 • Repairs • Batteries 2130B Broad Street, Regina, Saskatchewan S4P 1Y5 540-8th Ave. West, • Custom Molds Melville, SK Phone: 306-782-1793 306-352-2552 www.yorktonhearing.com Jacquie Mvula CALL COLLECT M.S., R. Aud. “Doing a smiling business for over a decade and a half” 18 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News WEEK OF SEPTEMBER 20 TO 26, 2020 THE LUCKIEST SIGNS THIS WEEK: ARIES, AQUARIUS AND PISCES ARIES You have an insatiable thirst for knowledge, and you’ll consider taking a trip. Some unexpected Copyright © 2018, Penny Press cash will allow you or your family PUZZLE NO. 042 to organize a large-scale project. CROSSWORDS TAURUS ACROSS 41. Scalding 10. Silver or glass You’ll receive great news about 42. Beast’s neck gear follower funding to make one of your 43. Ran dreams a reality. If you want to 1. Type of bran 11. Do in, as a dragon be successful, take every oppor- 4. Tent site 48. Journey 16. Horse’s neck hair tunity to learn. You’ll benefit from 8. Chops 49. 1981 Warren Beatty 20. Berserk paying attention to the details. 12. Beer’s cousin film 21. Farmer’s produce 50. Fierce anger 13. Impostor 22. Fishing cord GEMINI 14. Egg shape 51. Female chickens 23. Copier Many people are relying on you. 15. Long-legged bird 52. BLT spread Some might also be waiting on a 17. Italian money unit, 53. Fresh 24. Young ladies decision that you’re struggling to 26. Dais make. Try to gather as much in- once formation as possible beforehand 18. Unwanted picnic 27. Voice range to avoid disappointing anyone. guest 28. Run into 19. Hollow between 29. Goals CANCER hills DOWN 31. Coal or gas If you’re swamped at work, your 21. Resound 34. Snoozes health might become compro- 24. Silent actor 1. Clumsy person mised. Remember, the more you 35. Small amount push yourself now, the more 25. Fully developed 2. Each and every 37. Trunk rest you’ll need later. Your well- 26. Scenic view 3. Iced brew 38. Fable 30. Unity being must be a top priority. 4. Hold fast 39. Olden times 31. Movie 5. “____ LEO 32. Island necklace 40. Covering You’ll be applauded for achie- 33. Urge Misbehavin’ “ 41. Actress Lamarr ving an impressive feat. You’ll also 35. Thing 6. Periodical, for short 44. Pod inhabitant receive an award or other form 36. Says yes to 7. Nova Scotia, e.g. 45. Metal container of recognition, which will help 8. Shout restore your confidence and self- 37. Honks 46. Before, in a poem esteem. 38. Me 9. Rotten 47. Moisture VIRGO You’ll find yourself seeking the comfort of your home this week. Take the opportunity to rear- range the furniture and clear the cobwebs from your house and mind. LIBRA You won’t hesitate to express yourself this week, and you’ll manage to lighten the mood in a tense situation. Your comical side will help you build relation- ships and foster collaboration. SCORPIO You might be faced with a large expense that requires you to reassess your budget. However, you’ll also realize you can afford to buy the house or plan the va- cation that you want. SAGITTARIUS There’s plenty of action to come. Friends will invite you to social and sporting events all winter, and you’ll make a particular ef- fort to stay in shape this season. CAPRICORN There’s a lot of confusion in the air, especially at work. An exci- ting family getaway will leave you feeling rejuvenated despite some complications while orga- nizing it. AQUARIUS FAVORITES If you’re struggling with chronic Blackberry Streusel Tart fatigue, you’ll benefit consider- Submit your favorite recipe to [email protected] ably from a gradual transforma- tion of your lifestyle. You might also decide to partake in activi- A summer barbecue or picnic just wouldn’t be the same without the perfect dessert. While a slice of pie with ice cream on top ties of a more spiritual nature. -9!(!2(!=38-;'T!(8<-;;!8;$!2#'!>'£$31'$,!2+'T'96'$-!££@>,'2-;Z9#<89ধ2+>-;,/<-$@T&'£-$-3<9#'88-'9W PISCES You’re in a great position to get INGREDIENTS promoted at work, and financial DIRECTIONS: Serves 6 to 8 success is on the horizon. Your investments will show good re- Make the crust: In a small bowl, whisk together the egg and 2 tablespoons of the cream. f6-2;9#£!$0#'88-'9l!#3<;$<69m turns despite the economic situa- 31#-2';,'*3<8T9<+!8!2&9!£;-2;,'#3>£3(!9;!2&1-?'8)ħ'&>-;,;,'6!&&£'!ħ!$,1'2;!2&1-? $<6+8!2<£!;'&9<+!8 tion. The stars are on your side. 32£3>96''&<2ধ£$31#-2'&W$!ħ'8;,'#<ħ'86-'$'93='8;,';36!2&1-?32£3>96''&<2ধ£;,' ;!#£'96332$3829;!8$,38;!6-3$!*3<8 #<ħ'8-9;,'9-A'3(91!££6'!9W ;'!96332(8'9,£@97<''A'&£'132/<-$' &&;,''++f!2&f$8'!11-?;<8'!2&1-?32£3>96''&(38!#3<;9'$32&9W;36;,'1-?'8!2&+'2;£@ 68'#!0'&;!8;$8<9;l9''#'£3>m 97<''A'!91!££!13<2;3(;,'&3<+,-2@3<8,!2&W (;,'&3<+,$31'9;3+';,'8!2&&3'923;,!='!2@ Streusel &8@6-'$'9-;,!9'23<+,13-9;<8'W (;,'&3<+,-9&8@T!&&!23;,'8;!#£'963323($8'!1W-?!2&;'9; !+!-2<2ধ£;,'&3<+,!£139;$31'9;3+';,'8-2!#!££W $<6!££f6<8639'*3<8 $<6)81£@6!$0'S>29<+!8 -2';,';!8;6!2>-;,6!8$,1'2;6!6'8!2&;,'26£!$';,'&3<+,32;36W8','!;;,'3='2;3 W!0' -2$,3(039,'89!£; <2ধ£;,''&+'93(;,'$8<9;!8'+3£&'2#83>2T!#3<; 3<2$'9l¤;!#£'963329m$3£&<29!£;'& 1-2<;'9W'13='!2&$33£W #<ħ'8T$<;-2;3f-2$,6-'$'9 2!#3>£T+'2;£@$31#-2';,'#£!$0#'88-'9T9<+!8T $3829;!8$,T!2&£'132/<-$'W68'!&;,'#£!$0#'88@ Tart crust 1-?;<8''='2£@-2;,';!8;$8<9;W £!8+''++ To make the streusel: In a food processor, combine the ;3;!#£'963329,'!=@>,-66-2+$8'!1 *3<8T#83>29<+!8T9!£;T!2&#<ħ'8!2&6<£9'<2ধ£;,' f$<69!££f6<8639'*3<8 #<ħ'8-9;,'9-A'3(£!8+'6'!9W68-20£'3='8;,' ;!#£'963329+8!2<£!;'&9<+!8 #£!$0#'88@)££-2+W ;'!96332039,'89!£; !0'!; <2ধ£;,'9;8'<9'£-9#83>2'&!2&;,'(8<-; 3<2$'9l;!#£'963329m$3£&<29!£;'& -9#<##£-2+T!#3<;1-2<;'9W';;,';!8;$33£<2ধ£-; #<ħ'8T$<;-2;3f-2$,6-'$'9 $!2#',!2&£'&T;,'28'13=';,';!8;!2&6£!$'32! £3<8(38&<9ধ2+ 6£!ħ'8W'8='>!8138!;8331;'16'8!;<8'W www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 19 Neighbourly Advice - Ray Maher Ed, my old neighbor there is a list of the top For Solomon’s faith Christians that because in Saskatchewan, said 10 of the smartest people in God, it wasn’t in his of God’s mercy, we are WHITEWOOD AND AREA yesterday that continu- today. The top spot goes best interest to take for- to continue to be trans- KNOX ST. JOSEPH’S ROMAN ing to be a farmer shows to Australian, Terence eign wives who wor- formed by the renewing PRESBYTERIAN CHURCH CATHOLIC CHURCH 6HUYLFHV DP 6HSWHPEHU6XQGD\0DVV that he is not too smart. I Tao, a mathematician. shiped other gods. No one of our minds in God’s 5HY6HRQ2N/HH asked him if the pressure Personally, it is wise for should forget that human word for as long as we DP of his harvest was getting me to use a calculator. relationships can grow live. NEW LIFE ST. JOHN’S LUTHERAN to him. Ed admitted that The second person on cold and end. Likewise, We are to, “Hate what COMMUNITY CHURCH CHURCH, WAPELLA his optimism and eager- the list is Marilyn Van our love for God can get is evil. Honor others above :RUVKLS6HUYLFHa DP &KXUFK6HUYLFHV&$1&(//(' :HGa.LGV&OXEa SP XQWLOIXUWKHUQRWLFH ness for his farm have Savant, who has an IQ distracted, cold and mis- ourselves. Be joyful in +HOGDW1HZ/LIH&KXUFK ST. MARY’S dried up like the creek in of 228. I like the saying placed on ourselves or hope, patient in affliction, $JHV ANGLICAN CHURCH a summer drought. that it is good to be smart others. faithful in prayer. Unwill- )ULa Melville Anglican Lutheran Ecumenical %(7+$1<(9$1*(/,&$/ /RFDWHGDWWK$YH:DQG0DLQ6W0HOYLOOH6. Denton Keating Community - MALEC 0,66,21$5<&+85&+ 210 Claude Street * * * WK$YH: 4XHHQ6W²&KXUFK2IÀFH3K ´7UHDWLQJ *22'6+(3+(5'/87+(5$1&+85&+ ),56781,7('&+85&+ WK$YH:²3K Matthews Funeral Home WK$YH( .LQJ6W 3DVWRU'RXJ6FKPLUOHU 2IÀFH+RXUV IDFHERRNFRPJVOFPHOYLOOH Melville’s only locally-owned funeral home. 0RQ7XHV7KXUV DPQRRQ 3K Sunday Services: DP,QSHUVRQDQGRQOLQHVHUYLFHV %UDQFKRI¿FHLQ:KLWHZRRG 5HY%ULDQ0HH3K %XULDODQGFUHPDWLRQVHUYLFHVJULHIVXSSRUW ZHEVLWH ÀUVWXQLWHGPHOYLOOHRUJ 67*(25*(·68.5$,1,$1 FHPHWHU\PHPRULDOVQRWDU\SXEOLF :HKDYHUHWXUQHGWRUHJXODURIÀFHKRXUVDQG &$7+2/,&&+85&+ FKXUFKUHRSHQLQJZLWK&29,' SURWRFDOVLQSODFH &RUQHURIUG$YH( 0DQLWRED6W 0HOYLOOH²:KLWHZRRG )U%DVLO0DORZDQ\ Sept. 20: DP:RUVKLS6HUYLFHZLWK5HY%ULDQ0HH EDVLOPDORZDQ\#JPDLOFRP² Sept. 27: Mark and Gaylene Matthews and staff DP:RUVKLS6HUYLFHZLWK5D\ Joseph Roger Nowlan Julia Helen Robinson Garage Sale Province Wide Obituary May 16, 1933 – Sept. 4, 2020 Obituary March 1, 1916 – Sept. 5, 2020 *$5$*( 6$/( ²)ULGD\ 6HSW 1257+ ($67 35$,5,( *5$,1 Roger died peacefully on Julia was born on a farm SP DQG 6DWXUGD\ 6HSW ,1& %8<,1* )((' %$5/(< DP SP 0DLQ 6WUHHW 62<%($16 '$0$*(' &$12/$ Friday, Sept. 4, 2020 at the age near Ituna, Sask., to the late 0HOYLOOH S 2Q )DUP 3LFNXS 3URPSW 3D\PHQW of 87, in Central Haven Care Piotr Grzebinski and Ksenia 3+ :(%6,7( Home, Saskatoon, with family (Klimczak). She attended St. QHSUDLULHJUDLQFRP ´,Q %XVLQHVV WR members by his side. He lived Joseph’s School to Grade 8. For Rent 6HUYH:HVWHUQ3URGXFHUVµ his life with humour, passion, In 1946 Julia married Er- ,1'(3(1'(17 $'8/7 /,9,1* and dedication to his family. His nie Robinson; they lived and )25 5(17 ² DQG EHGURRP DSDUWPHQWV LQ 0DUWHQVYLOOH 6. wife of over 65 years, Marie, farmed near Ituna until 1959, DSDUWPHQWV LQ 6TXLUH·V &RXUW 6SHQG \RXU UHWLUHPHQW \HDUV LQ D had visited him that morning. then moved to Melville. 0HOYLOOH$SSOLDQFHVLQFOXGHG3KRQH FRPPXQLW\FORVHWRIDPLO\IULHQGVLQ Roger loved baseball and RU WKH 6DVNDWRRQ DUHD WKDW KDV ODUJH Julia was predeceased by WIS FLW\ VHUYLFHV ZLWK VPDOO WRZQ VDIHW\ hockey, and having children DQG FKDUP 0RUH LQIR # ZZZFKD her husband, Ernie, in 1985; $%(51(7+< +286,1* $XWKRULW\ involved in the sports was the WHDXYLOODFD KWWS ZZZFKDWHDXYLOOD daughter-in-law Christa Rob- KDV WZR EHGURRP VHQLRU VXLWHV only excuse he needed to get FD RU FKDWHDXYLOOD# inson; her parents; her sisters DQG D EHGURRP KRXVH DYDLODEOH VDVNWHOQHW involved. He coached his sons and their spouses, Lucy (Steve) IRU UHQW )RU PRUH LQIRUPDWLRQ FRQ at different times in both hockey and baseball. Marie and Rog- Szarkowicz, Mary (John) WDFW $QQH 0DULH 0RXOGLQJ KRXVLQJ /$1' )25 6$/( 50 er both became very involved in the Melville Minor Sports As- PDQDJHUDW GHHGHG DFUHV LQ :QG Klimczak, Frances (Carl) Batycki and Jean Grzebinski; her sociation and was the president for a time. In the evenings WIF DFUHV /HDVH DYDLODEOH WR TXDOLILHG brothers and their spouses, Stanley (Mary), Bernie( Hattie), SHUVRQV )HQFHG DQG FURVV IHQFHG during hockey season their children knew they could usually 68,7( $9$,/$%/( )RU 5HQW /RWV RI ZDWHU DQG JUDVV $OO LQ RQH Peter, John (Nellie) and Edward; siblings in infancy Joseph, LQ 0HOYLOOH EHGURRPV SULYDWH ¿QG WKHLU SDUHQWV DW WKH ULQN DW D KRFNH\ JDPH RU SUDFWLFH EORFN,QTXLULHV2IIHUVWR%R[%LJ Anna and Walter; mother- and father-in-law William and Clara HQWUDQFH ,QFOXGHV IULGJH VWRYH often working in the concession. %HDYHU6.6+* Roger was known for his bilingual announcing from the Robinson; and brothers-in-law and sisters-in-law Edward ZDVKHUDQGGU\HU8WLOLWLHVLQFOXGHG penalty box at many hockey games, giving spectators and (Florence), William (Sadie), Thomas (Olga), James (Eileen), )UHH :L)L VDWHOOLWH RSWLRQDO 1R 612:%,5'6 2VR\RRV %& ² Elsie Ivey (George) and Isobel Martin (Jack). VPRNLQJ QR SHWV RU &DQDGD·V ZDUPHVW FOLPDWH 9HU\ players the impression that they were at an NHL game. Roger WIF VSHFLDO ZHHNO\ DQG PRQWKO\ UDWHV became a baseball umpire and was recognized for his high Julia will be lovingly remembered by her six children: DYDLODEOH WKURXJK $SULO standards, sense of fair play and sportsmanship. He served on daughter Elaine (Garry) Loehr and family, Jeff (Lianne) and &KRRVH IURP VWXGLR DQG EGUP the Saskatchewan Baseball Association as an umpire mentor family Karissa, Madison and Brooklyn and Jana Kinar (Chris) Farmland OX[XU\FRQGRVIURPQLJKWZZZ for the region, impacting many young adults positively. and family Jordan and Easton; daughter Jean (Irving) Soos RVR\RRVVQRZELUGVFRP Combining the love of baseball and hockey with his love and family, Cathy Englot (Mark) and family Greg, Michael and of driving, he also drove the bus for Minor Sports teams, both Julie, Chris (Jen) and family Liam and Kayla, Teri (Matt Par- FARMLAND $'9(57,6(0(176 DQG VWDWH baseball and hockey, driving them throughout the province lakian) and family Zoe and Charlotte, and Jason (Erin) and PHQWVFRQWDLQHGKHUHLQDUHWKHVROH UHVSRQVLELOLW\RIWKHSHUVRQVRUHQWL for games and tournaments. He thoroughly enjoyed spending family Cole and Haley; Linda (Lyle) Custer and family, Laurie WLHV WKDW SRVW WKH DGYHUWLVHPHQW time with the players, their parents and the coaches, occasion- Jean and Steven; son Richard Robinson and family, Virgin- FOR SALE DQG WKH 6DVNDWFKHZDQ :HHNO\ ally taking some of his family along. ia Ostrye (Steven) and son Thomas, and Elizabeth Robinson NE 32-23-6 W2 1HZVSDSHU $VVRFLDWLRQ DQG PHP Even as Roger passed gently from this world, his sense of (Kent); daughter Val (Frank) Zimmer and family, Krista Inkster EHUVKLS GR QRW PDNH DQ\ ZDUUDQW\ humour prevailed while he visited quietly with family. Roger is (Darcy) and family Austin (Brandi), Jacalyn and her son Cam- in the RM of Cana #214 DV WR WKH DFFXUDF\ FRPSOHWHQHVV WUXWKIXOQHVV RU UHOLDELOLW\ RI VXFK survived by: his wife Marie; children, Diane (Terry), Judy (Lee), eron, Michael Zimmer and son Brandon and Sheena Lacroix PLOHVQRUWKRI0HOYLOOH DGYHUWLVHPHQWV )RU JUHDWHU LQIRU Doug (Christine), Gail (Lachlan) McLeod, Patrick (Nicole), Ron (Phil) and family Ethan and Caelan; son Ken Robinson (Shan- PDWLRQ RQ DGYHUWLVLQJ FRQGLWLRQV (Nataghia), Gary and Sharon; grandchildren, Giselle (Shaun), da) and family, Graham Robinson, Jennifer Robinson, Brooke FORVHWR+Z\ SOHDVH FRQVXOW WKH $VVRFLDWLRQ·V Monique, Ariana (Foster), Jared, Owen and Benjamin; sister, (Matt Morgan) and family Sawyer, Emerson and Archer, and %ODQNHW $GYHUWLVLQJ &RQGLWLRQV RQ Dorilla (Dolly); and brother, Peter (Betty). Brogan Magill; sister-in-law Leona Grzebinski, and numerous 306-728-3732 RXUZHEVLWHDWZZZVZQDFRP He was predeceased by his parents, Joseph and Barbara; nephews, nieces and friends. Bert1HXEDXHUHYHQLQJV his siblings, Victoria, Bernice, Yvan, Yolia, Frank, Clarence, Julia was a loving wife, mother, grandmother, sister and and Bob. friend. Raising and caring for her family kept her busy, but in Obituary The family would like to thank everyone at Central Haven her spare time, she loved knitting and crocheting, rock paint- Business Opportunity for their compassionate care and kindness. Condolences may ing, doing puzzles of any kind and, at age 103, could still skunk Deadline be left at www.saskatoonfuneralhome.com. Arrangements en- us at crib! Always curious and caring about her family and trusted to Saskatoon Funeral Home (306) 244-5577. )5(( $70 IRU \RXU EXVLQHVV *DV friends, Julia kept up on our news with visits by phone, mail VWDWLRQV FRQYHQLHQFH VWRUHV HWF Tuesdays 12 noon and her iPad. Thank you, Mom, for always being that special 0DNH PRQH\ IURP HDFK FXVWRP light in our lives. HU WUDQVDFWLRQ /RFDO &DVK /RDGLQJ $YDLODEOH &DOO 0LQW $70 1HWZRUN June Katherine Trueman A private service was held on Saturday, Sept. 12, 2020, WRGD\ Obituary March 7, 1929 – Sept. 8, 2020 from Matthews Funeral Home, Melville, SK, with the Rev. Fr. $QGU]HM 6RZD 20, RI¿FLDWLQJ ,QWHUPHQW IROORZHG DW WKH 6W It is with great sadness that Stanislaus Roman Catholic Cemetery, Ituna, SK. Acting as Personal we announce the passing of pallbearers were her grandsons and honorary pallbearers her June Katherine Trueman (nee granddaughters. '(&(170$1VHHNLQJDODG\FRP Arrangements were entrusted to Matthews Funeral Home, SDQLRQ EHWZHHQ DQG \HDUV Lane) on Tuesday, Sept. 8, RIDJHLQWKHDUHDVRI0RRVRPLQWR 2020. Melville *UHQIHOO DQG (VWHUKD]\ WR &DUO\OH She was predeceased by We love you Mom, Granny and GG . “Last Touch”. &DOO-RKQ S her parents, Elizabeth and Lew- is Lane; siblings, Phyllis Theis, Shirley McCowan and Al Lane. June is survived by her daugh- ters, Marjorie (Dan) Popescul DQG 'LDQH -RQ -DURV ¿YH grandchildren; six great-grand- children; two great-great-grand- children; and many nieces and nephews. Born in Melville, Sask., she Ronald Stanley Stuart moved to Regina in 1950. After raising her family, June lived Obituary May 22, 1948 – Sept. 6, 2020 life to the fullest. Cruises were taken to many countries with YELLOW HEAD her friends from Melville. She was a lifetime Lions member, an In loving memory of Ronald MODULAR HOME avid stamp collector, puzzle solver, cribbage player and musi- Stanley Stuart. Born in Melville, SALES cian. June’s love of music and the Saskatchewan Roughriders Sask. May 22, 1948 - passed brought her to join the Rider Pep Band which brought her the away in Burnaby, B.C. Sunday, opportunity to make friends nationwide for 25 Grey Cups. She Sept. 6, 2020 at age 72. was front and center for televised football or curling. June had Leaves behind son, Johon PUT YOUR MONEY Stock homes endless energy for volunteering whether it be at bingos, selling Stuart (Michelle) of Perth Aus- WHERE YOUR Ready for Delivery! hot dogs, ticket selling, collecting tabs or serving pizza. tralia; daughter, Jodaye Stuart HOUSE IS ,QOLHXRIÀRZHUVWKRVHZLVKLQJPD\PDNHPHPRULDOGRQD of Edmonton, Alta.; and daugh- HUGE Savings when you tions to June’s favorite charity, the Lions Foundation of Can- ter, Tera Millman (Patrick) of Advertise Local purchase a stock home ada Dog Guides, 152 Wilson St, Oakville, Ont. L6K 0G6 or Sherwood Park, Alta.; and shines a spotlight on ILO ordering a new build https://www.dogguides.com/. To leave an online message of ¿YH JUDQGFKLOGUHQ *DEULHOOH local businesses. 960 sq ft - 1672 sq ft home to choose from! condolence, please visit www.speersfuneralchapel.com Kaileb, Olivia, Isaac and Isa- Newspaper advertisers belle; sisters, Sharon Flatt, Gail can submit their WE do Site consultation, Jubenville and Pamela Stuart; business for free. Screw piles /Insulated and many nieces and nephews. Join the Local skirting PKG He will be loved and missed Advertiser List forever. and help keep your 306-496-7538 No service planned by request. community thriving. Yorkton, SK New sales lot in Visit Lloydminster, AB. advertiselocal.ca Call 780-872-2728 Subscribe online at grasslandsnews.ca – 306-728-5448 www.yellowheadmodularhomesales.ca CLASSIFIED RATES 1 week: $12.00 • 2 weeks: $18.00 • 3 weeks: $24.00 • 4 weeks: $28.00 1-844-GNG-NEWS (based on 25 words or less) Additional weeks: $2.50 • Deadline: Tuesdays at 12 noon Email: [email protected] www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 21 LOOK! Mainline Music Festival plans underway You just proved even small ads By Sarah Pacio ahead to hosting the pro- declined their refund, of- tancing guidelines. it becomes necessary. get noticed. Grasslands News gram in Wolseley next fering the registration fee May noted that most “We’re going to run it spring. as a donation to the non- categories at the festival either way, either virtu- 1-844-GNG-NEWS Valentina May recalled profit organization. have less than ten mu- ally or in-person,” May DGV#JUDVVODQGVQHZVFD “We just hit pause,” the “ups and downs” of “We have a pretty solid sicians, so adjudication said confidently. “(In-per- commented secretary the previous months and financial position going could still occur in-per- son) is our preference; it Penny Miles at the AGM expressed appreciation forward,” treasurer Tim son even if gathering just means extra clean- for Wolseley Mainline for volunteers who helped Taylor reported. “Un- limits were reduced to 15 ing and sanitizing, and I Music Festival on Sept. make arrangements for fortunately the way we people. think most of us are get- 9. Committee members the festival. “We started ended up generating that If an outbreak occurrs ting used to that now.” attended the meeting at organizing in August is because we didn’t have in one of the participating New Life Church in Wol- 2019 and everything was the expense of running a communities, musicians Integrity Post seley, or participated via all set to go as of March festival.” could submit recordings Frame Buildings Zoom, to review the past 13,” said May during the With current public for adjudication. The SINCE 2008 year and plan for the next president’s report. “Then health orders in mind, committee agreed to pro- Built with festival. March 16 we had to can- the committee resumed vide technical support if Concrete Posts The festival provides cel; that was a tough preparations for the festi- young musicians from thing to do.” val tentatively scheduled Barns, Shops, communities along Hwy. Facilities and accom- for April 18-22, 2021. They Riding Arenas, 1, from Indian Head to modations that had been acknowledged that flexi- Machine Sheds Whitewood, the oppor- booked were cancelled, bility and consideration and More tunity to undergo ex- and refunds were issued of alternative scenarios sales@ aminations by qualified to participants. would be important. Integritybuilt.com adjudicators and to per- There were also pos- They discussed options 1-866-974-7678 form publically during a itive outcomes from the for in-person and virtual final concert. unforeseen situation. programing, concluding www. Committees in Wolse- Several youth who had that individuals who reg- integritybuilt.com ley and Indian Head host prepared to attend the ister should be prepared the event on alternating festival submitted record- to participate in either years, and it was sched- ings of their in-home per- format. Heavy Duty Mechanics, WALK IN TUBS Heavy Equipment SASK uled to take place in Wol- formances, which were The hall typically used Operators and seley last March. Since shared on social media. for the festival is large 1A Drivers required: the COVID-19 pandemic The campaign for pa- enough for up to 60 peo- Late model, clean thwarted these plans, trons was also successful ple, while complying with CAT, JD equip: winch, organizers are looking and several musicians two-meter physical dis- dump, gravel trucks and trailers. Both camp and shop locations; R & B SAFETY, QUALITY & provided. COMFORT! Wage negotiable. Stay Independent and Clean drivers abstract safe, in your home. 1-800- a must. Send resume and Soothe the pain work references to: of arthritis and 222- Bryden Construction ÄIYVT`HSNPH^P[O )V_(YIVYÄLSK:R heated therapeutic jets. :,(" Fax: 306-769-8844 Walk in Tubs have never been so 7,36 ,THPS! brydenconstruct@ (ɈVYKHISL xplornet.ca *HSS Today! www. 1-306-536-7660 brydenconstruction TAX ENFORCEMENT LIST andtransport.ca ^^^^HSRPU[\IZZHZRJH Rural Municipality of Cana #214 Province of Saskatchewan 1RWLFH LV KHUHE\ JLYHQ XQGHU WKH Tax Enforcement Act WKDW XQOHVV WKH DUUHDUV DQG FRVWV DSSHDULQJRSSRVLWHWKHODQGDQGWLWOHQXPEHUGHVFULEHGLQWKHIROORZLQJOLVWDUHIXOO\SDLGEHIRUHWKH Contractors and Home 18th day of November, 2020,DQLQWHUHVWEDVHGRQDWD[OLHQZLOOEHUHJLVWHUHGDJDLQVWWKHODQG 127( $ VXP IRU DGYHUWLVLQJ FRVWV LQ DQ DPRXQW UHTXLUHG E\ VXEVHFWLRQ RI The Tax Enforcement ActLVLQFOXGHGLQWKHDPRXQWVKRZQDJDLQVWHDFKSDUFHO Directory DESCRIPTION OF PROPERTY 3DUW Lot Adver- 7RWDO of Lot %ON 3ODQ Meridian 7LWOH 7RWDO 1XPEHU $UUHDUV WLVLQJ $UUHDUV &RVWV &RVWV 3DUWRI 6HF 5DQJH Section 7S J&V ELECTRIC 6( 6 22 2 A NW 2 2 Jamie Sebastian 6( 17 2 SW 2 Owner/Journeyman 1( 28 2 TREE SERVICE Box 2388, Fort Qu’Appelle, SK S0G 1S0 NW 28 2 [email protected] 6( 28 2 306-331-8742 - 306-331-8732 3062I¿FH 'DWHGWKLVWKGD\RI6HSWHPEHU 306-331-8827 Cell .DOL7RXUQH\$GPLQLVWUDWRU Fort Qu’Appelle, SK www.whitingtreeservice.ca Serving Fort Qu’Appelle and area for over 25 years RURAL MUNICIPALITY OF SILVERWOOD NO. 123 NOTICE OF CALL FOR NOMINATIONS FlatLand Plumbing & Heating Public notice is hereby given that nominations of candidates for the 117 - 3rd Ave. West, Melville, SK offi ce(s) of: 306-728-5493 R REEVE: RM of Silverwood No. 123 ,'#8!2&9@3<023>W Whitewood, SK. ,'9'8=-$'@3<;8<9;W R Councillor: R.M. of Silverwood No. 123 Division No. 1 Phone: 306-735-4328 ,'=!£<'@3<&'9'8='W R Councillor: R.M. of Silverwood No. 123 Division No. 3 Mon., Tues., Wed. & Fri. 9:00 a.m. to 5:30 p.m. [email protected] Thurs. 9:00 a.m. to 6:00 p.m., Sat. 9:00 a.m. to 3:00 p.m. R Councillor: R.M. of Silverwood No. 123 Division No. 5 Will be received by the undersigned on the 7th day of October, 2020, from 9:00 a.m. to 4:00 p.m. at the RM of Silverwood Offi ce, and during regular business hours on September 18 to October 7, 2020 at the RM of Silverwood Offi ce. Whitewood, SK Nomination forms may be obtained at the following location: RM of Silverwood Offi ce Dated this 18th day of September, 2020. Jennalee Beutler Returning Offi cer 22 September 18, 2020 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV Grasslands News GET IT WEEKLY Subscribe for as little as $37.80 a year! New building for Dept. of Highways 1-844-GNG-NEWS – FRQWDFW#JUDVVODQGVQHZVFD By Emily Jane Fulford Form H (Section 66 of the Act) Grasslands News NOTICE OF CALL A new facility is being erected this fall in Melville for the Depart- FOR NOMINATIONS ment of Highways. The new build- Village of Grayson ing is being constructed on Hwy. 15 by N&R Concrete with a scheduled Public notice is hereby given that nominations of completion date set for the end of FDQGLGDWHVIRUWKHRIILFH V RI October or possibly early Novem- Mayor: Village of Grayson ber. Councillors: Village of Grayson The aim is for crews to be able 7ZR WREHHOHFWHG to get settled into the new facility Nominations will be received on the 7th day of before any major snowfalls begin The operations and maintenance vious facility to accommodate to- 2FWREHU IURP DP WR SP 1RPLQDWLRQ 'D\ RU for the season. The Department of facility will be used to store the day’s equipment.” FDQ EH HPDLOHG WR YLOODJHRIJUD\VRQ#VDVNWHOQHW RU Highways has had a home in the ministry’s heavy equipment such While it may be the case that PDLOHG WR 32 %R[ 9LOODJH RI *UD\VRQ 6. 6$ city for a number of decades and as plows, graders, sign trucks, back- only current staff from the previ- 1E0 or dropped off during regular office hours from it was high time for some much hoes, and other equipment. This ous facility will be occupying the 6HSWHPEHU XQWLO 1RPLQDWLRQ 'D\ 2FW needed upgrades to the property. equipment is required to perform new one, making that number of “The original facility, built in duties for all seasons including full time positions unchanged, the 1966, was over 50 years old and at summer and winter maintenance construction process has had a pos- Nomination Forms must be accompanied by a signed the end of its life cycle. The new to keep traffic moving safely. itive impact on the local economy 3XEOLF'LVFORVXUH6WDWHPHQWDQGD&ULPLQDO5HFRUGV building is located at the site of “The cost of the new building during a time when jobs were hard &KHFN DW WKH FDQGLGDWH¶V RZQ H[SHQVH DV RXWOLQHG the old facility because of its con- is about $1.75 million and is about to come by. LQ %\ODZ 1RPLQDWLRQ IRUPV FDQ EH REWDLQHG venience and cost effectiveness,” 8,400 sq. ft. which includes three The new building going up has E\FRQWDFWLQJ*UD\VRQ¶V9LOODJH2IILFHE\SKRQH said Steve Shaheen, Senior Com- bays, a wash bay, mechanical room resulted in a number of temporary RUHPDLO YLOODJHRIJUD\VRQ#VDVNWHOQHW munications Consultant for the and some limited office space for job opportunities for contractors 'DWHGWKLVWKGD\RI6HSWHPEHU Department of Highways and In- staff,” explains Shaheen. and tradespeople hired during the Colleen Stinson, Returning Officer frastructure. “It is a little larger than the pre- construction process. Village of Grayson Notice of Call for Nominations Form H (Section 66 of the Act) NOTICE OF CALL FOR NOMINATIONS (General Election) NOTICE OF CALL Town of Broadview Town of Balcarres FOR NOMINATIONS Municipal Election PUBLIC NOTICE is hereby given that Public notice is hereby given that nominations of QRPLQDWLRQVRIFDQGLGDWHVIRUWKHRI¿FH V RI Village of Waldron candidates for the office(s) of: Public notice is hereby given that nominations of MAYOR: IRUWKH7RZQRI%URDGYLHZ FDQGLGDWHVIRUWKHRIILFH V RI MAYOR: Town of Balcarres COUNCILLOR: IRUWKH7RZQRI%URDGYLHZ Mayor: Village of Waldron COUNCILLOR: Town of Balcarres 1XPEHUWREH(OHFWHG± Councillors: Village of Waldron Number to be elected: Six 7ZR WREHHOHFWHG will be received by the undersigned on the 7th day Will be received by the undersigned up to and RI2FWREHUIURP DPWR SP&67 Nominations will be received on the 7th day of including the 7th day of October, 2020 from 9:00 DW WKH 0XQLFLSDO$GPLQLVWUDWLRQ 2I¿FH 0DLQ 2FWREHUIURP DPWRSP 1RPLQDWLRQ'D\ RU a.m. to 4:00 p.m. at 209 Main Street (Balcarres 6WUHHW %URDGYLHZ 6DVNDWFKHZDQ DQG GXULQJ FDQEHPDLOHGWR32%R[9LOODJHRI:DOGURQ6. Town Office), and during regular business hours UHJXODUEXVLQHVVKRXUVRQWKGD\RI6HSWHPEHU 6$ . SULRU WR 2FWREHU IURP 6HSWHPEHU 15, 2020 until Nomination Day. from September 22nd, 2020 to October, 6th, to the 6th day of October, 2020, at the Municipal 2020 at 209 Main Street. $GPLQLVWUDWLRQ2I¿FH0DLQ6WUHHW%URDGYLHZ Nomination Forms must be accompanied by a signed 6DVNDWFKHZDQ 3XEOLF 'LVFORVXUH 6WDWHPHQW DQG D GHSRVLW Nomination forms may be obtained at the that will be returned after the election as outlined by following location: The Balcarres Town Office, 1RPLQDWLRQIRUPVPD\EHREWDLQHGDWWKHIROORZ %\ODZ1RPLQDWLRQIRUPVFDQEHREWDLQHGE\ 209 Main Street, Balcarres, Saskatchewan and; On LQJORFDWLRQ FRQWDFWLQJ WKH 9LOODJH RI :DOGURQ¶V 9LOODJH 2IILFH the Municipal website (www.townofbalcarres.ca) 0XQLFLSDO$GPLQLVWUDWLRQ2I¿FH 3KRQH RU HPDLO YLOODJHRIZDOGURQ# 0DLQ6WUHHW gmail.com Dated this 8th day of September, 2020 %URDGYLHZ6DVNDWFKHZDQ 'DWHGWKLVWKGD\RI6HSWHPEHU Victoria Folk Returning Officer 'DWHGWKLVWKGD\RI6HSWHPEHU Colleen Stinson, Mervin J. Schmidt, Returning Officer Village of Waldron 5HWXUQLQJ2I¿FHU RM of Silverwood No. 123 RM of Elcapo No. 154 NOTICE OF INTENTION TO ADOPT AN OFFICIAL COMMUNITY PLAN Box 129 – 731 Lalonde Street Notice of Call for Nominations Phone (306) 735-2210 (General Election) AND ZONING BYLAW 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWWKH&RXQFLORIWKH50RI6LO NOTICE FOR CALL PUBLIC NOTICE is hereby given that YHUZRRG1R WKH50 LQWHQGVWRFRQVLGHUWKHDGRSWLRQRI QRPLQDWLRQVRIFDQGLGDWHVIRUWKHRI¿FH V RI WKUHHE\ODZVXQGHUThe Planning and Development Act, 2007. FOR NOMINATIONS 7KH 50 ZLOO HVWDEOLVK D QHZ 2IÀFLDO &RPPXQLW\ 3ODQ D QHZ Reeve: Rural Municipality of Elcapo No.154 =RQLQJ%\ODZDQGDQHZIHHVE\ODZ 2020 MUNICIPAL ELECTION Councillor: Division No. 1 INTENT: 7KHSURSRVHG2IÀFLDO&RPPXQLW\3ODQE\ODZZLOOHV Rural Municipality of Elcapo No.154 WDEOLVKPXQLFLSDOODQGXVHSROLFLHVJRDOVDQGREMHFWLYHVIRUWKH l'$ধ32¤¤3(;,'$;m 507KHSURSRVHG=RQLQJ%\ODZZLOOLPSOHPHQWODQGXVHSROL Councillor: Division No. 3 FLHVHVWDEOLVK]RQLQJGLVWULFWVSUHVFULEHSHUPLWWHGDQGGLVFUH -9,'8'#@+-='2;,!;231-2!ধ329 Rural Municipality of Elcapo No.154 WLRQDU\XVHVZLWKLQHDFK]RQLQJGLVWULFWHVWDEOLVKDGHYHORSPHQW 3($!2&-&!;'9(38;,'3ă$'l9m3(V Councillor: Division No. 5 SHUPLWSURFHVVSUHVFULEHDSURFHVVIRUDSSHDOVDQGSURYLGHD Rural Municipality of Elcapo No.154 SURYLVLRQIRUDPHQGPHQWV7KHSURSRVHGIHHVE\ODZZLOOHVWDE 1. MAYOR of the Town of Whitewood OLVKIHHVIRUPXQLFLSDOVHUYLFHVLQFOXGLQJSODQQLQJDQGGHYHORS 2. COUNCILLOR for the Town of Whitewood will be received by the undersigned on the 7th day PHQWVHUYLFHV AFFECTED LAND: 7KH SURSRVHG E\ODZV ZLOO DIIHFW DOO ODQG (Number to be Elected – 6) RI2FWREHUIURP DPWR SP&67 ZLWKLQWKHLQFRUSRUDWHGDUHDRIWKH5XUDO0XQLFLSDOLW\ DW WKH 0XQLFLSDO$GPLQLVWUDWLRQ 2I¿FH 0DLQ REASON: 7KH2IÀFLDO&RPPXQLW\3ODQZLOOSURYLGHWKH50ZLWK Will be received by the undersigned on the 7th day 6WUHHW%URDGYLHZ6DVNDWFKHZDQDQGGXULQJUHJ GLUHFWLRQ RQ GHYHORSPHQW GHFLVLRQV DQG PXQLFLSDO JRDOV7KH 3($;3#'8T(831!W1W;36W1W!;;,'ă$' XODUEXVLQHVVKRXUVRQWKHWKGD\RI6HSWHPEHU =RQLQJ %\ODZ ZLOO KHOS GLUHFW DQG PDQDJH JURZWK DQG GHYHO of the Town of Whitewood, 731 Lalonde Street RSPHQWZLWKLQWKHPXQLFLSDOLW\7KHIHHVE\ODZZLOOSURYLGHD and during regular business hours from 9 a.m. to 4 to the 6th day of October, 2020, at the Municipal $GPLQLVWUDWLRQ2I¿FH0DLQ6WUHHW%URDGYLHZ VFKHGXOHRIIHHVWREHFKDUJHGIRUVHUYLFHVSURYLGHGE\WKH50 p.m. commencing Friday, September 18, 2020 to PUBLIC INSPECTION:$Q\SHUVRQPD\LQVSHFWWKHSURSRVHG Wednesday, October 7, 2020. 6DVNDWFKHZDQ E\ODZVDWWKH50RIÀFHGXULQJQRUPDORIÀFHKRXUV&RSLHVRI WKHE\ODZVDUHDYDLODEOHDWFRVW 31-2!ধ32(38191!@#'3#;!-2'&!;;,'(3££3>-2+ 1RPLQDWLRQIRUPVPD\EHREWDLQHGDWWKHIROORZ PUBLIC HEARING:&RXQFLOZLOOKROGDSXEOLFKHDULQJRQ2FWR £3$!ধ32V LQJORFDWLRQ EHUDWDP7KHSXEOLFKHDULQJZLOOEHKHOGDWWKH50RIÀFH ă$'3(;,'3>23( ,-;'>33&T 0XQLFLSDO$GPLQLVWUDWLRQ2I¿FH LQ:KLWHZRRG$Q\SHUVRQRUJURXSWKDWZDQWVWRFRPPHQWRQ 731 Lalonde Street 0DLQ6WUHHW WKH SURSRVHG E\ODZV LV ZHOFRPH WR DWWHQG RU WR VXEPLW FRP %URDGYLHZ6DVNDWFKHZDQ PHQWVSULRUWRWKHPHHWLQJ&RXQFLOZLOOFRQVLGHUDOOFRPPHQWV Dated this 18th day of September, 2020. received. 'DWHGWKLVWKGD\RI6HSWHPEHU ,VVXHGDWWKH50RI6LOYHUZRRG1RWKLVWKGD\RI6HS WHPEHU Cindy Baumgartner Mervin J. Schmidt, -HQQDOHH%HXWOHU ';<82-2+ă$'8 5HWXUQLQJ2I¿FHU &KLHI$GPLQLVWUDWLYH2IÀFHU www.grasslandsnews.ca 0HOYLOOH$GYDQFH:KLWHZRRG*UHQIHOO+HUDOG6XQ)RUW4X·$SSHOOH7LPHV September 18, 2020 23 Distressed tourists rescued on Echo Lake By Alan Hustak as they were offshore, attempting to bring the boat to day.” The biggest problem was getting the boat out of Grasslands News safety at the Fort campground. the water and on to the trailer. “When the nose was “They were caught in the wind and large waves, on the trailer, the boat started to sink. It was mostly coming in on the leeward side, and I directed them trying to deal with whatever problems arose.” Two distressed tourists from Alberta were rescued to the windward side where they would drift into the on the Labour Day weekend by town councillor Lee dock, then ran out to the end of the dock to help them Finishen and several municipal park employees when tie off. The wave were 3-5 feet and coming up to my their boat was swamped by heavy waves on Echo Lake waist while standing on dock,” he said. and began to sink. With the help of municipal park employees Corinna Finishen, who is running for mayor, was driving Schwab Tristan Thorpe and Mike Forrester, they along the Fort San road when he saw the boat rid- managed to eventually drag the 15-foot craft out of the ing the windswept waters. “I wondered who would be water. “It was getting swamped from the back, every- Sign up for free at your local post office to opt out of receiving crazy enough to be out there in those kind of waves,” thing was floating out of the boat. We had one hell of unwanted flyers, catalogs, credit card offers and junk mail. he told the Times. Finishen says he got to the pair a time.” Forrester said because it was a “super windy 127,&(2)&$// 127,&(RI&$// 127,&(RI&DOO )25120,1$7,216 IRU120,1$7,216 IRU1RPLQDWLRQV 5XUDO0XQLFLSDOLW\RI/LSWRQ Rural Municipality of Cana No. 214 Form H (Section 66 of the Act) 3XEOLF QRWLFH LV KHUHE\ JLYHQ WKDW QRPLQDWLRQV RI 38%/,&127,&(LVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGL 38%/,&127,&(LVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHV FDQGLGDWHVIRUWKHRIILFHRI GDWHVIRUWKHRIILFHVRI IRUWKHRIÀFH V RI 0$<259LOODJHRI'XII 5((9( 50RI&DQD1R 5HHYH &281&,//25 50RI&DQD1R'LYLVLRQ1R &281&,//259LOODJHRI'XII &281&,//25 50RI&DQD1R'LYLVLRQ1R &RXQFLOORU 'LYLVLRQ1R Number to be Elected: 2 &281&,//25 50RI&DQD1R'LYLVLRQ1R &RXQFLOORU 'LYLVLRQ1R ZLOOEHUHFHLYHGE\WKHXQGHUVLJQHGRQWKHWKGD\RI ZLOO EH UHFHLYHG E\ WKH XQGHUVLJQHG RQ WKH WK GD\ RI &RXQFLOORU 'LYLVLRQ1R 2FWREHUIURP DPWRSPDQGGXULQJUHJXODUEXVL 2FWREHUIURP DPWR SPDWWKH'XII QHVV KRXUV RQ 6HSWHPEHU WK WR 2FWREHU WK DW WKH ZLOO EH UHFHLYHG E\ WKH XQGHUVLJQHG DW WKH 0XQLFLSDO 2IÀFH 9LOODJH 2IILFH DQG GXULQJ UHJXODU EXVLQHVV KRXUV RQ PXQLFLSDORIILFH ORFDWHG DW 0DLQ 6WUHHW /LSWRQ 6DVN GXULQJ QRUPDO RIÀFH 6HSWWR2FWDWWKH'XII9LOODJH2IILFH ** A completed Public Disclosure Statement MUST KRXUVXQWLO:HGQHVGD\2FWREHUDWSPORFDOWLPH 1RPLQDWLRQIRUPVPD\EHREWDLQHGDWWKHIROORZLQJ accompany a Nomination Paper ** 1RPLQDWLRQIRUPVPD\EHREWDLQHGIURPWKHPXQLFLSDORIÀFH ORFDWLRQ 'XII9LOODJH2IILFH 1RPLQDWLRQ)RUPVDQG3XEOLF'LVFORVXUH6WDWHPHQWVPD\EH REWDLQHGIURPWKHPXQLFLSDORIILFHORFDWHGDWWK$YH(DVW 'DWHGWKLVWKGD\RI6HSWHPEHU 'DWHGWKLVWKGD\RI6HSWHPEHU 0HOYLOOH6DVNRURQWKHPXQLFLSDOZHEVLWHDWZZZUPRIFDQDFD Frank Kosa 7UDFH\6FKXPDQ 'DWHGWKLVWKGD\RI6HSWHPEHU 5HWXUQLQJ2IÀFHU 5HWXUQLQJ2IILFHU .DOL7RXUQH\5HWXUQLQJ2IILFHU 127,&(RI&$// NOTICE of CALL NOTICE OF CALL FOR NOMINATIONS )25120,1$7,216 for NOMINATIONS Town of Cupar 5XUDO0XQLFLSDOLW\RI*UD\VRQ1R Municipal Elections FORM H (Section 45 of the Act) 3XEOLFQRWLFHLVKHUHE\JLYHQWKDWQRPLQDWLRQVRIFDQGLGDWHVIRU (Municipal Elections) WKHRIILFH V RI Village of Dysart Public notice is hereby given that nominations of 5((9( 502)*5$<62112 38%/,&127,&(LVKHUHE\JLYHQWKDWQRPLQDWLRQV FDQGLGDWHVIRUWKHRI¿FHRI &281&,//25 502)*5$<62112',9,6,2112 RIFDQGLGDWHVIRUWKHRI¿FHRI &281&,//25 502)*5$<62112',9,6,2112 Mayor: Village of Dysart Mayor: Town of Cupar &281&,//25 502)*5$<62112',9,6,2112 Councillor: Village of Dysart Councillor: Town of Cupar Number to be elected: 4 1XPEHUWREHHOHFWHG :LOO EH UHFHLYHG E\ WKH XQGHUVLJQHG RQ WKH WK GD\ RI th 2FWREHUIURP DPWR SPDWWKH0XQLFLSDO2IILFH ZLOO EH UHFHLYHG E\ WKH XQGHUVLJQHG RQ WKH WK GD\ Will be received by the undersigned on the 7 day of 7D\ORU 6WUHHW *UD\VRQ 6DVN DQG GXULQJ UHJXODU EXVLQHVV RI2FWREHUIURP DPWRSPDW0DLQ 2FWREHUIURP DPWR SPDWWKH7RZQ KRXUV RQ 6HSWHPEHU WK WR 2FWREHU WK IURP DP WR SPDWWKH0XQLFLSDO2IILFH 7D\ORU6WUHHW *UD\VRQ 6W'\VDUW6DVNDQGGXULQJUHJXODUEXVLQHVVKRXUV RI &XSDU 2I¿FH DQG GXUULQJ UHJXODU EXVLQHVV KRXUV 6DVN IURP6HSWHPEHUWR2FWREHUDW IURPWK6HSWHPEHUWRWK2FWREHUDW 1RPLQDWLRQIRUPVDQGSXEOLFGLVFORVXUHIRUPVPD\EHREWDLQHG WKH7RZQRI&XSDU2I¿FH IURPWKH0XQLFLSDO2IILFH 0DLQ6W'\VDUW6DVN 1RPLQDWLRQIRUPVPD\EHREWDLQHGDWWKHIROORZ Nomination forms must be properly executed and 1RPLQDWLRQIRUPVPD\EHREWDLQHGDW7RZQRI&XSDU accompanied by a Public Disclosure Statement and a current LQJORFDWLRQ 9LOODJHRI'\VDUW2I¿FH0DLQ6WUHHW RI¿FHDW6WDQOH\6WUHHW&XSDU6.6*< Criminal Record Check. '\VDUW6DVN Dated this 14thGD\RI6HSWHPEHU 'DWHGWKLVWKGD\RI6HSWHPEHU 'DWHGWKLVWKGD\RI6HSWHPEHU Silvia Virgilio, 6DUDK'LHWULFK5HWXUQLQJ2IILFHU 3DP6WHLQLQJHU5HWXUQLQJ2I¿FHU 5HWXUQLQJ2I¿FHU STILL OPEN FOR BUSINESS We are still here to serve you, at a social distance of course! RENOVATIONS & BOBCAT WORK • Concrete driveways, walks & garage pads installed Contractors and Home • Paving stone driveways & walks installed • Paving stones releveled Free estimates, 24 hour emergency service • Yard clean-up Danny Currie, Journeyman Electrician Directory [email protected] Brian Gordon Fort Qu’Appelle, SK 306-331-6588 echoelectric.ca Locally owned and operated serving fort qu’appelle and 1-306-530-4550 surrounding area call or email today! -LP·V5RRÀQJ Pole Buildings Home - Kitchen - Bath +RW5RRÀQJ6KLQJOLQJ Everything for your home under one roof. 6QRZ5HPRYDOIURP5RRIV 7UDFNKRH'R]HU/RDGHU • HARDWOOD • CARPET • LAMINATE • LUXURY VINYL )5(((VWLPDWHV *UDGHU6NLG6WHHU • TILE • AREA RUGS & MORE +\GUR9DF7UXFN%DFNKRH Jim Anderson 7UXFNV *UDYHO /RZ%R\ 6SHFLDOL]LQJLQEDVHPHQWVVHZHUDQGZDVWH &RPPHUFLDO UHVLGHQWLDOIDUPVGXJRXWVHWF 110 - 3rd Ave. W., Melville, SK | 306.725-5432 | 1.877.728.5432 Cell: 1-306-621-6372 carpet1melville.com 12 Livingstone St., Yorkton, SK | 306.782.6556 | 1.888.782.6556 MLPVURRÀQJ#OLYHFD 306-740-7805 or 306-745-7226 carpet1yorkton.com Melville, Sk Whitewood, SK Photos for illustrative purposes only. ©2017 Carpet One Floor & Home. All Rights Reserved. DO YOU NEED “We specialize in all your building needs” Mr T’s Plumbing Invoices, Business 197 Victoria Ave. We’re here to HELP! and Heating Fort Qu’Appelle Your Success is Our Success. Todd Th rossell Cards or Any Kind Journeyman Plumber Licensed Gas Fitter of Printing? HOURS Your support makes our community Mon. - Fri. 7 a.m. - 5 p.m. 813 Desmond St., stronger by shopping locally! P.O. Box 296, Contact: Sat. - 8 a.m. - 4 p.m. Grenfell, SK 1-306-332-2833 We take pride in servicing S0G 2B0 Grasslands News and serving our community! Ph.: 1-306-697-2727 1-844-464-6397 ext 229 Cell: 1-306-697-7749 www.friestallman.com [email protected] 24 September 18, 2020 Whitewood Grenfell Herald Sun Grasslands News Upcoming promotions 3 GREAT GUIDES for 1 LOW PRICE 36,0000 READERSHIP! 8!99£!2&9'>9 83<6T>,-$,6<#£-9,'9;,''£=-££'&=!2$'T ,-;'>33&c 8'2('££ '8!£&<2!2& 38; £32+>-;,3<88'+<£!89<#9$8-#'89T;,'9'+<-&'9>-££!£93#'!=!-£!#£'FREE OF CHARGE(8313<83ă$'Z9-2 '£=-££'{ ,-;'>33&!2&&3>2£3!&(8313<8>'#9-;'!; >>>W+8!99£!2&92'>9W$!W Community Show your appreciation Guide this Remembrance Day &RPPXQLW\6SRWOLJKW Information Spotlight on Community Groups, Clubs, OrganizationsTFacilities{ <9-2'99'9W Community Guide First Responders Remembrance Day September 25 October 2 November 6 The Community Guide will This supplement salutes Share your thanks in our 63;£-+,;-2(381!ধ3232 3<8!8'!)89;8'9632&'89 <6$31-2+!22,-£'683=-&-2+'&<$!ধ32!£ ';'8!2996'$-!£'&-ধ32! 8+!2-A!ধ329T !$-£-ধ'9!2& -2(381!ধ3232;,'/3#9;,!; Businesses in our area. 1!0'3<8$311<2-;@!9!('8 6£!$'W '2''&;,'9<6638;3(£3$!£#<9-2'99'9!2&38+!2-A!ধ329£-0'@3<89;3683=-&'96329389,-6(38 ;,'9'$311<2-;@6<#£-$!ধ329W Sponsorship ads spots are 2” x 2” for $50 each, colour included or #<@!££6<#£-$!ধ329(38W W !8+'8!&963;9!8'!=!-£!#£'-2!2@38!££+<-&'9T6£'!9'$32;!$;(3868-$-2+W 3#330@3<8!&='8ধ9-2+96!$'38-(@3<,!='!2@7<'9ধ329T$32;!$; -$,'££';3££(8''!;Vf¥f f l'?;Wm 38'1!-£;3V!&9|+8!99£!2&92'>9W$! 2020 Fall Harvest AGRICULTURE EDITION Publishers of The Melville Advance, The Fort Times and The Whitewood and Grenfell Herald Sun Photos submitted by Howard Pankoski Grasslands News 2 September 18, 2020 Fall Agriculture Edition Farm Credit Canada Modest increase for farmland values for 2020 Average farmland values in Canada dence among producers in the farmland are once again showing modest increases market appear to be the main drivers be- for the first half of 2020, although the full hind the 2020 mid-year increase. impact of the COVID-19 pandemic has “Despite supply chain disruptions yet to be weighed, according to a review that have impacted some sectors, such by Farm Credit Canada. as red meat, the pandemic has so far The national average for farmland not significantly affected the agriculture values increased an average of 3.7 per land market,” Gervais said. “In fact, the cent for the first half this year. This in- grain, oilseed and pulse sectors have crease is in line with mid-year results performed well in the first half of 2020, over the past five years, which showed supporting the slightly higher rate of in- single-digit increases for the full year. crease in western Canada.” “Given the global economic situation Crop receipts (excluding cannabis) for during the first half of 2020, Canada’s the first six months of 2020 are 1.6 per farmland market is showing remark- cent higher than for the same period last able resilience in the face of adversity year. and uncertain times,” said J.P. Gervais, Gervais recommends farm operators FCC’s chief agricultural economist. should continue to exercise caution, “Changes to production and marketing especially in regions where the growth plans induced by the pandemic have had rate of farmland values significantly a definite influence on profitability, yet exceeded that of farm income in recent the demand for farmland remained ro- years. He also recommends operators bust.” maintain a risk management plan to pro- FCC’s review showed lower 12-month tect their business from unpredictable increases in average farmland values for circumstances. most provinces over the last 12 months compared to last year’s average, with the exception being in Alberta (8.5 per cent compared to 3.3 per cent) and Saskatch- ewan (7.9 per cent compared to 6.2 per Viterra and STARS team up to launch fundraiser cent). In general, the pace of farmland value increases over the past six months Viterra has announced that it is ing our sponsorship with STARS, which “STARS is grateful for Viterra’s gen- was slightly higher in western provinces teaming up with STARS to sponsor its has had a tremendous impact in the erous support, especially during these and slightly lower in central and eastern 2021 fundraising calendar. This marks lives of patients in rural communities, difficult times, when many of our fund- parts of the country, with the exception the sixth consecutive year that Viterra including our employees, our custom- raising events have been postponed or being New Brunswick. has partnered with STARS by covering ers and their families,” said Kyle Jew- cancelled,” said Andrea Robertson, Pres- A look back at 2015 in the many differ- the full printing costs of the calendar. orski, President and CEO for Viterra ident and CEO of STARS. “We are grate- ent regions shows the average increase This initiative is STARS’ second larg- North America. “We’ve worked closely ful for Viterra’s ongoing partnership to was 10 per cent, and since that year, Can- est fundraiser, with more than 60,000 with this world class organization since continue our calendar program, helping ada has seen more moderate single-digit calendars sold annually. The calendars 2015, and are proud to help patients STARS stay operational and providing increases in average farmland values. will be available for purchase at Viterra share their stories and support STARS world-class, life-saving emergency med- Low interest rates, the limited supply facilities across Western Canada. in raising awareness so that they can ical care to patients who need it most.” of farmland in the market and confi- “We’re very pleased to be continu- continue their life-saving work.” The calendars will be available until The campaign is entering its 28th December 4 at most Viterra locations, as year and has raised millions of dollars well as online at starscalendar.ca. HAUSER’S MACHINERY LTD. to date. Hwy. #15 West, Melville, SK TEL: (306) 728-2101 — TOLL FREE: 1-888-939-4444 www.hausers.ca “Proudly serving the agricultural and industrial communities since 1947” - Complete machine shop service Steel - 6WUXFWXUDOÀDWEDU+6DQJOH - Welding rods; hard surface rods - Mig, tig and stick welding round, rebar, sheet metal and mesh 137¿WWLQJV FXVWRPSLSH - Large inventory of industrial - Custom shearing, forming threading to 4 in. and ag parts and fabrication - Sch 40 - 80 - 160 pipe - Crosby shackles, tow straps - Mobile welding unit Grade 8 bolts - metric 10.9 bolts - Gr. 70 - 100 hooks and slings to - Bearings, seals, hubs, pulleys - Trailer hitch accessories 100,000 lb. cap. and sprockets - Electrical; tail lights, side markers, We are a team of animal lovers, here to give our - Wide load signs, tarp straps, - PTO yokes, roller chain and links beacons load binders by OCM to #100 series - L.E.D. lighting patients the attention and care they deserve. Heavy Truck and Trailer Safeties, Repairs and Service Full service large and small animal veterinary clinic! ³SGI Safety Inspections We offer year round service both in clinic and on farm. Our focus is preventative medicine ³Fully Stocked Parts Dept. through herd health programs that best fit the operation! We utilize up to date equipment, ³Journeyman Truck and Trailer including ultra sound and digital radiography. Our shelves are always stocked to supply you Mechanic on Duty with all the essential items to promote optimal herd and pet health care. If we don’t have it we can order it, most of the time for next day! Emergency service is available after regular HAUSER’S MACHINERY LTD. – QUALITY SERVICE AND COMPETITIVE PRICING... EVERY DAY office hours. Equine Care Routine Care, Dentistry, Vaccination, Castration, Ultra Sound, Worming Livestock Services Reproductive Care, Vaccination, Castration, Dehorning, Pregnancy Testing, Bull Evaluation Small Animal Care Preventative Care, Spay/Neuter, Dentistry, Dental X-ray now offered, Geriatrics, Digital X-ray,Ultra Sound, Specialty Surgery 228 Main St. Melville, SK @MA1974LTD Open: Monday to Friday Melville | Springside | Ituna 8:30 a.m. to 5:30 p.m. - Thursdays until 7 p.m. 306-728-4457 After hour services available www.melvilleagencies.com Motor Licence Issuer • Home/Auto/Farm/Commercial Notary Public • Surety • Blue Cross • GMS MELVILLE HOURS Monday - Friday 8:30 am - 5:00 pm Saturday 9:00 am - 12:00 pm Excluding Long Weekends Find us on #1 Agri-Park Road North, Facebook & Twitter or Melville, SK download our APP Tel.: 306.728.2633 Wishing you a safe and successful harvest. AHCMelville - in your APP store www.melvillevet.com Grasslands News www.grasslandsnews.ca September 18, 2020 3 Loop program returns organic foods to farms By Chris Ashfield resulting in a large reduction of tradi- Grasslands News tional disposal tip frequency. As one of those partnering farms, DK Acres travels to Regina once a week to pick A program developed to close the up approximately 100 boxes of grocery loop on organic food waste disposal is food. Common items include outdated, growing across Saskatchewan by taking damaged or distressed produce, dairy, expired or damaged food from the end bakery, floral, deli, meat, food waste of the line at the grocery store and send- and end of shelf life items. Almost all ing it back to the beginning as feed and grocery store surplus can be utilized as compost on local farms instead of into animal feed. landfills. Through the Loop program, goats, Loop Resources works with grocery sheep, llamas, pigs, chickens, ducks, stores across Saskatchewan, Alberta cows, buffalo, dogs, cats, horses, and and British Columbia to divert unsale- more are all treated to living, fresh, real able grocery store food to feed animals food. Farmers routinely find that their on farms of all shapes and sizes, and to animals’ condition improves with the registered charities where possible. The additional feed. program has over 1,000 stores involved “We provide simple systems with CHRIS ASHFIELD | GRASSLANDS NEWS across the three provinces with over safe liability structures that enable food Recycling food waste 1,000 farms participating. Saskatchewan wholesalers, retailers, and producers Kelsey Kaban of DK Farms feeds pigs on a farm near Whitewood with food has 15 stores and 150 farms involved to divert one hundred percent of their provided through the Loop program. Loop donates unsellable organic food with Loop. Thousands of more farms are unsaleable food away from landfill, and from grocery stores to farms to help feed livestock. on the waiting list. towards those in their community who Whitewood’s DK Acres, which spe- can use it best,” said Jaime White, di- their ideal farm is diverse enough to be charities and outreach organizations. cialize in purebred poultry and live- rector with Loop. able to utilize 100 per cent of the prod- Although some brands require that the stock, along with fibre animals, is one of “For stores, it means diverting un- uct they receive. Biodiversity on farms donated food is not to be used for human the farms who participates in the Loop saleable food away from the landfill enables every feed source to be utilized consumption, one of Loops partners, program. Operated by Kelsey Kaban and while reducing staff time and saving optimally, and returned as healthy food Save On Foods, does allow donations of Dustin Dick, the farm has been part- disposal costs. For charities, it means for people in the community. Loop se- the goods they receive if they are part of nered up with the Superstore East in access to food for their programs with- lects their partner farms carefully, and the Loop program. Regina since May 2020. out overwhelming their resources. For prefer family farms engaged in mixed, “When you support at risk families, “We decided to go with Loop because farmers, it means food that can be used holistic farming. Then through their se- and small farms; you invest in the heart it goes along with what we strive for on as feed for their animals, as bio-energy, lection criteria, they match stores with of your community. Benefits large and our farm which is reducing the carbon or as compost. For all of us, we believe farms by size and diversity. To belong small ripple outwards from the growth foot print and reducing waste while al- it’s a simple, sustainable way to do the to the Loop program, participants must of dynamic, vibrant, and sustainable lowing the best for the animals,” said right thing for the environment while also be interviewed and take a manda- communities, while securing ethical Kaban. helping strengthen our communities,” tory course. food production close to home,” said The average store the Loop program says a post by White on the company’s Farms are not the only one that ben- White. works with produces 600 to 1000 pounds website. efits from Loop as they are also commit- For more information on Loop, visit of surplus product a day, and is served While Loop allows farms of many ted to using surplus food received from their website at loopresource.ca. by daily pick-ups from Loop partners, sizes and descriptions into the program, their partner stores to provide access to EXPERIENCED. $**5283 The RE/MAX® brand’s 46 years’ experience allows us to adapt to changing markets, innovate with smart technology and evolve with open mindsets to help maximize your investments. -9!+33&ধ1';3 38 !81£!2&R !;'9!8'3>{<@'89!8'£330-2+(38!2&R Ray Nordin - Realtor® !819T$8'!+'9{'9-&'2ধ!£ Serving East Central Saskatchewan (306) 730-8151 [email protected] 3&."9#SJEHF$JUZ3FBMUZ ""SMJOHUPO"WF remaxcommercial.com 4BTLBUPPO 4,4++ FARM & RANCH LAND © 2020 RE/MAX, LLC. All rights reserved. Each Office Independently Owned and Operated. 20_302554 Grasslands News 4 September 18, 2020 Fall Agriculture Edition Local farmer gets the edge By Emily Jane Fulford Angus, near Duff, Sask. The opera- grain farmers was a super excit- Grasslands News tion has currently raised 100 pure- ing change. This internship with bred Black Angus cows and plans Farmers Edge entailed scouting my to expand each year. farmers’ fields, visiting with them For 15 years, Farmers Edge has “My parents, Troy and Amy about their crop plans and the vari- been a global leader in developing Frick, have been in the Black Angus eties that they are using this year, and delivering digital agriculture business since 1997,” explains but most of all building strong re- solutions. It is through a combi- Frick. “My grandparents, Alvin lationships with them,” said Frick. nation of field data gathering and and Marlene Frick, have been in innovative technology that they “Using the satellite imagery to help have dominated the agriculture the cattle business for 55 years and them know what is happening in industry. Moving forward into the have been in Black Angus since every area of their fields was really digital era, Farmers Edge supports 1997 also. I have 10 cows of my own intriguing to them and to myself.” the educational initiatives of the and am also expanding each year Farmers Edge offers a website next generation of farmers through and hoping to take over the family and an app called ‘FarmCommand’ their internship program. This farm someday; but for now, con- that has fully integrated precision year, Alexis Frick of Melville, Sask. tinuing to work alongside my fam- digital tools. The data is collected had the opportunity to take part in ily. We attend Harvest Showdown from farms and is used to help this unique experience. in Yorkton, Canadian Western farmers make decisions and make “I learnt about the program of Agribition in Regina, and Brandon data collection easier for them by the internship from the career fair Ag Ex in Brandon MB. Each year installing weather stations and that the University of Saskatche- on the second Saturday in April we telematic devices onto their farms Unique farming internship market our bulls through the Blue wan held in the fall,” said Frick. and having all these data sources Local Melville student, Alexis Frick, had the rare Collar Bull Sale and in 2021 it will into the platform called FarmCom- “What made me pursue this intern- and unique opportunity to attend a summer intern- ship was the interest I had in what be our 15th annual sale. I was also mand. Farmers Edge offers to the future involved in 4-H for 13 years.” “Being in a field with a farmer ship aimed at helping bring leading edge technol- of agriculture. There was lots of Alexis completed her Diploma and watching them be proud of the ogies to the world of farming. talk about Farmers Edge’s tools to in Agribusiness at the University work they’ve accomplished and see- benefit farmers. Weather stations, of Saskatchewan in the spring of ing Farmers Edge benefit them and May to July I was intern for a full time position satellite imagery, moisture probes, 2020 and took on the intern position their farm is all a reward in itself,” and then I got offered a for the long term. I am growth stage models, the list goes during this past summer. said Frick. “I am super grateful for full time position as a really looking forward to on and on. This was a company I “During the internship I cov- the internship and all the great peo- Client Success Manager my future with Farmers knew I could be long term because ered the North West territory of ple I got to work beside this sum- for the North Battleford Edge and continuing to of the bright future it has.” Saskatoon. Going from being a mer. My manager, Kelsey Waelchli territory. It was super ex- build relationships with Since childhood, Alexis has cattle rancher from southern Sas- (Schultz), was such a great mentor citing news because I fin- the farmers I had over been actively serving on the fam- katchewan and moving to northern and I cannot thank her enough for ished my diploma in the the summer and gained ily cattle ranch, Northern View Saskatchewan to work with huge guiding me this summer. From spring and was looking with this new position.” OK TIRE MELVILLE MORE THAN JUST TIRES! We Salute - SGI Certifi ed Light Vehicle Inspection Station - Heavy Truck and Trailer Inspection Station - Truck and Trailer Repair Center - Wheel Alignments, Oil Changes, Brakes, Shocks - Tune-ups and more! OUR TIRES ARE ALWAYS ON SALE! 15W-40 ROTELLA OIL “We’ll beat any written quotes” On Sale Now! (on same name tires) While Quantities Last We also offer $ 99 the Farming 63 / pail Free wheel checks! Community! 306.728.4002 280 Service Road North, Melville “No job too big or small!” For all your Mechanical Repairs, Welding, Parts, Lubricants, Westwind Livestock Mineral/Salt, Feed Test, Ag and Vet Supply Needs. { W Portable Wind Breaks, Panels, Bale Feeders, Feed Bunks, Calf Shelters and More! 1005 Hwy. #47 North, Grenfell, Sask. Dealers for: • Westward Parts • A&I Products • Fleetguard Filters •83<><;8-ধ32c,<8f !-2 ''&9 • -$0<#9•6''&8-;' £'$;8-$ '2$-2+ •,'££<#8-$!2;9 •;31';T<;$,6'2'89 • Fleetguard Filters •$!@ 2&Wc !8='9;'8=-$'9!2&1!2@138'R -='9!££ Ph: 306-697-2771 – Fax 306-697-2775 ¤f¤f Email: [email protected] Grasslands News www.grasslandsnews.ca September 18, 2020 5 Farmers need to handle stress during fall harvest By Sarah Pacio whose husband Nathan to face these difficulties Grasslands News operates a farm outside with determination and Grenfell, shared a similar positivity, by focusing perspective with Grass- on what needs to be done People passing along lands News. “Leaning on and looking for the good a Saskatchewan highway family and supporting in every situation. in September might be each other is important,” She spoke with Grass- surprised to see head- she said. “We’re a small lands News last week lights in a field after family farm, and we all and described a recent sunset, but the lights have to work together, machinery breakdown, are simply evidence that the kids included, to get which abruptly stopped farmers are diligently the crops off, the garden work in their field. While harvesting crops. Trying harvested, and the Fall neighboring farms con- to gather all the bounti- work done.” tinued to bring in crops, ful yield before a heavy She added that an- the family faced un- frost or early snowstorm other key to handing planned expenses and Stressed farmer can be stressful, but local harvest stress is flexibil- time-consuming travel to Nearly two-thirds of Canadian farmers feel stress about farming, which can farmers rely on friends ity. “A big part of coping get the part necessary to lead to health problems. Several Grenfell area farmers share their methods for and faith to help them is realizing that there’s repair their equipment. coping with stress on the farm. persevere. lots of things out of your When challenges like Research cited by control,” she said. “You that come, a plaque in the Canadian Centre encouraged to contact the really have to be able to Adrina’s living room re- for Health and Safety in Farm Stress Line. This go with the flow during minds her, “Life is bet- Agricultural (CCHSA) free resource was estab- harvest.” ter when you say your indicates that nearly lished by the Ministry Adrina Hoffman helps prayers.” She said, “I two-thirds of Canadian of Agriculture to provide her husband Mark run can’t do it without prayer. farmers feel stressed individuals in rural Sas- agriculture their family farm north of God is not a magician, about farming. Prolonged katchewan with 24-hour Grenfell. She agrees that but He knows what He’s stress may cause high access to crisis counsel- changing weather and doing. There’s a reason blood pressure, heart dis- ing. Support is available malfunctioning equip- everything happens.” ease, depression or other by phone 1-800-667-4442 ment are top stressors If the pressure becomes health problems. and online help@farm- during harvest. Adrina unbearable, farmers and Many things can con- stressline.ca or www. encourages her family their family members are tribute to stress during farmstressline.ca. harvest, from poor weather conditions to mechanical trouble with equipment. Since har- vesting crops is such a time-sensitive endeavor, THANK YOU Fall Ag Week any delay can cause anx- To everyone in the Agricultural Industry iety. Yet there are ways of Saskatchewan, have a Safe Harvest to counteract these nega- to our area farmers, tive experiences, helping reduce physical and emo- tional strain. for all you do! For example, experts at the CCHSA recommend incorporating relaxation techniques or exercise We would like to take this into regular routines as opportunity to thank you, a means of coping with stress. They also suggest the farmers of Saskatchewan talking things over with (38@3<8'ø38;9;,83<+,3<; a family member, friend or professional. Sharing the years that have even a brief interaction made you our Number 1 industry. over the phone or social !1-''#!9ধ!2Owner/Journeyman media can help ease some of the burden during a ¤ff¥ă$'¤ff¥¥Cell RM of Elcapo No. 154 busy harvest season. '8=-2+ 38; SUBSCRIBE TO THE FOLLOWING: ❑ Melville Advance ❑ Fort Qu’Appelle Times ❑ Whitewood/Grenfell Herald Sun Name: Address: Town/City: Prov: ✁ ✁ Help to build a stronger community! Postal Code: Phone: Email Address: WHY SUBSCRIBE? • Stay informed about your community. Payment by: ❑ Visa ❑ Mastercard Expiry • You support local businesses who support you back. ❑ Cheque or Money Order (enclosed) Signature • The newspaper is the community’s only historical record. Please make cheques out to Grasslands News Group Telephone Orders: 306-728-5448 (ext. 227) • A viable newspaper shows a strong community. • It’s less than buying one cup of coffee per week Forms should be mailed to Grasslands News Group, Box 1420, Melville, SK., S0A 2P0 -$0f<6<#9$8-6ধ32 !90W<#9$8-6ধ32 !2!&!<#9$8-6ধ32 Subscribe TODAY! W W¤ W CALL US TOLL FREE AT 1-844-464-6397 (EXT. 222) 838!;'&8!;'9(389<#9$8-6ধ3299;!8ধ2+-2$;3#'8T;,3<+,;3'$WTW 2$£<&'&W Grasslands News 6 September 18, 2020 Fall Agriculture Edition Area ironworks business SUBMITTED | GRASSLANDS NEWS Impressive farm entry SUBMITTED | GRASSLANDS NEWS 7KLV\DUGRYHUORRNV:HVW(QG5HVRUWDQGLVEHDXWLÀHGE\WKHYLQWDJHLURQ- 7KLVJDWHDWWKHHQWUDQFHWRDIDUPQHDU0HOYLOOHZDVGHVLJQHGDQGFRQVWUXFWHG ZRUNVPDGHE\*DWHZD\*DWHV7KHFRPSDQ\KDVDYDULHW\RIGHVLJQÀJXUHV E\*DWHZD\*DWHVZKRGHVLJQVVHFWLRQVWREHSXWWRJHWKHUWKDWLQWHUPDWFK WKDWFDQEHSXWWRJHWKHUWRSHUVRQDOL]HDV\RXURZQGHVLJQ MXVWOLNHOHJRRZQHU'DQQ\.X]XEVWDWHV Gateway Gates inspired by trip down south By Elaine Ashfield in love with the many design features that ap- most beneficial part of his itive responses and excel- freelance design work Grasslands News vintage ironworks de- pealed to me.” designs is that they can lent feedback in regards for other manufacturing signs from around the Kuzub compiles his be ‘mixed and matched’ to the finished projects! companies for a number world that I found in and own designs and states to create whatever a per- Kuzub grew up on a of years. A trip to New Orleans around New Orleans and none of his ironworks de- son’s likes may be. Solar family farm in the White- Kuzub has a home and the Gulf of Mexico in- (on another trip) around signs are copies. “I think lights can be etched into wood area, and it was in in Regina but currently spired a Whitewood area the Gulf of Mexico to the of the reproductions as the ironwork; ranch or his late twenties when lives at Round Lake man to develop a line of tip of Florida. I recorded complimenting the iron- farm names (that can he got involved with de- where his yard overlook- vintage ironworks that hundreds of the five and works’ art from the fif- be changed or updated sign and building agri- ing the valley at West specializes in driveway six hundred year old teenth century and so if needed) can become a cultural machinery that End Resort also displays gates, garden gates, ar- ironworks designs on my on,” Kuzub says. part of the design; person- led to a contract with a some of his ironwork de- bors, roadside billboards digital camera. With an- In the past twenty alized wedding arbors or company from Winni- signs. and custom gate designs. other digital collection of some years Kuzub pro- cemetery gateways are peg, Manitoba where he View the various sam- Gateway Gates, de- ironworks designs from duced a small library of just a few of the ideas spent the following three ples of Kuzub’s intricate signed by Danny Kuzub, the San Francisco area digitally produced iron- where the ironwork de- years, leading him back and varied work at Gate- began with a winter va- and along the west cost works designs, as well signs could make a huge to Regina where he also waygates.ca or on his cation where, he told that I recorded, I began as many actual laser cut impact to anyone viewing did contract design work Face book page that the Grasslands News, “I fell to reproduce some of the products. Kuzub feels the them. for another manufactur- Gatewaygates.ca search “It’s just like putting ing company as well as will lead you to. Lego together except Proud to support these are pieces of laser cut steel.” THE AGRICULTURE INDUSTRY! Pieces can be added to Organic growers get funds the sides, the tops or hor- The federal govern- dian organic farmers. izontally to create a fence. The demand for or- Kuzub recently pro- ment recently announced an investment of over ganic foods in Can- duced driveway gates for ada continues to rise, a new client in the Mel- $640,000 to the Canadian Organic Growers (COG) and there are many ville area and has done hard-working and entre- other projects such as the to help get more Cana- dian consumers buying preneurial organic food steel surroundings at the producers across the patio bar at Bird’s Point. Canadian-made organics produced locally by Cana- country. However, much He is receiving very pos- of the Canadian demand for organics is met by im- ported products. With this investment, COG will develop a strat- egy to identify and find solutions to organic sup- ply chain barriers so that Canadian organic pro- ducers can realize their full economic potential and more Canadian con- sumers can buy locally produced Canadian or- ganic food. Strategy recommen- TO OUR dations will be assessed MILLER MOAR GRODECKI and evaluated by an in- dependent industry-wide national advisory com- KREKLEWICH & CHORNEY mittee and a final report FARMERS will be published that Chartered Professional Accountants will explore investment ,!='!9!('{6£'2ধ(<£ opportunities to meet do- mestic demands and rec- ommendations on how to !81T'8932!£{38638!;'!?8'6!8!ধ32{£!22-2+ best seize the opportuni- $$3<2ধ2+{<&-ধ2+'8=-$'9f -2!2$-!£;!;'1'2;8'6!8!ধ32 ties. The report will also HARVEST help quantify the eco- 3300''6-2+{!@83££'8=-$'9 nomic and environmen- tal benefits of increasing domestic organic produc- MELVILLE ESTERHAZY GRENFELL tion and supply chains. Һ Һ ¤Һ “Demand for organic ¤Һ¥Һ ¤ҺҺ¤¤ ¤Һ¤Һ¥ food is growing rapidly and we want to ensure that it is Canadian pro- PART TIME OFFICES Rural Municipality ducers who are benefit- Һ Z ting from that increased Һ Һ of STANLEY No. 215 demand,” said Ma- rie-Claude Bibeau, Min- ister of Agriculture and www.millerandco.ca Agri-Food. Grasslands News www.grasslandsnews.ca September 18, 2020 7 Alpaca farming serves many purposes By Elaine Ashfield mals at Agribition where our society.” natural products to make locks that have a dread- only about two others in Grasslands News she has been successful, “The fibre (wool) of the their care so much easier lock appearance. While the prairies. As the fibre as she also is with her alpaca is so warm, and than from years ago. both fibers can be used in mills become more di- award-winning dogs, in we live in a cold environ- Alpaca fleece is the the worsted milling pro- verse, these developments Dozens of purebred and attaining high achieve- ment so why not use it? It natural fiber harvested cess using light weight are greatly increasing the exotic breeds are homed ments. is hypoallergenic and did from an alpaca. There yarn or thread, Huacaya demand for product. at DK Acres In White- “I bet you didn’t know you know – is fire resis- are two different types fiber can also be used Kaban used the rest of wood which led one of the that alpacas all do their tant.” Unlike polyester of alpaca fleece. The in a woolen process and the fibre from her alpacas owners, Kelsey Kaban, ‘business’ in one area. spun into various weight for numerous things to question Grasslands products that burn vigor- most common fleece type Yes, they only go to the yarns. It is a soft, dura- such as her dog beds and News “Why the interest ously, the more products comes from a Huacaya bathroom in community ble, luxurious and silky chicken nests for comfort, in only the alpacas.” The produced from these fi- which is what DK Acres piles so when it comes natural fiber. warmth and fire safety. dozens of breeds, rang- bres, the safer our envi- produce. Huacaya fiber ing from peacocks, to to clean-up time, just Every bit of fibre that Kelsey Kaban is a di- exotic chickens, to pigs head to the pile to scoop,” is sheared from the al- rector of the Saskatch- and horses, and goats, to Kaban added to my lack paca is useable. Alpacas ewan Alpaca Breeders. name just a few provides of knowledge of the ben- need to be sheared just “Agribition is really on a writer with interest in efit of raising these ani- once a year, provide an board with our associa- the many breeds that are mals that are not at all a abundance of fibre and tion, although not this beyond just one story so native of our area. “And, are lanolin free so are year, due to COVID, as we will start with the al- to top that off, they only easily manageable. Not things were forced to be pacas, an animal that is have their babies between all fibrecan be used to a little different. Agrib- showing growing interest 10 a.m. and 2 p.m. There’s be carded into wool as ition has classes for not in not only breeding but none of this getting up to only what is called the only the animals but also employment oppor- birth these babies in the ‘jacket’ of the fibre from also for fibre that can tunities resulting from middle of the night!” the shoulders and select be displayed and judged. production of their fiber. Being alpaca breeders areas is satisfactory for European judges are an “If anyone wants to is more than the money these qualities. The se- excellent asset to the venture into raising an- of breeding purebred an- lect fibres are washed, judging,” says Kaban. imals for the first time, imals for sale but falls processed and made into “I just love sharing alpacas are a very good under the DK Acres’ yarn. Fibre mills are our experiences and first choice,” Kaban says. pride of “being a small now also using the bal- knowledge with others. I With her partner, Dustin farm that specialize in CHRIS ASHFIELD | GRASSLANDS NEWS ance or poorer strands want interest to grow to purebred poultry and Alpaca farm of fibres and are mixing help create a more sus- Dick, they presently Alpaca at DK Acres near Whitewood are an easy enjoy the alpaca experi- livestock, along with them with flax and hemp tainable world and all at ence with eight breeding fibre animals, all along DQGFOHDQOLYHVWRFNWRUDLVHDQGWKHLUÁHHFHFDQEH fibre, products that also the same time providing females, one registered meeting their goal to pro- used for many purposes. were previously just dis- enjoyment and accom- male for breeding and a duce animals and prod- carded. Even the repur- plishments for anyone. ronment also becomes. grows and looks similar few what they call fibre ucts that would make posing of plastic products We will share and teach The days of the headache to sheep wool in that the boys who are kept for our great grandparents is being introduced with them anything they want of washing delicate and animal looks “fluffy”. The their fibre – and well, proud!” They want to be the alpaca fibres. All to know. “ possible shrinkage from second type of alpaca is their cuteness too! environmentally friendly, these provide a by-prod- DK Acres information wool products are going Suri and makes up less “They are sort of a enjoy the benefits of re- uct that can be utilized in can be found on facebook dream animal to care newable resources and by the wayside as well than 10% of the South various areas. There is a and a visit or a chat with for,” says Kaban, as also make an impact on as items such as soap or American alpaca popula- fibre mill now operating the owners is not only in- they eat sparingly, and things like the fibre im- other care products con- tion. Suri fiber is more in Hafford, SK. and also formative but enjoyable are very easy to handle. print, that as Kaban says, tinue to keep pace with similar to natural silk one in Moose Jaw, SK. and for some of us, just Kaban shows her ani- “Has been almost lost in the increased interest of and hangs off the body in but otherwise, there are plain therapeutic. __ Custom air. __ CUSTOM SAVINGS. Rethink your air for more comfort. And savings. Receive up to $1,350 in rebates PLUS don’t pay until 2021 on a new Lennox® Ultimate Home Comfort System.* SALUTE TO AGRICULTURE 2020 7KDQN\RXWRDOOWKHSURGXFHUVZKRFRQWULEXWH VRPXFKWRRXUHFRQRP\DQGVRFLHW\ &RQVHUYDWLYHVZLOODOZD\VVWDQGXSIRURXU 712 Lalonde Street, Whitwood, SK – 306-735-4328 DJULFXOWXUHVHFWRUDQGWKRVHZKRZRUNLQLW OR 515 Main Street, Kipling, SK – 306-736-5328 íđŜĻŞɳǚíƤœíŞđƎœƫŜĉĻŞİȤĊí 984-A Albert Street *This off er is available through participating Lennox® dealers. Promotions are off ered to the homeowner at the discretion of the Lennox dealer. Only equipment and systems listed onpromotion are eligible for this off er. All products Regina SK S4R 2P7 and off ers are subject to availability. Off er valid on purchases of qualifying equipment between September 7, 2020 and November 27, 2020. The sale of equipment to the homeowner must be within the promotional dates to qualify. System installs need to be completed by December 4, 2020. Claims must be entered online at www.lennoxconsumerrebates.ca with all required documentation by December 18, 2020. Claims and/or paperwork will not be accepted after December 18, 2020. Claims may not be submitted prior to equipment installation. This off er applies to residential installations only. Commercial installations, homebuilder or contractor purchases for new construction, (306) 790-4727 homeowner upgrade through home builder or contractor, installations in multi-family dwellings or any dwelling other than a single-family residence do not qualify for this off er. All information requested is required. Incomplete, illegible or late submissions will be denied. Financing credits will not be issued for denied claims. Lennox reserves the right to request additional information to validate a claim. Lennox reserves the right to inspect any installation [email protected] that is a part of this program. Consumers can redeem only one of the promotional off ers per serial number sold. All required back-up paperwork must be submitted to 360insights online at www.lennoxconsumerrebates.ca. Lennox is not responsible for lost or missing paperwork. Submission will not be accepted for retailers, clubs, organizations, wholesalers or contractors. This off er can be combined with special fi nancing as advertised on lennox.ca. Multiple qualifying products may be sold within an individual family or household. Purchase of equipment must be made by the individual receiving the Rebate. Rebate is paid in the form of a Lennox Visa® Prepaid card. Please allow 2-4 weeks for Visa® Prepaid card processing after claim has been approved. Claims paid on returned products may be subject to reversal. Use your Visa® Prepaid card anywhere Visa® cards are accepted worldwide. The Visa® card is issued by Peoples Trust Company pursuant to license by Visa® International, Trademark of Visa® International Service Association and used under license by Peoples Trust Company. Pay close attention to the expiration date of the card. See Cardholder Agreement for additional details. By providing your information for the rebate, you are signing up and agreeing to receive correspondence or notifi cations from Lennox by text or email. You can unsubscribe at any time. This is subject to WWWW.ANDREWMP.CAW the Lennox Privacy Policy, which can be found at www.lennox.com/legal-privacy.asp. Please see our Privacy Policy for more details about how we manage your personal information. © 2020 Lennox Industries, Inc. Grasslands News 8 September 18, 2020 Fall Agriculture Edition Percy Schmeiser vs Monstanto Sask. farmer’s legal battle made into movie By Alan Hustak nabel Soutar. Schmeiser multinational company Grasslands News lost in the end but he won a license fee. Schmeiser a moral victory when the was a Liberal MLA in the court waived the legal Saskatchewan Legisla- Who would have fees and he didn’t have ture in the 1960s. He be- thought a movie about to pay “one red cent” in lieved that farmers have canola, corn, soybeans damages to Monsanto. a right to use their own and a Saskatchewan The movie raises the farm bred and farmer farmer could be so, uhm, saved seeds and fought damned entertaining? question: where do farm- er’s right begin and Mon- against Monsanto say- SCYTHIA FILMS | GRASSLANDS NEWS Percy, starring Chris- ing. “We have a right to Monsanto movie topher Walken, is sched- santo’s rights end. In 1997, Schmeiser, dis- know what we are eat- Christopher Walken as Saskatchewan farmer Percy Schmeiser, the Saskatch- uled to open in Theatres ing.” Schmeiser says he HZDQIDUPHUZKRWRRNRQ0RQVDQWRLQWKH ·V on October 9. The film, covered genetically modi- fied canola plants growing and his wife Louise, (Ro- tells the story of Percy berta Maxwel in the film) Schmeiser, who farmed in his field near Bruno, Saskatchewan, which he didn’t know whether he near Bruno and who would have a farm or a raged against the Mon- had sprayed with poi- Here to help with all your son, only to discover the house left because of the santo machine in the legal fees. But in the end, plants survived. Curious 1990s and took his inter- he says, “It turned out ACCOUNTING as to why, he saved the nationally publicized case good, and we brought the seeds and planted them to the Supreme Court. world’s attention to what the following year. Mon- NEEDS The movie, which also genetically modified or- santo then sued him for stars Adam Beach and ganisms do and what it Christina Ricci, is based using patented technol- could do to farmers.” on a play, Weeds, by An- ogy without paying the Ironically, because Saskatchewan eliminated Hollywood film tax cred- its in 2012, director Clark Johnson filmed the movie in Manitoba. In a perfect world, it would have been nice to see Eric Peterson, Corporate and Personal Tax Returns the actor from Indian Bookkeeping • Payroll Services Head who originated the role of Percy on stage re- GST Returns • AgriStability • AgriInvest peat the role on screen. And Much More But then, Peterson, one of Canada’s finest actors, 714 Desmond St., Grenfell, SK wouldn’t have the same box office appeal south of 306-697-3510 the border as Walken. 3HUF\6FKPLHVHUVDQGKLVZLIH/RXLVH CALEB VILLAGE Melville’s finest !££f-2$£<9-='8'ধ8'1'2;$311<2-;@ 680-7th Avenue East, Melville, SK • INDEPENDENT LIVING • WELL APPOINTED SUITES Complete with in-suite laundry, full kitchen, appliances, window coverings, balcony and individual heat & air control General Manager: Tracey Schuman 306-728-2035 FARMING IS ESSENTIAL Call for your personal tour and Wishing our area Farmers a Safe Harvest. complimentary lunch! Vahagn’s 100 Halifax Ave W, Melville www.calebgroup.ca Grasslands News www.grasslandsnews.ca September 18, 2020 9 #TIMETODIGDEEPER Producing more potash in Canada is better for the world—and you. Fewer emissions More jobs Billions of dollars for Yet, one-sided Canada our economy only extra costs are making it increasingly ÌðŨÆķăĴĴďÆďĉĨÐĴÐ œðĴìďķīæăďÅăīðŒăĮȘ Scan the QR Code with your mobile phone to visit the website It’s time to dig deeper. Learn more at timetodigdeeper.com Grasslands News 10 September 18, 2020 Fall Agriculture Edition Positioning Canada as a global ag superpower BY KODY BLOIS and industry decision tion focus must also be on wet springs on the prai- and removing inter-pro- place in between. So, let’s making on key agri-food transitioning our agricul- ries, hurricanes in the vincial trade barriers. For use this opportunity to On September 23rd the processing infrastructure ture sector to compete in Atlantic, and non-weath- example, it should not be build back a better ag- Speech from the Throne cannot be devoid of basic the low-carbon economy er-related events such as easier for wine producers riculture sector that is will lay out the broad pol- principles of economies of the future. Approxi- trade disruptions present in Nova Scotia’s Annapo- stronger, more innova- icy objectives of the Gov- of scale and business ef- mately 10% of Canada’s challenges. Reinvestment lis Valley to get a bottle of tive, and well positioned ernment of Canada as we ficacy, there is clearly GHG emissions are tied to by the federal and provin- our signature Tidal Bay to succeed globally and recover from the COVID- room to evaluate ways to agriculture. I do not say cial governments under across the Atlantic Ocean generate greater prosper- 19 pandemic. Positioning protect food security in this despairingly, simply the shared Business Risk than across a provincial ity at home. border to another Cana- Canada’s agriculture sec- regions across the coun- to say that we need to see Management programs to - Kody Blois is the dian province. It’s 2020, tor as a global superpower try. investment to help pro- a return of pre-2013 levels Member of Parliament for are being called for by in- and that needs to change. should be a key focus. Ag- Part of our focus ducers transition where Kings-Hants, Nova Scotia, riculture represents $130 dustry and should be an- Best of all, a focus on should include shoring possible, while develop- serves as a member of the billion to our GDP, it em- up regional capacity do- ing policy to reward those swered. positioning Canada as an Standing Committee on ploys 2.3 million Canadi- mestically, but there is a who are already and will Reducing risk can also agriculture superpower Agriculture and is Chair of ans, approximately one in world of opportunity for continue to sequester car- be achieved by regulatory has relevance across our eight jobs in this country. Canada to position itself bon. reform such as harmoniz- country, from St. John’s the Liberal Rural Caucus. In many respects Canada as a key partner in feed- A skilled workforce is ing provincial standards to Victoria and every- is already an important ing a growing world in a key to any industry, and player on the global stage sustainable manner. The COVID-19 has underlined (Canada is the 5th largest Barton Report noted that the inherent challenges exporter of agriculture the agriculture and agri- the agriculture industry commodities in the world, food industry in Canada faces. A mixture of incen- 11th in agri-food commod- has potential to grow tives to encourage young ities), but our current substantially by serving Canadians to get into standing is not guaran- a growing global popu- the sector, coupled with teed, and we must posi- lation and an increasing an immigration strategy tion ourselves for future middle class of consumers to recruit the best and success in a low-carbon emerging in developing brightest globally who economy where global de- countries. can offer their expertise, mand for food is expected How do we position would be a significant to rise. ourselves accordingly? boost. While labour is COVID-19 has illus- First is a continued key, so too is a renewal trated areas of opportu- focus on innovation and of Canada’s agri-food in- nity. During the height of research. Investments frastructure, with a focus the pandemic it became made under the prai- on advanced technologies evident the extent to rie-based Protein Indus- and automation to ensure which Canada’s agri-food tries Supercluster is a we are globally competi- supply chain has become promising start, but fur- tive. centralized. At the same ther investment in Cana- Finally, we need to be time, Canadians have da’s Agriculture Research mindful of finding ways put an increased focus on and Development Centres to partner with industry where their food is com- with an emphasis of solv- on mitigating risk. While ing from creating a nota- ing regional or sectoral climate change could be a ble uptick in local buying. specific challenges is war- net benefactor for Cana- While government policy ranted. Part of the innova- da’s growing capabilities, Grasslands News www.grasslandsnews.ca September 18, 2020 11 How’s your Portfolio doing? If recent market volatility has left you wondering if you’ll be able to meet your retirement goals, we’re here to offer you a second opinion. Please contact me for a complimentary review of your portfolio. MELANIE GOTTS, B.COMM., CIM Portfolio Manager Raymond James Ltd. 155 3rd Ave East, Melville, SK, S0A 2P0 306-359-2283 [email protected] www.raymondjames.ca/melaniegotts Raymond James Ltd., Member – Canadian Investor Protection Fund. Grasslands News 12 September 18, 2020 Fall Agriculture Edition 2020 Fall Harvest Photos Photo submitted by Howard Pankoski Photo submitted by Joni Mckay Photo submitted by Howard Pankoski Photo submitted by Howard Pankoski Photo submitted by Gloria Duchek BUILT ON FARMER Relationships. Photo submitted by Howard Pankoski Grain Millers is a family-owned company and has been a leader in whole-grain milling for over 30 years. We depend on direct farmer relationships and offer competitive farm gate pricing, agronomy and sustainability advice, and strong markets for your grains. Our commitment to producing quality products begins with you. We Purchase: Photo submitted by Carol Riess Oats • Flax • Barley Wheat • Other Grains Oats/Feed Grains: 306.786.4682 Flax: 306.933.4644 Other Grains: 952.983.1269 grainmillers.com | 866.730.4682 #1 Grain Millers Drive, PO Box 5040, Yorkton, SK S3N 3Z4 Photo submitted by Howard Pankoski Grasslands News www.grasslandsnews.ca September 18, 2020 13 Farm safety is a two-way concern during harvest By Darrell Nesbitt over 35 years. Both oper- flectors when travelling equipment and get appro- time, and to look closely to pass a farm vehicle and Like many aspects of ators of equipment, large on roadways (as required priate permits when ap- at the implement when may be unaware that the farming life, safety is a grain trucks, and smaller in the Highway Traffic plicable. passing or meeting it to equipment is extra wide shared responsibility and vehicles have a role to Act); As a motorist: make sure you know how or long until they are a team effort. It is abso- play when one speaks of • ensure lights, sig- wide and how long it is. in the passing lane. The lutely necessary that ev- safety. nage, and reflectors are • slow down when ap- Most common inci- number of motorists who eryone does their part to Farm safety is a two- visible and clean; proaching farm equip- dents include: left-turn would rather risk their reduce injuries or deaths way concern. With har- • use a pilot vehicle ment; it’s often travelling collisions, rear end col- own lives, and poten- involving machinery and vest now in full swing, the when transporting over- at reduced speeds and lisions and passing colli- tially ours, rather than vehicles. safe transport of grain on sized agricultural equip- taking up considerable sions. Left turn collisions just slowing down – often Farmers and agri- local roads is truly every- ment; amount of room on a occur when a farm ve- passing when its unsafe, cultural workers of all one’s responsibility says • whenever possible, roadway; hicle is about to make the lane is unclear and stripes are unsung heroes the CSC. Make safety the move equipment during • pay attention to turn a left turn and the mo- the distance is underesti- in our daily lives. Their highest priority when the day on secondary signals and possible lane torist behind the tractor mated – is shocking. efforts to provide the na- travelling on a highway roads; changes; decides to pass. Rear end Awareness is key to tion with crops, livestock or rural gravel road. • make sure your • only pass when the collisions happen when keeping our roadways and sustainable sources Reducing the risk of equipment will fit under operator of the equipment a motorist misjudges the safe on busy highways or of food require hard work collisions is not only up power lines along the knows your intentions, or speed when approaching dust-laden roads. Every- that often includes spe- to the farm equipment road and in your yard, it is clearly safe to do so. a slow-moving vehicle. one is expected to share cific safety risks, but pro- operator. Motorists need and on bridge structures The most important This gives the motor- the roads responsibly and ducers are now travelling to be observant and alert along your route (check thing to remember when ist only a few seconds safely. It’s time to use further as farmland has to slow moving farm width and height); approaching farm equip- to react and slow down. caution and be patient, equipment on roadways, become more spread out, • map out your route ment on the road is to Passing collisions result as farming is family life, especially in the early and because of it com- before transporting slow down well ahead of when a motorist attempts and community life. morning and evening bines and grain trucks when most equipment is are travelling greater dis- being moved. tances on public roads. Canada Safety Council As an equipment operator: RESIDENTIAL (CSC) has highlighted the • ensure all machinery importance of diligence is equipped with proper and safety on the farm for lighting, signage and re- A salute to COMMERCIAL Agriculture Producers INDUSTRIAL I would like to express my appreciation AGRICULTURAL to our agriculture community for the enormous contribution you make to our province’s economy. Steven Bonk, MLA MOOSOMIN CONSTITUENCY Phone: 306-435-4005 622 Main St. • Moosomin, SK Proud to Support Agriculture Businesses SINCE 1983 Phyllis Armstrong CPA, CGA For your STRUCTURED Accounting TRENCHING TAXATION Needs CABLING FIRE ALARM EXCAVATION SYSTEMS CERTIFIED 7 Lalonde St. Whitewood,. SK SERVICE CHANGES (306) 735-2284 VOICE/DATA BACK UP [email protected] 4UESDAY TO &RIDAY a.m. to p.m. SOLAR GENERATOR (Closed for lunch) After hours by appointment only SYSTEMS Canora 306-563-5592 Preeceville 306-547-5592 Melville 306-728-5585 Regina 306-359-5592 Yorkton 306-782-5592 Grasslands News 14 September 18, 2020 Fall Agriculture Edition Five facts about farming in Saskatchewan FROM SHEPPARD REALTY of when you hear the that a third of all mustard Of course, it’s not just Saskatchewan is words “Saskatchewan” traded in the world comes quantity that matters. known as Canada’s and “farming.” That said, from Saskatchewan? The Saskatchewan farmers breadbasket, and for good the province produces crop is grown in abun- are also proud to produce reason. That said, our 2.26 million kgs of it every dance in the province, a quality product—while agricultural system ex- year. From fruits that are where the yellow, brown, adhering to high stan- tends far beyond wheat. native to the province and oriental varieties dards for animal health From fruit to eggs and ev- (such as Saskatoon ber- flourish. and welfare. Those in- erything in between, the ries) to those that have While we’ve long been terested in starting their farmers in our provinces been bred to thrive in our known as a mustard own operations should produce high-quality food environmental conditions giant, Saskatchewan is look into the financial that feeds the world. Are (like apples), the variety making new strives to support available through you thinking of joining provided by our growers increase the production the Saskatchewan Egg their ranks? If so, here is incredible. and quality of its plants. Producers’ New Entrant are five Saskatchewan Moving forward, Sas- Recently, Mustard 21 Program. farming facts that will katchewan continues to (a non profit associated truly inspire you. diversify its fruit offer- with the Saskatchewan There were 34,523 farms in ings. Haskap (an edible Mustard Development Saskatchewan exports 90 honeysuckle enjoyed in Commission) completed Saskatchewan in 2016 Japan and Russia) and a research and develop- It’s one of the ultimate Did you know? – Saskatchewan hens produce per cent of Canada’s pulses dwarf sour cherries are ment project aimed at Saskatchewan farming over 32 million dozen eggs a year. A whopping 90 per just two increasingly pop- creating a “Canadian ad- facts: the number of cent of all Canadian pulse ular fruits that are being vantage” for the crop. farms in the province. As rise, which is great for federal funding available exports come from Sas- produced in the province. of 2016 (the last date for the province’s agriculture — and don’t forget that katchewan. Even more In 2017, Saskatchewan which there’s census data industry. If you’re think- real estate and mortgage impressive, our province One third of mustard available), there were ing of starting or expand- professionals with farm- is responsible for 35 per hens produced over 32 over 34,000 Saskatchewan ing on a farm operation, land expertise can answer cent of pulses traded glob- traded globally comes million dozen eggs farms. Notably, the num- you’ll find no shortage any questions you might ally. Those numbers are ber of operators under of opportunities. Look have. from Saskatchewan Saskatchewan is also pretty significant, espe- the age of 35 is on the into the provincial and cially given the popular- No list of Saskatche- a prime place for egg ity of these nutritional wan farming facts would production. Hens in the powerhouses—which in- be complete without a province produced over clude lentils, beans, peas, reference to one of the 32 million eggs in 2017— and chickpeas. world’s most popular con- an increase of 4 per cent Pulses are a great diments. Did you know from the previous year. source of plant-derived THANK YOU protein, fibre, vitamins, and minerals. They also have a low carbon foot- Because farming is Saskatchewan Ag Producers print, require little to no irrigation, and act as natural fertilizers. ESSENTIAL As consumers continue to embrace plant-based diets and eco-friendly lifestyles, Saskatche- Box 129 – 731 Lalonde Street wan’s pulse production Phone (306) 735-2210 will only strengthen its position as a world agri- cultural leader. Dr. Robert Kitchen MP Saskatchewan farmers Souris-Moose Mountain produce 2.26 million kgs of fruit annually 1-866-249-4697 Fruit probably isn’t www.drrobertkitchen.ca the first thing you think CLEARVIEW LIVESTOCK & ARENA Jim & Connie Call Tim at 306.730.9933 Chaplin [email protected] FAIRLAND SEEDS LTD. Your Canola Seed Specialist Melville, Sask. Proud to support local communities • Canola, Corn, Soybean & Forage Seed &HUWLÀHG&URS&RQVXOWDQW 1H[HUD&RQWUDFWV 6DOHV$JHQWIRU1XWULHQ$J6ROXWLRQV $OSLQH3ODQW)RRG0LFUR1XWULHQWV FEATURING:FEATURING: • Indoor & Outdoor Arena • Arena Rental *UDLQ%DJVDQG1HW:UDS s Horse Boarding - Year Round Lessons, • Clinics & %AGALA %QUINE 4HERAPY FOR &AMILIES YOUTH AND *O\SKRVDWH6HHG7UHDWPHQWV,QRFXODQWV STUDENTS #ERTIFIED 4HERAPIST AND %AGALA %QUINE 3PECIALISTS 0RUH3URGXFWV Arena Phone 306 332-7494 Jct. Hwy. #10 & #35 S. Fort Qu’Appelle, SK 6DPH*UHDW6HUYLFH*XDUDQWHHG www.clearviewarena.com Grasslands News www.grasslandsnews.ca September 18, 2020 15 Saskatchewan invests $15 million in agtech Provincial news manufacturing. a record year for venture wan will issue a Request Grasslands News “The proper support, capital investment in Sas- for Proposal (RFP) in the combined with strong katchewan. Deals worth coming weeks to begin ex- research in agricultural $114 million were made ploring fund options with The Government of innovation and the suc- in 2019, more than the the private sector. Saskatchewan announced cess of agtech startups, previous five years com- “Saskatchewan is ris- it will provide $15 million can make Saskatchewan bined, and most of those ing to the challenge of to help develop new tech- a global force in agtech,” investments were made feeding a growing world nologies in agriculture Minister Responsible for in Saskatchewan’s tech population and innova- and position the province Innovation Saskatche- sector. Once a partner tion in agriculture tech- as a global leader in the wan Tina Beaudry-Mellor is found, the $15 million nology plays an important agtech sector. said. “This investment investment is expected to role in meeting that grow- Through Innovation will bring jobs and new leverage millions more ing demand,” Agriculture Saskatchewan, funds will growth to our prov- from private investors, Minister David Marit be invested in a private- ince and equip farm- complementing Innova- said. “This investment ly-managed fund targeted ers and producers with tion Saskatchewan’s ex- will ensure producers exclusively at agtech game-changing technol- isting programs which have made-in-Saskatche- companies that require ogy.” support agtech startups wan technology that sup- venture capital to de- This investment will but are not designed to ports their efforts to grow velop past the startup accelerate the province’s scale companies to full high-quality, sustainable phase and scale up their economic recovery from business capacity. food.” business operations and COVID-19 and build upon Innovation Saskatche- With global demand for food anticipated to tage Innovation Fund, tural infrastructure to Western College of Veterinary Medicine rise 70 per cent by 2050, Saskatchewan Technol- help stimulate the provin- Innovation Saskatchewan ogy Startup Incentive cial economy, add value is helping farmers gain a and the $1 million Agtech to Saskatchewan’s agri- competitive edge to meet Growth Fund (https:// cultural products, and $134 million interprovincial the future by building innovationsask.ca/news/ grow the technology sec- upon a significant and saskatchewan-launches- historic economic driver. 1-million-agtech-growth- tor – all important objec- agreement renewed The agency’s new in- fund) announced in July, tives in Saskatchewan’s Growth Plan 2020-30. Provincial news “This is an important investment vestment, combined with will work with the rest Grasslands News in Manitoba’s agriculture sector that its Saskatchewan Advan- of the province’s agricul- aligns with needs under the Manitoba Protein Advantage Strategy. We need Three provincial governments an- good veterinarians in place to help us You work hard to build your nounced the renewal of their financial practice safe animal welfare and keep commitment to the University of Sas- business. Don’t make people growing animal agriculture in Mani- katchewan’s Western College of Veter- toba.” >380,!8&;3)2&@3 • Personal Insurance • Hail Insurance 775 Broadway St. W. - Hwy. #52 West • Farm Insurance • Health Insurance Yorkton, SK • Commercial Insurance • Motor Licence Issuer Open Monday to Friday: • Notary Public 8:00 a.m. to 12:00 noon • and 1:00 to 5:30 p.m. Business Hours: Telephone: (306) 783-6122 Tuesday to Friday: 9:00 a.m.-12:00 noon & 1:00 to 5:00 p.m. www.smithsteelservice.com Saturday: 9:00 a.m. -12:00 noon Sunday & Monday - CLOSED Grasslands News 16 September 18, 2020 Fall Agriculture Edition Column Grandkids, breakdowns and harvest all part of farm live By Donna Beutler – those kayaking and pad- so much fun for them as us (50% children) gather for Grasslands News dleboard moments, our riding around in the com- around for a meal in the great fishing days and bine hour after hour after field lovingly prepared somehow, about Grand- The Lighter Side of hour. They take their (well, prepared anyhow) Lake time has long pa’s ‘farm’ half-ton (the lunch with them and they by myself or our daugh- since come to an end as Life... replacement for the one hop out for Grandma’s ter-in-law. Sometimes the it so inevitably does each stolen in February) that tailgate suppers in the food’s a bit cold and a bit summer and our trusty was now in the shop for DOWN ON THE FARM field and back they go sparse by the time the RV has left its beach-side repair (for the second combining. last one eats but since it summer home and settled time in five months). One September day as doesn’t look like any of us back into its spot next to One of the twins (nine) byy donna beutler they rode along with me are starving, I suspect we the farm shop with that said to me, “Grandpa’s on the combine, they had are doing okay, food-wise. down-on-the-farm view farm truck breaks down [email protected] some pointers for me: This harvest season of both the chicken coop all the time.” Without “Grandma, maybe lift the has been an absolute treat and the dog house, all missing a beat, the other pickup a bit.” “Grandma, compared to last year ready to become the cook chimed in, “Because it’s a was pretty sure a farm- he said he’d missed the don’t pay attention to the when I think most of har- shack/harvest sleeping Ford.” yard burial was not going toilet ‘just a little bit.’ I ground speed, look at the vest was done in October. quarters. “Whoa, whoa, whoa,” to cut it. And I had never told him no worries, that fan speed.” “Grandma, This year, we harvested Those special sum- I said. “Let’s talk about raised chickens myself so happens sometimes and back up and grab the a fair bit of the 2020 crop mer-time moments were your two-year-old Dodge I couldn’t bank on expe- I would get it cleaned canola the wind blew in August and that felt oh being recounted by my that left your Mom and rience. up. “Oh don’t worry, out of the swath.” I told so good. Life on the farm grandchildren and I as Dad sitting on the side As it was, the solution Grandma I put a cloth on them Grandpa would may have its challenges we were sitting on the of the road the day they seemed to be to chuck it.” A cloth? Yup, there just have to pick up the from year to year but back deck the other day were coming to pick you it in the lagoon and so was a lovely teal-coloured odds and ends but I was what’s most interesting up from the lake. I don’t there was our daughter, facecloth placed as flat duly informed that that’s is watching the delight think we ought to be dead chicken in hand and as neatly as could “not how we do it!” As of the younger genera- %(/2:)$&725< coming down so hard on with her eight-year-old be (he has some OCD for climbing the hill full, tion as they become more Grandpa’s Ford.” daughter not far away, tendencies) on the floor they thought maybe I and more ingrained in all ',5(&735,&,1* Pause. And then I ready to chuck this thing right next to the toilet. ought to dump ahead of things ‘farm.’ Agriculture heard: “Well, Grandpa’s into the lagoon when she As I walked in, carrying time especially with the is definitely making a big breaks down lots but hears: “Mom, don’t fall the Lysol spray and the hopper topper pretty full. impact on these farmers- 61$3/2&.+,''(1 when ours breaks down, in! I don’t know how I’ll paper towel, he was wash- Good thinking, boys, good in-the-making. )$67(1(5 it breaks down good.” get back to town ‘cause ing his hands. I didn’t say thinking! Did I mention And so, to all our Ahhh yes, that’s more Dad is working.” And so anything as I walked past they are nine? farmer readers, we wish 67((/522),1*12:$9$,/$%/( like it! And the Ford/ it seemed she was more him and that’s when he On a day when the you a happy harvesting Dodge debate promises to worried about how she said in the cheeriest of combines weren’t roll- season! May you delight 6758&785$/67((/'($/(5 continue I am quite sure! would get home if her voices: “You’re welcome ing, I took them ATVing each day in the ever-tran- *UDGH&RORXUHG One weekend, while mom drowned in the la- for that, Grandma!” And across the field. In the sitioning skies and the VTIW our son and his family goon than if her mom ac- away he went! distance we could see the sun as it sets on the hori- were away, our daugh- tually drowned. One day just before swather cutting canola on zon; the combines as they %*UDGH&RORXUHG ter was on chicken/egg In August, I had the harvest began, the kids Grandpa’s field. “What roll across the acres tak- ##VTIW picking duty at their pleasure of two young and I were driving across the heck!” one exclaimed. ing you ever closer to the %*UDGH*DOYDQL]HG farm and, as sometimes grand-visitors coming for the farmyard on our way And then the other: “Why finish line; and the mo- #!VTIW happens, a chicken had a couple of weeks. They to the farm next door is Grandpa swathing ments when you are re- died and she needed to were excited to do meals when I said to the twins, straight-cut variety?” minded that even during 0XOWL&RORXUHG0LOO(QGV dispose of it. Her text to in the field, spend some “Now why wouldn’t the And while I didn’t likely a busy, stressful day, the VTIW me (as I was on the boat nights in the camper at guys line the augers up have the best answer most important things in in the middle of the lake) the farm, spend some time neatly in a row? One is (“Because, ahhh, because life are not things at all, was, ‘What do I do with with their cousins, and over there facing east, …), I thought to myself, but rather the people in 'LVFRXQWHG this dead chicken?’ My just have some good old another over there facing ‘How would they even your life who share your %*UDGH&RORXU response came with some play time. When my six- south ….” They looked at remember that that field love of the land and your 2UDQJH intensity of thought: year-old grandson called me with a strange look was straight-cut variety passion for a way of life VTIW ‘Mmmmmmm.’ I know me from the bathroom (I am not OCD about anyhow, and further- like no other. that when you have farm one day as I was prepping much, but I like a very more, why would they [ [6RIILW%RDUG dogs, you best not let them supper to take to the field neat and tidy ‘machinery even care.’ VKHHW get a taste of chicken so I (and in a hurry as usual), row.’ With a laugh, they My meals on wheels GET IT &DOOXVQRZIRUEHVWVHOHFWLRQ said, “Cause we are al- continue to be the tail- RIOHQJWKV FRORXUV ways using the augers to gate variety, no matter move grain. What does the weather. I keep wish- WEEKLY 1RZVHOOLQJ6HSWLF7DQNV it matter how they are ing for my pie-in-the-sky 1RZVHOOLQJ6FUHZ3LOHV parked.” Well, there’s dream motorhome (field Join the more than $VNXVDERXW that, I thought to myself. variety) but some dreams )XHO$OORZDQFH Still, everytime I go past just never come true, or 12,000 readers who a hodge podge mix of au- so my husband tells me enjoy and support )28,//$5'67((/ gers parked this way and as he rolls his eyes at my the local newspaper. that, a little shudder rip- literal meals on wheels Subscribe for as little 6833/,(6/7' ples through me. dream vehicle. Hey, it’s ZZZIRXLOODUGVWHHOFRP These young farm- all about the dust, don’t as $37.80 a year! 67/$=$5(0% hands have been in their you think? We eat a lot 1-844-GNG-NEWS glory for much of Au- of it. [email protected] WF gust as nothing is quite Sometimes a dozen of Thanks for Helping HILLSIDE WELDING Feed the World Keith Lang, Melville SK 1-306-728-4095 Services • Welding • Hydraulic Hose • !#8-$!ধ2+ Repair • Break Work • Grade 5 & 8 • For all your insurance needs. Shearing Bolts Residential - Commercial • Aluminum • Metric Bolts Auto - Hail - Farm • Reynolds • Trailer Parts Roller Chain • Mobile Unit OPEN • Bearings Monday thru Friday Balcarres Agencies Ltd. :00 p.m 9:00 a.m. - . open over lunch 216 Main Street, Balcarres, SK, Box 970, S0G 0C0 To everyone in the Agricultural Industry of Phone: (306) 334-2401 — Fax: (306) 334-2705 Email: balcarresagencies@TBTLUFMOFU — Website: www.balcarresagencies.saskbrokers.com Saskatchewan, have a safe harvest season. Grasslands News www.grasslandsnews.ca September 18, 2020 17 Canadian Agricultural Youth Council Helping shape the future of agriculture and food Provincial News of the group’s meetings, a voice to young people Canada’s strong agenda and mental health. Over wide range of important Grasslands News their perspectives will and women, whose con- for agriculture and agri- the coming months, the issues, all while devel- help to articulate Cana- tributions are essential to food and continue to Council will also meet oping leadership skills da’s vision and the pro- our economic growth and The inaugural meeting build diversity across the with policy leaders, as grams that will result to the vitality of our re- and building professional of the Canadian Agricul- agricultural sector. well as senior departmen- tural Youth Council was from it, leading to a sus- gions,” said Bibeau. Discussions at the tal officials. relationships. They will held earlier this month, tainable and prosperous Canada’s agricultural inaugural meeting fo- Members will have the help advise the Minister agriculture and agri-food sector is an import- where 25 members who cused on various issues, opportunity to offer sug- and the Department on were selected from over sector. ant driver of economic including the future of gestions on Government “Young Canadians in growth, responsible for agriculture-related poli- 800 applicants from across the sector, sustainable priorities, as well as to the agriculture and agri- one in eight jobs in Can- the country, shared their agriculture, rural vital- identify problems and cies and programs that food sector are engaged ada. The sector contrib- perspectives on the future ity, skills and labour, propose solutions on a are important to them. of the sector. and passionate. The utes over $143 billion to Marie-Claude Bibeau, Youth Council is a signifi- our gross domestic prod- Minister of Agriculture cant opportunity for them uct and over $66 billion and Agri-Food partici- to be heard and to influ- in agri-food exports. pated in the meeting, say- ence the future of the sec- Earlier this year, Min- ing that the government tor. As the first woman ister Bibeau announced wants young people to be federal Minister of Agri- the creation of the Cana- able to share their aspi- culture, I am increasing dian Agricultural Youth rations. Over the course the opportunities to give Council to help bolster GET IT WEEKLY Join the more than Premier Realty 12,000 readers who enjoy and support the local newspaper. Selling Saskatchewan Subscribe for as little Grain farms, Ranches, as $37.80 a year! 1-844-GNG-NEWS Organic farms and [email protected] Acreages. Call for competitive rates. Book an appointment today. Larry Hanowski Melville, Sask. Cell: 306-728-9033 Email: [email protected] Web: www.langenburgrealestate.ca Every operation is unique. Your advice should be too. Our experienced and knowledgeable agriculture account managers can help you reach your specifi c GROWING YOUR WORK OF ART business goals. Whether you’re looking to expand your operation, pass it to the next generation or ® you’re focused on managing risks, we’re here to From almost any angle, the visionary design in Proven Seed shines through. Our leading-edge technology offers a help you succeed. whole new perspective on canola, cereals, corn, soybeans and forages. Whether you’re looking for high yields and performance from every seed across all acres, or specific herbicide systems and disease management, we know Sandra Hollinger RBC Melville Branch there’s a Proven Seed that fits your vision of success. Only available at your local Nutrien Ag Solutions™ retail. 306-621-5347 303 Main Street [email protected] 306-728-6545 Learn more at ProvenSeed.ca Commercial Account Manager Visit rbc.com/agriculture to learn more ® / ™ Trademark(s) of Royal Bank of Canada. 124817 (09/2020) Proven® Seed is a registered trademark of Nutrien Ag Solutions (Canada) Inc. Nutrien Ag Solutions™ and Design is a trademark of Nutrien Ag Solutions, Inc. 07/20-72516-1 Grasslands News 18 September 18, 2020 Fall Agriculture Edition Canada and Saskatchewan Governments join forces with ranchers to protect biodiversity in Saskatchewan Provincial News said. “We are especially thankful to the ranchers who Grasslands News will continue their great work as stewards of the pas- tures on the land.” “Saskatchewan ranchers play an important role in As Canadians, we are fortunate to have an abun- our pasture biodiversity and protecting the environ- dance of nature in our backyards – a gift that comes ment,” Marit said. “Our cattle producers are the best with a tremendous amount of responsibility to protect stewards of the land and they serve a vital role in it. preserving native prairie landscapes.” Earlier this month, the Minister of Environment “The certainty of continued access to the pastures and Climate Change, Jonathan Wilkinson along with for sustainable cattle grazing while maintaining the Minister of Agriculture and Agri-Food, Marie-Claude ecological and environmental benefits of these grass- Bibeau, and Saskatchewan Agriculture Minister David lands is important for ranchers,” Battle Creek Pas- Marit announced a land exchange that will allow the ture Patron David McLeod said. “We look forward federal and provincial governments to work with the to continuing to build on the cooperative relationship ranching community to conserve prairie grasslands in we have established with Environment and Climate southwestern Saskatchewan. Change Canada.” This land exchange helps Canada work toward its In 2017, the Government of Canada confirmed its goal of conserving a quarter of its land and a quarter desire to acquire and manage these pastures, covering of its oceans by 2025. an area of 800 km2. As part of this agreement, Canada Environment and Climate Change Canada (ECCC) acquires land from Saskatchewan valued at $64 mil- will acquire Govenlock, Nashlyn and Battle Creek lion for conservation purposes, in exchange for trans- pastures from Saskatchewan, and manage them for ferring land valued at $64 million to Saskatchewan the conservation of species at risk and migratory for efficient operation of pastures as provincial leased birds, while continuing sustainable cattle grazing. lands. The area is recognized nationally and interna- Livestock grazing mimics traditional disturbance by tionally for its significant concentration of migratory plains bison and maintains the health and quality of birds and grassland birds. the grasslands. ECCC, Agriculture and Agri-Food Canada and Sas- In return, Saskatchewan will acquire federal lands katchewan engaged local ranchers, communities and and improvements, such as fencing, barns, and cor- Indigenous People regarding the transfer of lands and rals, of equivalent value in 55 former federal com- administration. First Nations and the Métis Nation of munity pastures that have transitioned to producer Saskatchewan and ECCC are working to establish an control. This land exchange will simplify and improve Indigenous Advisory Committee to include Indigenous land management, enabling the efficient production of perspectives as a core partner in the ongoing manage- beef cattle, while supporting biodiversity. ment of these lands. Govenlock, Nashlyn and Battle Creek pastures Patrons from the Govenlock, Nashlyn and Battle cover an area of 800 km2 and are an excellent exam- Creek pastures were actively involved in the develop- ple of how governments, ranchers, and conservation ment of the operational model that was used for the groups can work together to protect iconic Canadian past two years and that will continue to be used in the species. Through collaboration, a strategy was devel- future. This area supports habitat for 10 species at risk oped to manage the pastures in an economically, so- SUBMITTED | GRASSLANDS NEWS including Swift Fox, Sprague’s Pipit, Chestnut-collared Prairie preservation cially and environmentally responsible way to support Longspur, McCown’s Longspur, Greater Sage Grouse, The Govenlock (top) and Nashlyn (bottom) were livestock production, wildlife habitat protection and Burrowing Owl, Ferruginous Hawk, Mountain Plover, part of the land exchange to conserve prairie farm- local and Indigenous community interests. Long-billed Curlew and Northern Leopard Frog. “The Government of Canada is pleased to work land in Saskatchewan. with the Province of Saskatchewan, ranchers, and In- digenous leaders on this important land transfer in southwestern Saskatchewan,” Wilkinson said. “To- gether, we are protecting iconic Canadian biodiver- sity, including 10 species at risk, for generations to come. Congratulations to everyone who worked so hard over the years to make this transfer a reality.” “This is a wonderful story of collaboration between many different groups to preserve the environmental- ly-significant grasslands and achieve our goal of pro- tecting 25 per cent of Canadian land by 2025,” Bibeau 15 - 8th Avenue North, Yorkton 1-306-786-6607 '><-£&38'23=!ধ323( Kitchen Cabinets, Quartz or Laminate Countertops, Special Projects We serve East-Central Saskatchewan and West-Central Manitoba During Saskatchewan Agriculture Month, we celebrate an industry that faces adversity each year, yet continues to make our province a place for growth and innovation. Conexus Credit Union tips our hat to you. 1.800.667.7477 conexus.ca email: [email protected] website: www.premiercabinetsltd.ca Grasslands News www.grasslandsnews.ca September 18, 2020 19 A&&2817,1* • TAX • ADVISORY ALWAYS KNOW WHAT’S BELOW Farming and agriculture &DQDGD¶V IDUPLQJ DQG DJULFXOWXUH LQGXVWU\ LV FRQWHQGLQJ CLICKING or CALLING before you dig costs nothing. ZLWK HVFDODWLQJ GHPDQGV SDUWLDOO\ GXH WR FKDQJLQJ NOT CLICKING or CALLING could cost you and your JRYHUQPHQW SROLFLHV PDUNHW WUHQGV DQG HQYLURQPHQWDO neighbours everything! LQIOXHQFHV $GGLWLRQDO FKDOOHQJHV VXFK DV WKH LQFUHDVHG FRVW RI GRLQJ EXVLQHVV DQG DFFHVVLQJ FDSLWDO UHTXLUH The SASKATCHEWAN COMMON GROUND LQQRYDWLYHILQDQFLDODGYLFHDQGVROXWLRQV:LWKGHFDGHVRI ALLIANCE and SASK 1ST CALL reminds everyone to H[SHULHQFH DQG H[WHQVLYH H[SHUWLVH LQ WKH LQGXVWU\ WKH 8'7<'9;!£3$!;'(38<2&'8+83<2&<ধ£-;@£-2'9;3#' SURIHVVLRQDOVDW%DNHU7LOO\&DQDGDEULQJFODULW\WRWRGD\¶V marked prior to any ground disturbance like digging. DJULEXVLQHVVHVSURGXFHUVDQGSURFHVVRUV Local roots, global horizons = financial clarity ALWAYS DIG SAFE! Connect with us www.scga.ca bakertilly.ca Now, for tomorrow Yorkton 306.783.8531 | \RUNWRQ#EDNHUWLOO\FD Enjoy the season. Without the stress. This winter, shake off the snow and come try retirement living with us. We offer special winter stays that let you enjoy the season in style, including spacious suites, comfort foods and the warmth of good company. Call today to learn more. The Bentley 94 Russell Dr, Yorkton 306-782-5552 • reveraliving.com Grasslands News 20 September 18, 2020 Fall Agriculture Edition Your ears deserve an AUDIOLOGIST Your Trusted Source For Hearing Assessments & Hearing Aids 3@3<)2&@3<89'£(!90-2+3;,'89;38'6'!;;,'19'£='9#'$!<9'@3<$3<£&2Z; ,'!8;,'1$£'!8£@38!;!££S8'93<2&91<Đ'&23>>,'2;,'@<9'&;3#'£3<&!2& $£'!8S<8;'!1!;<23<2;8@ '!8-2+;&W-2 9;'=!2T!2& 380;32 '!8-2+ '8=-$'9-2 380;32TT,!=','£6'&8'9-&'2;9T!2&;,'9<883<2&-2+!8'!9>-;, ,'!8-2+!99'991'2;9!2&,'!8-2+!-&9W <23<2;8@ '!8-2+;&W!2& 380;32 '!8-2+'8=-$'9!8'#3;,£3$!££@3>2'& !2&36'8!;'&!8';,'32£@,'!8-2+$£-2-$9-2;,'!8'!>,3$!29'8='$,-£&8'2!9 >'££!9!&<£;9W Contact us Today! 418 Kensington Ave. #5 Estevan, SK #18 First Avenue N. Yorkton, SK 306-636-3277 306-782-1793 www. suncountryhearing.com www.yorktonhearing.com