DOCSLIB.ORG

Mapping Genes That Contribute to Daunorubicin- Induced Cytotoxicity

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mapping Genes That Contribute to Daunorubicin- Induced Cytotoxicity Research Article Mapping Genes that Contribute to Daunorubicin- Induced Cytotoxicity Shiwei Duan,1 Wasim K. Bleibel,1 Rong Stephanie Huang,1 Sunita J. Shukla,2 Xiaolin Wu,1 Judith A. Badner,3 and M. Eileen Dolan1 Departments of 1Medicine, 2Human Genetics, and 3Psychiatry, The University of Chicago, Chicago, Illinois Abstract for dGdC-rich regions flanked by A/T basepairs (2). Daunorubicin Daunorubicin is an anthracycline antibiotic agent used in has also been shown to inhibit DNA topoisomersase II by trapping the treatment of hematopoietic malignancies. Toxicities DNA strand passage intermediates, eventually resulting in DNA single-strand and double-strand breaks. Recent studies have shown associated with this agent include myelosuppression and cardiotoxicity; however, the genes or genetic determinants that the formation of DNA-anthracycline complexes can signifi- that contribute to these toxicities are unknown. We present cantly modify the ability of the helicases to separate DNA into an unbiased genome-wide approach that incorporates herita- single strands in an ATP-dependent fashion, thereby hindering bility, whole-genome linkage analysis, and linkage-directed the process of strand separation and limiting replication (3). There association to uncover genetic variants contributing to the are also reports that this drug can inhibit protein kinase C sensitivity to daunorubicin-induced cytotoxicity. Cell growth pathways (4). Patients often initially respond but then relapse due inhibition in 324 Centre d’ Etude du Polymorphisme Humain to resistance mechanisms, such as P-170 glycoprotein–mediated lymphoblastoid cell lines (24 pedigrees) was evaluated follow- drug efflux, altered topoisomerase II activity, or overexpression of ing treatment with daunorubicin for 72 h. Heritability analysis bcl-2 (5). showed a significant genetic component contributing to the The cumulative and dose-dependent toxicities that have limited cytotoxic phenotypes (h2 = 0.18–0.63at 0.0125, 0.025, 0.05, 0.1, the usage of daunorubicin are myelosuppression, mucositis, and 0.2, and 1.0 Mmol/L daunorubicin and at the IC , the dose cardiotoxicity (6–8). The risk of anthracycline-induced cardiotox- 50 icity is 10% to 26% and is dependent primarily on dose (9, 10). required to inhibit 50% cell growth). Whole-genome linkage Anthracycline-induced cardiotoxicity is thought to be mediated scans at all drug concentrations and IC50 uncovered 11 regions with moderate peak LOD scores (>1.5), including 4q28.2 to through reactive oxygen species production. Experiments con- 4q32.3 with a maximum LOD score of 3.18. The quantitative ducted on rat cardiomyocytes have shown that corticosterone can transmission disequilibrium tests were done using 31,312 high- inhibit apoptosis induced by doxorubicin, a structuralanalogueof frequency single-nucleotide polymorphisms (SNP) located in daunorubicin. This effect was mediated by the regulation of the 1 LOD confidence interval of these 11 regions. Thirty genes multiple genes, including antioxidant/detoxification enzymes, were identified as significantly associated with daunorubicin- receptors, signaling molecules, and amino acid and protein À induced cytotoxicity (P V 2.0  10 4, false discovery rate V 0.1). synthesis (11). Furthermore, Yi et al. have identified significant Pathway and functional gene ontology analysis showed that gene expression changes in mice after doxorubicin treatment, including a series of genes that encode oxidative stress-related these genes were overrepresented in the phosphatidylinositol signaling system, axon guidance pathway, and GPI-anchored proteins, signaltransduction, and apoptotic proteins (12). Matrix proteins family. Our findings suggest that a proportion of metalloproteinases 2 and 9 expression levels were enhanced in mice susceptibility to daunorubicin-induced cytotoxicity may be after acute doxorubicin treatment (13). In humans, tumor necrosis a y controlled by genetic determinants and that analysis using factor and phospholipase C- 1 have been shown to be criticalin linkage-directed association studies with dense SNP markers doxorubicin-induced cardiotoxicity (14). The genes important in can be used to identify the genetic variants contributing to daunorubicin-induced cardiotoxicity have not been well studied. In this report, we used classic and modern genetic approaches to cytotoxicity. [Cancer Res 2007;67(11):5425–33] identify genes that contribute to daunorubicin-induced cytotox- icity. To this end, lymphoblastoid cell lines (LCLs) derived from Introduction large Centre d’ Etude du Polymorphisme Humain (CEPH) reference Daunorubicin is a chemotherapeutic agent used in the treatment pedigrees of Northern and Western European descent were used to of hematopoietic malignancies, such as acute lymphocytic and identify the extent to which heritable factors contribute to drug acute myelogenous leukemia, as well as some lymphomas and cytotoxicity. There have been candidate gene approaches to study breast cancer (1). There are severalproposed mechanisms of the cellular sensitivity of daunorubicin in multiple tumor cell lines daunorubicin, most notably DNA intercalation, with a preference (15–19). However, our approach uses whole-genome linkage analysis and linkage-directed association studies to facilitate identifying regions within the genome that harbor genes contrib- Note: Supplementary data for this article are available at Cancer Research Online uting to daunorubicin-induced cytotoxicity. (http://cancerres.aacrjournals.org/). A Pharmacogenetics of Anticancer Agents Research Group study (http:// pharmacogenetics.org). Requests for reprints: M. Eileen Dolan, Department of Medicine, University of Materials and Methods Chicago, 5841 S. Maryland Avenue, Box MC2115, Chicago, IL 60637. Phone: 773-702- Cell lines. LCLs derived from 24 Caucasian Utah CEPH families (1331, 4441; Fax: 773-702-0963; E-mail: [email protected]. I2007 American Association for Cancer Research. 1333, 1334, 1340, 1341, 1344, 1345, 1346, 1347, 1349, 1350, 1358, 1362, 1375, doi:10.1158/0008-5472.CAN-06-4431 1408, 1413, 1416, 1420, 1423, 1444, 1447, 1454, 1459, and 1463) were www.aacrjournals.org 5425 Cancer Res 2007; 67: (11). June 1, 2007 Downloaded from cancerres.aacrjournals.org on September 25, 2021. © 2007 American Association for Cancer Research. Cancer Research purchased from the Coriell Institute for Medical Research4 (Camden, NJ). heterozygous markers (heterozygosity: 1% at <0.7, 7% at 0.7–0.8, 28% at Cell lines were maintained in RPMI 1640 (Mediatech) supplemented with 0.8–0.9, 64% at 0.9–1) were used for linkage mapping studies. 15% fetalbovine serum (HyClone)and 1% L-glutamine (Invitrogen). Cell Linkage analysis. The genotypic data and map distances were lines were passaged thrice per week at a concentration of 350,000 cells/mL downloaded from the CEPH Version 9 database and the Marshfield map j 8 and kept at a temperature of 37 C, with 5% CO2 and 95% humidity. database using error-checked markers. MERLIN was used to perform Drug. Daunorubicin (NSC-82151) was kindly provided by the Drug nonparametric linkage analysis because it is robust to nonnormal Synthesis and Chemistry Branch, Division of Cancer Treatment, National distributions. For quantitative traits, MERLIN uses the following definitions: Cancer Institute (NCI), Bethesda, MD. Cell cytotoxicity assay. Cell growth inhibition was evaluated at 2 SðvÞ¼f founder alleles SalleleðvÞ ; concentrations of 0, 0.0125, 0.025, 0.05, 0.1, 0.2, and 1.0 Amol/L daunorubicin. These concentrations were selected through assay optimization over a large SalleleðvÞ¼f all carriers of allele ðyi À lÞ: range of daunorubicin treatment concentrations. We chose the daunorubicin concentrations within the limits of our assay that best characterized the The score for each inheritance vector S(v) is calculated by summing squared sigmoid shape of cell growth inhibition. Daunorubicin was prepared in PBS scores for each founder allele. The score for each founder allele is calculated by (pH 7.4; Invitrogen) immediately before use. The cytotoxic effect of summing the mean deviates (yi À l) for all individuals who carry the founder daunorubicin on these CEPH cell lines was determined using the nontoxic allele, in which yi is the phenotype for individual i, l is the population mean, colorimetric-based assay, alamarBlue (Biosource). Cell viability was assessed and v is the list of individuals who carry a particular founder allele. Inheritance on exponentially growing LCLs by trypan blue dye exclusion using the Vi-Cell vectors are used to construct a likelihood ratio test for linkage. XR viability analyzer (Beckman Coulter). Cells (100 AL) with viabilities of Single-nucleotide polymorphisms. From the online CEU dataset in the  5  4 >85% were plated at a density of 1 10 cells/mL (1 10 cells per well), in HapMap project (release 21)9, 31,312 high-frequency SNPs covering 1,278 triplicate, in 96-well round-bottomed plates (Corning). After 24 h incuba- genes within the 1 LOD confidence intervalof linkageregions with LOD tion, cells were treated with either vehicle (media contains 0.1% PBS) or scores of >1.5 were retrieved. To prevent possible genotyping errors, we increasing concentrations of daunorubicin for 72 h. At 72-h incubation excluded the SNPs with Mendelian transmission errors. Remaining SNPs time, untreated cells were in exponential growth. AlamarBlue was added used were those with three genotypes and two counts per genotype in the 24 h before absorbance reading at wavelengths
Load more

Recommended publications
  • PRODUCT SPECIFICATION Product Datasheet
    Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST SLIT3 Mass Spectrometry Protein Standard Product Number QPrEST21571 Protein Name Slit homolog 3 protein Uniprot ID O75094 Gene SLIT3 Product Description Stable isotope-labeled standard for absolute protein quantification of Slit homolog 3 protein. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding CDNKNDSANACSAFKCHHGQCHISDQGEPYCLCQPGFSGEHCQQENPCLG fusion tag) QVVREVIRRQKGYASCATASKVPIMECRG Theoretical MW 26448 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
    [Show full text]
  • Supplementary Table 1: Adhesion Genes Data Set
    Supplementary Table 1: Adhesion genes data set PROBE Entrez Gene ID Celera Gene ID Gene_Symbol Gene_Name 160832 1 hCG201364.3 A1BG alpha-1-B glycoprotein 223658 1 hCG201364.3 A1BG alpha-1-B glycoprotein 212988 102 hCG40040.3 ADAM10 ADAM metallopeptidase domain 10 133411 4185 hCG28232.2 ADAM11 ADAM metallopeptidase domain 11 110695 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 195222 8038 hCG40937.4 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 165344 8751 hCG20021.3 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 189065 6868 null ADAM17 ADAM metallopeptidase domain 17 (tumor necrosis factor, alpha, converting enzyme) 108119 8728 hCG15398.4 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 117763 8748 hCG20675.3 ADAM20 ADAM metallopeptidase domain 20 126448 8747 hCG1785634.2 ADAM21 ADAM metallopeptidase domain 21 208981 8747 hCG1785634.2|hCG2042897 ADAM21 ADAM metallopeptidase domain 21 180903 53616 hCG17212.4 ADAM22 ADAM metallopeptidase domain 22 177272 8745 hCG1811623.1 ADAM23 ADAM metallopeptidase domain 23 102384 10863 hCG1818505.1 ADAM28 ADAM metallopeptidase domain 28 119968 11086 hCG1786734.2 ADAM29 ADAM metallopeptidase domain 29 205542 11085 hCG1997196.1 ADAM30 ADAM metallopeptidase domain 30 148417 80332 hCG39255.4 ADAM33 ADAM metallopeptidase domain 33 140492 8756 hCG1789002.2 ADAM7 ADAM metallopeptidase domain 7 122603 101 hCG1816947.1 ADAM8 ADAM metallopeptidase domain 8 183965 8754 hCG1996391 ADAM9 ADAM metallopeptidase domain 9 (meltrin gamma) 129974 27299 hCG15447.3 ADAMDEC1 ADAM-like,
    [Show full text]
  • Transgelin Interacts with PARP1 and Affects Rho Signaling Pathway in Human Colon Cancer Cells
    Transgelin interacts with PARP1 and affects Rho signaling pathway in human colon cancer cells Zhen-xian Lew Guangzhou Concord Cancer Center Hui-min Zhou First Aliated Hospital of Guangdong Pharmaceutical College Yuan-yuan Fang Tongling Peoples's Hospital Zhen Ye Sun Yat-sen Memorial Hospital Wa Zhong Sun Yat-sen Memorial Hospital Xin-yi Yang The Seventh Aliated Hospital Sun Yat-sen University Zhong Yu Sun Yat-sen Memorial Hospital of Sun Yat-sen University Dan-yu Chen Sun Yat-sen Memorial Hospital Si-min Luo Sun Yat-sen Memorial Hospital Li-fei Chen Sun Yat-sen Memorial Hospital Ying Lin ( [email protected] ) Sun Yat-sen Memorial Hospital https://orcid.org/0000-0003-2416-2154 Primary research Keywords: Transgelin, PARP1, Colon Cancer, Rho Signaling, Bioinformatics Posted Date: July 1st, 2020 DOI: https://doi.org/10.21203/rs.3.rs-16964/v2 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/22 Version of Record: A version of this preprint was published on August 3rd, 2020. See the published version at https://doi.org/10.1186/s12935-020-01461-y. Page 2/22 Abstract Background: Transgelin, an actin-binding protein, is associated with the cytoskeleton remodeling. Our previous studies found that transgelin was up-regulated in node-positive colorectal cancer versus in node- negative disease. Over-expression of TAGLN affected the expression of 256 downstream transcripts and increased the metastatic potential of colon cancer cells in vitro and in vivo. This study aims to explore the mechanisms that transgelin participates in the metastasis of colon cancer cells.
    [Show full text]
  • Expression Profiling the Developing Mammalian Enteric Nervous System Identifies Marker and Candidate Hirschsprung Disease Genes
    Expression profiling the developing mammalian enteric nervous system identifies marker and candidate Hirschsprung disease genes Tiffany A. Heanue and Vassilis Pachnis* Division of Molecular Neurobiology, National Institute for Medical Research, Medical Research Council, The Ridgeway, Mill Hill, London NW7 1AA, United Kingdom Communicated by Shirley M. Tilghman, Princeton University, Princeton, NJ, March 16, 2006 (received for review January 19, 2006) The enteric nervous system (ENS) is composed of neurons and glial eration, differentiation, and axonogenesis within the ENS (11–13). cells, organized as interconnected ganglia within the gut wall, How Ret signaling regulates these diverse cellular responses re- which controls persistalsis of the gut wall and secretions from its quired for normal ENS development is not understood. glands. The Ret receptor tyrosine kinase is expressed throughout HSCR occurs relatively frequently in the human population enteric neurogenesis and is required for normal ENS development; (1:5,000 live births). Mutations in RET and the Endothelin receptor humans with mutations in the RET locus have Hirschsprung disease type B (EDNRB) account for 50% and 5% of familial HSCR cases, (HSCR, an absence of ganglia in the colon), and mice lacking Ret respectively. Mutations in a number of other genes account for a have total intestinal aganglionosis. The Ret mutant mouse pro- further small percentage of HSCR cases, including the Ret ligands vides a tool for identifying genes implicated in development of the GDNF and NTN, the EDNRB ligand EDN3, the EDN3-converting ENS. By using RNA from WT and Ret mutant (aganglionic) gut tissue enzyme ECE1, SOX10, PHOX2B, and ZFHX1B (7). Additional and DNA microarrays, we have conducted a differential screen for susceptibility loci have been identified, although the corresponding ENS-expressed genes and have identified hundreds of candidate genes have yet to be determined (7).
    [Show full text]
  • SLIT3 (NM 003062) Human Untagged Clone – SC118202 | Origene
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for SC118202 SLIT3 (NM_003062) Human Untagged Clone Product data: Product Type: Expression Plasmids Product Name: SLIT3 (NM_003062) Human Untagged Clone Tag: Tag Free Symbol: SLIT3 Synonyms: MEGF5; SLIL2; Slit-3; SLIT1; slit2 Vector: pCMV6-XL4 E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: None Fully Sequenced ORF: >OriGene ORF sequence for NM_003062 edited ATGGCCCCCGGGTGGGCAGGGGTCGGCGCCGCCGTGCGCGCCCGCCTGGCGCTGGCCTTG GCGCTGGCGAGCGTCCTGAGTGGGCCTCCAGCCGTCGCCTGCCCCACCAAGTGTACCTGC TCCGCTGCCAGCGTGGACTGCCACGGGCTGGGCCTCCGCGCGGTTCCTCGGGGCATCCCC CGCAACGCTGAGCGCCTTGACCTGGACAGAAATAATATCACCAGGATCACCAAGATGGAC TTCGCTGGGCTCAAGAACCTCCGAGTCTTGCATCTGGAAGACAACCAGGTCAGCGTCATC GAGAGAGGCGCCTTCCAGGACCTGAAGCAGCTAGAGCGACTGCGCCTGAACAAGAATAAG CTGCAAGTCCTTCCAGAATTGCTTTTCCAGAGCACGCCGAAGCTCACCAGACTAGATTTG AGTGAAAACCAGATCCAGGGGATCCCGAGGAAGGCGTTCCGCGGCATCACCGATGTGAAG AACCTGCAACTGGACAACAACCACATCAGCTGCATTGAAGATGGAGCCTTCCGAGCGCTG CGCGATTTGGAGATCCTTACCCTCAACAACAACAACATCAGTCGCATCCTGGTCACCAGC TTCAACCACATGCCGAAGATCCGAACTCTGCGCCTCCACTCCAACCACCTGTACTGCGAC TGCCACCTGGCCTGGCTCTCGGATTGGCTGCGACAGCGACGGACAGTTGGCCAGTTCACA CTCTGCATGGCTCCTGTGCATTTGAGGGGCTTCAACGTGGCGGATGTGCAGAAGAAGGAG TACGTGTGCCCAGCCCCCCACTCGGAGCCCCCATCCTGCAATGCCAACTCCATCTCCTGC CCTTCGCCCTGCACGTGCAGCAATAACATCGTGGACTGTCGAGGAAAGGGCTTGATGGAG ATTCCTGCCAACTTGCCGGAGGGCATCGTCGAAATACGCCTAGAACAGAACTCCATCAAA GCCATCCCTGCAGGAGCCTTCACCCAGTACAAGAAACTGAAGCGAATAGACATCAGCAAG
    [Show full text]
  • Slit Proteins: Molecular Guidance Cues for Cells Ranging from Neurons to Leukocytes Kit Wong, Hwan Tae Park*, Jane Y Wu* and Yi Rao†
    583 Slit proteins: molecular guidance cues for cells ranging from neurons to leukocytes Kit Wong, Hwan Tae Park*, Jane Y Wu* and Yi Rao† Recent studies of molecular guidance cues including the Slit midline glial cells was thought to be abnormal [2,3]. family of secreted proteins have provided new insights into the Projection of the commissural axons was also abnormal: mechanisms of cell migration. Initially discovered in the nervous instead of crossing the midline once before projecting system, Slit functions through its receptor, Roundabout, and an longitudinally, the commissural axons from two sides of the intracellular signal transduction pathway that includes the nerve cord are fused at the midline in slit mutants [2,3]. Abelson kinase, the Enabled protein, GTPase activating proteins Because the midline glial cells are known to be important and the Rho family of small GTPases. Interestingly, Slit also in axon guidance, the commissural axon phenotype in slit appears to use Roundabout to control leukocyte chemotaxis, mutants was initially thought to be secondary to the cell- which occurs in contexts different from neuronal migration, differentiation phenotype [3]. suggesting a fundamental conservation of mechanisms guiding the migration of distinct types of somatic cells. In early 1999, results from three groups demonstrated independently that Slit functioned as an extracellular cue Addresses to guide axon pathfinding [4–6], to promote axon branching Department of Anatomy and Neurobiology, and *Departments of [7], and to control neuronal migration [8]. The functional Pediatrics and Molecular Biology and Pharmacology, Box 8108, roles of Slit in axon guidance and neuronal migration were Washington University School of Medicine, 660 S Euclid Avenue St Louis, soon supported by other studies in Drosophila [9] and in Missouri 63110, USA *e-mail: [email protected] vertebrates [10–14].
    [Show full text]
  • Differential Expression of Drosophila Transgelins Throughout Development
    fcell-09-648568 July 6, 2021 Time: 18:30 # 1 ORIGINAL RESEARCH published: 12 July 2021 doi: 10.3389/fcell.2021.648568 Differential Expression of Drosophila Transgelins Throughout Development Katerina M. Vakaloglou1†, Maria Mouratidou1†, Athina Keramidioti1,2 and Christos G. Zervas1* 1 Center of Basic Research, Biomedical Research Foundation, Academy of Athens, Athens, Greece, 2 Department of Biochemistry and Biotechnology, University of Thessaly, Larissa, Greece Transgelins are a conserved family of actin-binding proteins involved in cytoskeletal remodeling, cell contractility, and cell shape. In both mammals and Drosophila, three genes encode transgelin proteins. Transgelins exhibit a broad and overlapping expression pattern, which has obscured the precise identification of their role in development. Here, we report the first systematic developmental analysis of all Drosophila transgelin proteins, namely, Mp20, CG5023, and Chd64 in the Edited by: living organism. Drosophila transgelins display overall higher sequence identity with Lei-Miao Yin, mammalian TAGLN-3 and TAGLN-2 than with TAGLN. Detailed examination in different Shanghai University of Traditional Chinese Medicine, China developmental stages revealed that Mp20 and CG5023 are predominantly expressed in Reviewed by: mesodermal tissues with the onset of myogenesis and accumulate in the cytoplasm Cedric Soler, of all somatic muscles and heart in the late embryo. Notably, at postembryonic Clermont Université, France Simone Diestel, developmental stages, Mp20 and CG5023 are detected in the gut’s circumferential University of Bonn, Germany muscles with distinct subcellular localization: Z-lines for Mp20 and sarcomere and Rajesh Gunage, nucleus for CG5023. Only CG5023 is strongly detected in the adult fly in the abdominal, Boston Children’s Hospital, United States leg, and synchronous thoracic muscles.
    [Show full text]
  • KIF23 Enhances Cell Proliferation in Pancreatic Ductal Adenocarcinoma and Is a Potent Therapeutic Target
    1394 Original Article Page 1 of 15 KIF23 enhances cell proliferation in pancreatic ductal adenocarcinoma and is a potent therapeutic target Chun-Tao Gao1#, Jin Ren2#, Jie Yu1,3#, Sheng-Nan Li1, Xiao-Fan Guo1, Yi-Zhang Zhou1 1Department of Pancreatic Cancer, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center for Cancer, Tianjin Key Laboratory of Cancer Prevention and Therapy, Tianjin’s Clinical Research Center for Cancer, Tianjin, China; 2Shanxi Bethune Hospital, Shanxi Academy of Medical Sciences, Taiyuan, China; 3The First Hospital of Shanxi Medical University, Taiyuan, China Contributions: (I) Conception and design: CT Gao, J Ren; (II) Administrative support: CT Gao; (III) Provision of study materials or patients: J Yu; (IV) Collection and assembly of data: J Ren, SN Li, YZ Zhou; (V) Data analysis and interpretation: XF Guo, J Ren; (VI) Manuscript writing: All authors; (VII) Final approval of manuscript: All authors. #These authors contributed equally to this work. Correspondence to: Chun-Tao Gao. Department of Pancreatic Cancer, Tianjin Medical University Cancer Institute and Hospital, National Clinical Research Center for Cancer, Tianjin Key Laboratory of Cancer Prevention and Therapy, Tianjin’s Clinical Research Center for Cancer, Huan-hu-xi Road, He-xi District, Tianjin 300060, China. Email: [email protected]. Background: In recent research, high expression of kinesin family member 23 (KIF23), one of the kinesin motor proteins involved in the regulation of cytokinesis, has been shown to be related to poor prognosis in glioma and paclitaxel-resistant gastric cancer, as a results of the enhancement of proliferation, migration, and invasion. In this study, we analyzed the role of KIF23 in the progression of pancreatic ductal adenocarcinoma.
    [Show full text]
  • Polyclonal Antibody to Transgelin (TAGLN) (C-Term) - Aff - Purified
    OriGene Technologies, Inc. OriGene Technologies GmbH 9620 Medical Center Drive, Ste 200 Schillerstr. 5 Rockville, MD 20850 32052 Herford UNITED STATES GERMANY Phone: +1-888-267-4436 Phone: +49-5221-34606-0 Fax: +1-301-340-8606 Fax: +49-5221-34606-11 [email protected] [email protected] AP16212PU-N Polyclonal Antibody to Transgelin (TAGLN) (C-term) - Aff - Purified Alternate names: 22 kDa actin-binding protein, SM22, Smooth muscle protein 22-alpha, WS3-10 Quantity: 0.1 mg Concentration: 0.5 mg/ml Background: TAGLN is a transformation and shape-change sensitive actin cross-linking/gelling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear. Uniprot ID: Q01995 NCBI: NP_003177.2 GeneID: 6876 Host: Goat Immunogen: Peptide with sequence from the C-Terminus of the protein sequence according to NP_003177.2. Genename: TAGLN AA Sequence: C-MTGYGRPRQIIS Remarks: NP_003177.2 and NP_001001522.1 represent identical protein. Format: State: Liquid purified Ig fraction Purification: Ammonium Sulphate Precipitation followed by Antigen Affinity Chromatography using the immunizing peptide Buffer System: Tris saline, pH~7.3 Preservatives: 0.02% Sodium Azide Stabilizers: 0.5% BSA Applications: Peptide ELISA: 1/8000 (Detection Limit). Western blot: 0.01-0.03 mg/ml. Approx 24kDa band observed in Human Placenta lysates (calculated MW of 22.6kDa according to NP_003177.2). Other applications not tested. Optimal dilutions are dependent on conditions and should be determined by the user.
    [Show full text]
  • Duke University Dissertation Template
    Gene-Environment Interactions in Cardiovascular Disease by Cavin Keith Ward-Caviness Graduate Program in Computational Biology and Bioinformatics Duke University Date:_______________________ Approved: ___________________________ Elizabeth R. Hauser, Supervisor ___________________________ William E. Kraus ___________________________ Sayan Mukherjee ___________________________ H. Frederik Nijhout Dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate Program in Computational Biology and Bioinformatics in the Graduate School of Duke University 2014 i v ABSTRACT Gene-Environment Interactions in Cardiovascular Disease by Cavin Keith Ward-Caviness Graduate Program in Computational Biology and Bioinformatics Duke University Date:_______________________ Approved: ___________________________ Elizabeth R. Hauser, Supervisor ___________________________ William E. Kraus ___________________________ Sayan Mukherjee ___________________________ H. Frederik Nijhout An abstract of a dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Graduate Program in Computational Biology and Bioinformatics in the Graduate School of Duke University 2014 Copyright by Cavin Keith Ward-Caviness 2014 Abstract In this manuscript I seek to demonstrate the importance of gene-environment interactions in cardiovascular disease. This manuscript contains five studies each of which contributes to our understanding of the joint impact of genetic variation
    [Show full text]
  • Transcriptomic Landscape of Early Age Onset of Colorectal Cancer Identifies
    www.nature.com/scientificreports OPEN Transcriptomic landscape of early age onset of colorectal cancer identifes novel genes and pathways in Indian CRC patients Manish Pratap Singh, Sandhya Rai, Nand K. Singh & Sameer Srivastava* Past decades of the current millennium have witnessed an unprecedented rise in Early age Onset of Colo Rectal Cancer (EOCRC) cases in India as well as across the globe. Unfortunately, EOCRCs are diagnosed at a more advanced stage of cancer. Moreover, the aetiology of EOCRC is not fully explored and still remains obscure. This study is aimed towards the identifcation of genes and pathways implicated in the EOCRC. In the present study, we performed high throughput RNA sequencing of colorectal tumor tissues for four EOCRC (median age 43.5 years) samples with adjacent mucosa and performed subsequent bioinformatics analysis to identify novel deregulated pathways and genes. Our integrated analysis identifes 17 hub genes (INSR, TNS1, IL1RAP, CD22, FCRLA, CXCL3, HGF, MS4A1, CD79B, CXCR2, IL1A, PTPN11, IRS1, IL1B, MET, TCL1A, and IL1R1). Pathway analysis of identifed genes revealed that they were involved in the MAPK signaling pathway, hematopoietic cell lineage, cytokine–cytokine receptor pathway and PI3K-Akt signaling pathway. Survival and stage plot analysis identifed four genes CXCL3, IL1B, MET and TNS1 genes (p = 0.015, 0.038, 0.049 and 0.011 respectively), signifcantly associated with overall survival. Further, diferential expression of TNS1 and MET were confrmed on the validation cohort of the 5 EOCRCs (median age < 50 years and sporadic origin). This is the frst approach to fnd early age onset biomarkers in Indian CRC patients.
    [Show full text]
  • Genome-Wide Expression Profiling Establishes Novel Modulatory Roles
    Batra et al. BMC Genomics (2017) 18:252 DOI 10.1186/s12864-017-3635-4 RESEARCHARTICLE Open Access Genome-wide expression profiling establishes novel modulatory roles of vitamin C in THP-1 human monocytic cell line Sakshi Dhingra Batra, Malobi Nandi, Kriti Sikri and Jaya Sivaswami Tyagi* Abstract Background: Vitamin C (vit C) is an essential dietary nutrient, which is a potent antioxidant, a free radical scavenger and functions as a cofactor in many enzymatic reactions. Vit C is also considered to enhance the immune effector function of macrophages, which are regarded to be the first line of defence in response to any pathogen. The THP- 1 cell line is widely used for studying macrophage functions and for analyzing host cell-pathogen interactions. Results: We performed a genome-wide temporal gene expression and functional enrichment analysis of THP-1 cells treated with 100 μM of vit C, a physiologically relevant concentration of the vitamin. Modulatory effects of vitamin C on THP-1 cells were revealed by differential expression of genes starting from 8 h onwards. The number of differentially expressed genes peaked at the earliest time-point i.e. 8 h followed by temporal decline till 96 h. Further, functional enrichment analysis based on statistically stringent criteria revealed a gamut of functional responses, namely, ‘Regulation of gene expression’, ‘Signal transduction’, ‘Cell cycle’, ‘Immune system process’, ‘cAMP metabolic process’, ‘Cholesterol transport’ and ‘Ion homeostasis’. A comparative analysis of vit C-mediated modulation of gene expression data in THP-1cells and human skin fibroblasts disclosed an overlap in certain functional processes such as ‘Regulation of transcription’, ‘Cell cycle’ and ‘Extracellular matrix organization’, and THP-1 specific responses, namely, ‘Regulation of gene expression’ and ‘Ion homeostasis’.
    [Show full text]