SLIT3 (NM 003062) Human Untagged Clone – SC118202 | Origene
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
PRODUCT SPECIFICATION Product Datasheet
Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST SLIT3 Mass Spectrometry Protein Standard Product Number QPrEST21571 Protein Name Slit homolog 3 protein Uniprot ID O75094 Gene SLIT3 Product Description Stable isotope-labeled standard for absolute protein quantification of Slit homolog 3 protein. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG fusion tag) QVVREVIRRQKGYASCATASKVPIMECRG Theoretical MW 26448 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use. -
Supplementary Table 1: Adhesion Genes Data Set
Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like, -
Slit Proteins: Molecular Guidance Cues for Cells Ranging from Neurons to Leukocytes Kit Wong, Hwan Tae Park*, Jane Y Wu* and Yi Rao†
583 Slit proteins: molecular guidance cues for cells ranging from neurons to leukocytes Kit Wong, Hwan Tae Park*, Jane Y Wu* and Yi Rao† Recent studies of molecular guidance cues including the Slit midline glial cells was thought to be abnormal [2,3]. family of secreted proteins have provided new insights into the Projection of the commissural axons was also abnormal: mechanisms of cell migration. Initially discovered in the nervous instead of crossing the midline once before projecting system, Slit functions through its receptor, Roundabout, and an longitudinally, the commissural axons from two sides of the intracellular signal transduction pathway that includes the nerve cord are fused at the midline in slit mutants [2,3]. Abelson kinase, the Enabled protein, GTPase activating proteins Because the midline glial cells are known to be important and the Rho family of small GTPases. Interestingly, Slit also in axon guidance, the commissural axon phenotype in slit appears to use Roundabout to control leukocyte chemotaxis, mutants was initially thought to be secondary to the cell- which occurs in contexts different from neuronal migration, differentiation phenotype [3]. suggesting a fundamental conservation of mechanisms guiding the migration of distinct types of somatic cells. In early 1999, results from three groups demonstrated independently that Slit functioned as an extracellular cue Addresses to guide axon pathfinding [4–6], to promote axon branching Department of Anatomy and Neurobiology, and *Departments of [7], and to control neuronal migration [8]. The functional Pediatrics and Molecular Biology and Pharmacology, Box 8108, roles of Slit in axon guidance and neuronal migration were Washington University School of Medicine, 660 S Euclid Avenue St Louis, soon supported by other studies in Drosophila [9] and in Missouri 63110, USA *e-mail: [email protected] vertebrates [10–14]. -
Prediction of Human Disease Genes by Human-Mouse Conserved Coexpression Analysis
Prediction of Human Disease Genes by Human-Mouse Conserved Coexpression Analysis Ugo Ala1., Rosario Michael Piro1., Elena Grassi1, Christian Damasco1, Lorenzo Silengo1, Martin Oti2, Paolo Provero1*, Ferdinando Di Cunto1* 1 Molecular Biotechnology Center, Department of Genetics, Biology and Biochemistry, University of Turin, Turin, Italy, 2 Department of Human Genetics and Centre for Molecular and Biomolecular Informatics, University Medical Centre Nijmegen, Nijmegen, The Netherlands Abstract Background: Even in the post-genomic era, the identification of candidate genes within loci associated with human genetic diseases is a very demanding task, because the critical region may typically contain hundreds of positional candidates. Since genes implicated in similar phenotypes tend to share very similar expression profiles, high throughput gene expression data may represent a very important resource to identify the best candidates for sequencing. However, so far, gene coexpression has not been used very successfully to prioritize positional candidates. Methodology/Principal Findings: We show that it is possible to reliably identify disease-relevant relationships among genes from massive microarray datasets by concentrating only on genes sharing similar expression profiles in both human and mouse. Moreover, we show systematically that the integration of human-mouse conserved coexpression with a phenotype similarity map allows the efficient identification of disease genes in large genomic regions. Finally, using this approach on 850 OMIM loci characterized by an unknown molecular basis, we propose high-probability candidates for 81 genetic diseases. Conclusion: Our results demonstrate that conserved coexpression, even at the human-mouse phylogenetic distance, represents a very strong criterion to predict disease-relevant relationships among human genes. Citation: Ala U, Piro RM, Grassi E, Damasco C, Silengo L, et al. -
Conserved Modularity and Potential for Alternate Splicing in Mouse and Human Slit Genes
Int. J. Dev. Biol. 46: 385-391 (2002) Conserved modularity and potential for alternate splicing in mouse and human Slit genes MELISSA LITTLE*, BREE RUMBALLE1, KYLIE GEORGAS, TOSHIYA YAMADA and ROHAN D. TEASDALE Institute for Molecular Bioscience and Centre for Functional and Applied Genomics, University of Queensland, St. Lucia, Australia and 1Department of Biochemistry, University of Queensland, St. Lucia, Australia ABSTRACT The vertebrate Slit gene family currently consists of three members; Slit1, Slit2 and Slit3. Each gene encodes a protein containing multiple epidermal growth factor and leucine rich repeat motifs, which are likely to have importance in cell-cell interactions. In this study, we sought to fully define and characterise the vertebrate Slit gene family. Using long distance PCR coupled with in silico mapping, we determined the genomic structure of all three Slit genes in mouse and man. Analysis of EST and genomic databases revealed no evidence of further Slit family members in either organism. All three Slit genes were encoded by 36 (Slit3) or 37 (Slit1 and Slit2) exons covering at least 143 kb or 183 kb of mouse or human genomic DNA respectively. Two additional potential leucine-rich repeat encoding exons were identified within intron 12 of Slit2. These could be inserted in frame, suggesting that alternate splicing may occur in Slit2. A search for STS sequences within human Slit3 anchored this gene to D5S2075 at the 5’ end (exon 4) and SGC32449 within the 3’ UTR, suggesting that Slit3 may cover greater than 693 kb. The genomic structure of all Slit genes demonstrated considerable modularity in the placement of exon-intron boundaries such that individual leucine-rich repeat motifs were encoded by individual 72 bp exons. -
Die Rolle Intragenischer Mirna in Der Regulation Ihrer Host-Gene
Aus der Klinik für Anaesthesiologie Klinikum der Ludwig-Maximilians-Universität München Direktor: Professor Dr. Bernhard Zwißler Die Rolle intragenischer miRNA in der Regulation ihrer Host-Gene Als kumulative Habilitationsschrift Zur Erlangung des akademischen Grades eines habilitierten Doktors der Medizin an der Ludwig-Maximilians-Universität München Vorgelegt von Ludwig Christian Giuseppe Hinske (2017) 2 Hintergrund Micro-RNAs (miRNAs) sind kleine, nicht-kodierende RNA-Sequenzen. Lee und Kollegen beschrieben in den 90er Jahren erstmals, dass das für die larvale Entwicklung notwendige Gen lin-4 nicht in ein Protein translatiert wird, sondern dessen Transkript über basenkomplementäre Interaktion mit dem 3´-Ende des Transkripts des Gens lin-14 dessen Translation epigenetisch negativ regulieren kann (R. C. Lee, Feinbaum, & Ambros, 1993). Die Entdeckung war revolutionär, da bis zu diesem Zeitpunkt davon ausgegangen wurde, dass nicht-translatierte RNA lediglich ein Abfallprodukt ohne relevante biologische Funktion sei. Erst einige Zeit später, im Jahr 2001, zeigten Lagos- Quintana und seine Kollegen, dass miRNAs in einer Vielzahl von Organismen nachweisbar sind, unter anderem in menschlichen Zellen. Außerdem beschrieben sie, dass miRNAs nicht nur organismus-, sondern auch gewebespezifisch exprimiert werden (Lagos-Quintana, Rauhut, Lendeckel, & Tuschl, 2001). Daraufhin stieg die Anzahl der Arbeiten, die sich mit der Rolle von miRNAs in der Pathogenese verschiedenster Erkrankungen beschäftigten, exponentiell an (Chan, Krichevsky, & Kosik, 2005; Hammond, 2006; Xie et al., 2005). Heutzutage ist man sich der zentralen Rolle von miRNAs als Regulatoren physiologischer Signalkaskaden bewusst (Ledderose et al., 2012; Martin et al., 2011; Tranter et al., 2011; Yan, Hao, Elton, Liu, & Ou, 2011). Trotz intensiver Forschungsbemühungen sind allerdings viele Fragen im Bereich der miRNA-Forschung nicht ausreichend beantwortet. -
Transcriptome Profiling Reveals the Complexity of Pirfenidone Effects in IPF
ERJ Express. Published on August 30, 2018 as doi: 10.1183/13993003.00564-2018 Early View Original article Transcriptome profiling reveals the complexity of pirfenidone effects in IPF Grazyna Kwapiszewska, Anna Gungl, Jochen Wilhelm, Leigh M. Marsh, Helene Thekkekara Puthenparampil, Katharina Sinn, Miroslava Didiasova, Walter Klepetko, Djuro Kosanovic, Ralph T. Schermuly, Lukasz Wujak, Benjamin Weiss, Liliana Schaefer, Marc Schneider, Michael Kreuter, Andrea Olschewski, Werner Seeger, Horst Olschewski, Malgorzata Wygrecka Please cite this article as: Kwapiszewska G, Gungl A, Wilhelm J, et al. Transcriptome profiling reveals the complexity of pirfenidone effects in IPF. Eur Respir J 2018; in press (https://doi.org/10.1183/13993003.00564-2018). This manuscript has recently been accepted for publication in the European Respiratory Journal. It is published here in its accepted form prior to copyediting and typesetting by our production team. After these production processes are complete and the authors have approved the resulting proofs, the article will move to the latest issue of the ERJ online. Copyright ©ERS 2018 Copyright 2018 by the European Respiratory Society. Transcriptome profiling reveals the complexity of pirfenidone effects in IPF Grazyna Kwapiszewska1,2, Anna Gungl2, Jochen Wilhelm3†, Leigh M. Marsh1, Helene Thekkekara Puthenparampil1, Katharina Sinn4, Miroslava Didiasova5, Walter Klepetko4, Djuro Kosanovic3, Ralph T. Schermuly3†, Lukasz Wujak5, Benjamin Weiss6, Liliana Schaefer7, Marc Schneider8†, Michael Kreuter8†, Andrea Olschewski1, -
SLIT3 Sirna (Mouse)
For research purposes only, not for human use Product Data Sheet SLIT3 siRNA (Mouse) Catalog # Source Reactivity Applications CRM3794 Synthetic M RNAi Description siRNA to inhibit SLIT3 expression using RNA interference Specificity SLIT3 siRNA (Mouse) is a target-specific 19-23 nt siRNA oligo duplexes designed to knock down gene expression. Form Lyophilized powder Gene Symbol SLIT3 Alternative Names Slit homolog 3 protein; Slit-3; Slit3 Entrez Gene 20564 (Mouse) SwissProt Q9WVB4 (Mouse) Purity > 97% Quality Control Oligonucleotide synthesis is monitored base by base through trityl analysis to ensure appropriate coupling efficiency. The oligo is subsequently purified by affinity-solid phase extraction. The annealed RNA duplex is further analyzed by mass spectrometry to verify the exact composition of the duplex. Each lot is compared to the previous lot by mass spectrometry to ensure maximum lot-to-lot consistency. Components We offers pre-designed sets of 3 different target-specific siRNA oligo duplexes of mouse SLIT3 gene. Each vial contains 5 nmol of lyophilized siRNA. The duplexes can be transfected individually or pooled together to achieve knockdown of the target gene, which is most commonly assessed by qPCR or western blot. Our siRNA oligos are also chemically modified (2’-OMe) at no extra charge for increased stability and enhanced knockdown in vitro and in vivo. Directions for Use We recommends transfection with 100 nM siRNA 48 to 72 hours prior to cell lysis. Application key: E- ELISA, WB- Western blot, IH- Immunohistochemistry, -
Array-Based Profiling of the Differential Methylation Status of Cpg Islands in Hepatocellular Carcinoma Cell Lines
ONCOLOGY LETTERS 1: 815-820, 2010 Array-based profiling of the differential methylation status of CpG islands in hepatocellular carcinoma cell lines BIN-BIN LIU, DAN ZHENG, YIN-KUN LIU, XIAO-NAN KANG, LU SUN, KUN GUO, RUI-XIA SUN, JIE CHEN and YAN ZHAO Liver Cancer Institute, Zhongshan Hospital of Fudan University, Shanghai 200032, P.R. China Received February 8, 2010; Accepted June 26, 2010 DOI: 10.3892/ol_00000143 Abstract. Alterations in the DNA methylation status particularly genes was linked to the pathogenesis of various types of in CpG islands are involved in the initiation and progression of cancer, and tumor-specific methylation changes were estab- many types of human cancer. A number of DNA methylation lished as prognostic markers in numerous tumor entities (3). alterations have been reported in hepatocellular carcinoma Unlike genetic modifications, such as mutations or genomic (HCC). However, a systematic analysis is required to elucidate imbalances, epigenetic changes are potentially reversible, the relationship between differential DNA methylation status making these changes particularly important therapeutic targets and the characteristics and progression of HCC. In the present in cancer and other diseases (4). study, a global analysis of DNA methylation using a human In recent years, different techniques have been developed CpG-island 12K array was performed on a number of HCC for the genome-wide screening of CGI methylation status. cell lines of different origin and metastatic potential. Based on Included is differential methylation hybridization (DMH) a standard methylation alteration ratio of ≥2 or ≤0.5, 58 CpG which is a high-throughput DNA methylation screening tool island sites and 66 tumor-related genes upstream, downstream that utilizes methylation-sensitive restriction enzymes to or within were identified. -
1 Whole Genome Sequencing and Rare Variant Analysis in Essential
bioRxiv preprint doi: https://doi.org/10.1101/248443; this version posted January 16, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. 1 2 Whole Genome Sequencing and Rare Variant Analysis in Essential Tremor 3 Families 4 5 Zagaa Odgerel1, Nora Hernandez2, Jemin Park2, Ruth Ottman3,4,5,6, Elan D. Louis2 and 6 Lorraine N. Clark1,7 7 8 9 1Department of Pathology and Cell Biology, College of Physicians and Surgeons, 10 Columbia University New York NY 10032 USA. 11 2Department of Neurology, Yale School of Medicine, Yale University, New Haven, CT 12 06510, USA; Department of Chronic Disease Epidemiology, Yale School of Public 13 Health, New Haven, CT 06510, USA. 14 3G.H Sergievsky Center, Columbia University, New York, NY 10032 USA. 15 4Department of Neurology, College of Physicians and Surgeons, Columbia University 16 New York, NY 10032 USA. 17 5Department of Epidemiology, Mailman School of Public Health, Columbia University, 18 NY 10032 USA. 19 6Division of Epidemiology, New York State Psychiatric Institute, New York NY 10032 20 USA. 21 7Taub Institute for Research on Alzheimer’s Disease and the Aging Brain, College of 22 Physicians and Surgeons, Columbia University, New York, NY 10032 USA. 23 24 25 26 1 bioRxiv preprint doi: https://doi.org/10.1101/248443; this version posted January 16, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. -
Integration of Large-Scale Genomic Data Sources with Evolutionary History
Integration of Large-scale Genomic Data Sources with Evolutionary History Reveals Novel Genetic Loci for Congenital Heart Disease Running title: Fotiou et al.; Ohnologs in congenital heart disease Elisavet Fotiou, MRes1, Simon Williams, PhD1, Alexandra Martin-Geary, MSc2, David L. Robertson, PhD2,3, Gennadiy Tenin, PhD1, Kathryn E. Hentges, PhD2, Bernard Keavney, MD1,4 1Division of Cardiovascular Sciences, School of Medical Sciences, Faculty of Biology, Medicine, and Health, Manchester Academic Health Science Centre, University of Manchester, Manchester, UK, 2Division of Evolution and Genomic science, University of Manchester, Manchester, 3MRC-University of Glasgow Centre for Virus Research, Glasgow, 4Manchester Heart Centre, Manchester University NHS Foundation Trust, Manchester Correspondence: Professor Bernard D. Keavney Miss Elisavet Fotiou The University of Manchester The University of Manchester AV Hill Building AV Hill Building Manchester, M13 9PT Manchester, M13 9PT United Kingdom United Kingdom Tel: 44 (0)161 275 1201 Tel: 01612750238 Email: [email protected] [email protected] Journal Subject Terms: Genetics; Congenital Heart Disease 1 Abstract: Background - Most cases of congenital heart disease (CHD) are sporadic and non-syndromic, with poorly understood aetiology. Rare genetic variants have been found to affect the risk of sporadic, non-syndromic CHD, but individual studies to date are of only moderate sizes, and none to date has incorporated the ohnolog status of candidate genes in the analysis. Ohnologs are genes retained from ancestral whole-genome duplications during evolution; multiple lines of evidence suggest ohnologs are over-represented among dosage-sensitive genes. We integrated large-scale data on rare variants with evolutionary information on ohnolog status to identify novel genetic loci predisposing to CHD. -
Congenital Diaphragmatic Hernia Candidate Genes Derived from Embryonic Transcriptomes
Congenital diaphragmatic hernia candidate genes derived from embryonic transcriptomes Meaghan K. Russella,1, Mauro Longonia,1, Julie Wellsb, Faouzi I. Maaloufa, Adam A. Tracya, Maria Loscertalesa, Kate G. Ackermanc, Barbara R. Pobera,d,e, Kasper Lagea,f,g,h,i, Carol J. Bultb,2, and Patricia K. Donahoea,f,g,2,3 aPediatric Surgical Research Laboratories, Massachusetts General Hospital, Boston, MA 02114; bThe Jackson Laboratory, Bar Harbor, ME 04609; cDepartments of Pediatrics and Biomedical Genetics, School of Medicine and Dentistry, University of Rochester, Rochester, NY 14642; dChildren’s Hospital Boston, Boston, MA 02115; Departments of ePediatrics and fSurgery, Harvard Medical School, Boston, MA 02115; gBroad Institute, Cambridge, MA 02142; hCenter for Biological Sequence Analysis, Technical University of Denmark, DK-2800 Lyngby, Denmark; and iCenter for Protein Research, University of Copenhagen, DK-2200 Copenhagen, Denmark Contributed by Patricia K. Donahoe, January 6, 2012 (sent for review October 28, 2011) Congenital diaphragmatic hernia (CDH) is a common (1 in 3,000 live between transcriptional programs in normal development and births) major congenital malformation that results in significant those perturbed in disease processes (13–15). Similar correlations morbidity and mortality. The discovery of CDH loci using standard have been described between diaphragm morphogenesis and CDH genetic approaches has been hindered by its genetic heterogeneity. only at the level of individual genes (8, 16–18). In this study, we We hypothesized that gene expression profiling of developing analyzed global trends in gene expression in the PPFs (at E11.5 and embryonic diaphragms would help identify genes likely to be E12.5) compared with in the mature diaphragm (at E16.5) by using associated with diaphragm defects.