2021 Revision 3
Our Commitment to the Customer
We at ScyTek Laboratories, Inc. have committed ourselves to producing only the highest quality products for the laboratory market. Since the company was founded in 1991, ScyTek has continued to grow at a rapid rate as a result of our commitment to continuous improvement of each and every product line. In addition, aggressive pricing through vigilant cost containment and continuous improvements in efficiency combined with our commitment to quality have helped to foster strong customer bonds. While the majority of our business consists of producing custom reagents for the resale/OEM market, we still insist on providing only the highest quality service for those customers that use the product in their own laboratories.
Being a primary manufacturer allows ScyTek to continually identify areas that can be improved through the implementation of Kaizen and other manufacturing management techniques. Being a primary manufacturer also allows the customer to have maximum flexibility in the products specifications making ScyTek an ideal manufacturing partner. ScyTek has the ability to produce and vial products in various environmental conditions up to Class 1000. For our OEM customers, we have the capability of producing most any liquid or dry blend for the laboratory and can customize packaging to meet nearly any requirement. Whether the product is an off- the-shelf item, or one made specifically to meet the customer’s needs, we are committed to delivering the product when expected and matching the anticipated specifications.
As the President of ScyTek Laboratories, Inc., I encourage you to contact me directly with any questions or comments regarding the performance of our company or our products.
Thank you, and we look forward to hearing from each and every customer in the following year.
Sincerely,
R. Michael Anderson President/CEO
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
1 Ordering Information
Orders may be placed by telephone, telefax, e-mail, online or standard mail.
Mailing Address: ScyTek Laboratories, Inc. PO Box 3286 Logan, Utah 84323-3286 USA
Telephone: 800-729-8350 435-755-9848 Fax: 435-755-0015
Web Site: www.scytek.com Email: [email protected] Terms: Terms of payment are “net 30 days” from invoice date, FOB shipping point. Accounts with balance unpaid beyond terms of “net 30 days” are subject to a service charge of one and one-half percent (1.5%) per month on the unpaid balance.
Prices: Many of the resale items in this catalog are available at prices significantly lower than found with other vendors. ScyTek’s deep discount policy requires that pricing be subject to change without notice. No minimum order is required for shipments within the United States. Shipments outside of the United States can be no less than $100.00.
Discounts: Bulk discounts are available on almost any product in this catalog.
Guarantee: ScyTek Laboratories, Inc. guarantees that products conform to labeled description or they will be replaced or refunded. Product liability is limited to refunds or replacements for the value of the product. Prior authorization is required for all returns or refunds.
Liability: Many products in this catalog consist of hazardous materials. It is entirely the users responsibility to assure safe handling and usage.
The products in this catalog are for laboratory use only and are not to be used for therapeutic purposes or in any pharmaceutical products. ScyTek Laboratories, Inc. does not in any way, recommend use of these products in violation of any patent or license. It is the responsibility of the user to determine the existence of such patents or licenses.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
2 Table of Contents Enzyme Immunoassay (ELISA) 3 Diluents and Stabilizers Blocking Reagents Chromogens Buffers
Immunohistochemistry 9 UltraTek SensiTek Polymer IHC Species Specific Reagents Blocking Reagents Chromogens Ancillary Slide Master Equipment IHC
Antibodies 34 Monoclonal Ready-to-Use Monoclonal Concentrates Polyclonal Ready-to-Use Polyclonal Concentrates Multiplex Cocktail
DNA Ploidy Analysis 152
Histology 153 Fixing Fluids Transport Media Nuclear Stains Cytoplasmic Stains Special Stains Slide Master Ancillary
Cytology 179 Kits Individual Reagents Transport Media Ancillary
Hematology 182 Kits Individual Reagents Ancillary
Microbiology 184 Kits Individual Reagents Ancillary
Buffers 189
Enzyme Immunoassay Enzyme Immunoassay Diluents and Stabilizers Ancillary (ELISA) Alk-Phos Stabilizing Diluent This reagent is formulated specifically for Alkaline Phosphatase conjugates. The product insures consistently high levels of BRIJ 35 Solution (25-30%) activity for both the enzyme and the antibody following long- term storage at final dilution. This product has been chemically BRIJ 35 Solution is a nonionic polyoxyethylene surfactant used in engineered to increase conjugate stability providing the a variety of protein methods. The reagent is an aqueous base customer a longer shelf life, resistance to various shipping containing 25-30% w/v proteomics grade BRIJ 35 making it conditions and storage temperatures. Alk-Phos Stabilizing optimal for use as a wetting agent in immunohistochemical Diluent is filtered at 0.2 um and reinforced with a non-mercury or reagents. azide-free preservative. Inquire about custom vialing, labeling, Catalog Number Volume kit assembly and drop shipping. BRJ500 500 ml Catalog Number Volume BRJ999 1000 ml APD500 500 ml Tween 20 APD999 1000 ml Polyoxyethylenesorbitan Monolaurate - Tween 20. Coating Stabilizer Catalog Number Volume Coating Stabilizer has been developed specifically for the TWN500 500 ml stabilization of adsorbed or immobilized proteins on microwell TWN999 1000 ml plates/strips. Coating Stabilizer maintains the conformation and activity of the antibody or protein antigen portion of the dried Water, Deionized/Distilled immunoassay components. Product is filtered at 0.2 microns. Water for use in laboratory procedures has been deionized, Contents: Aqueous, protein-containing stabilizer and blocking distilled and filtered at 0.2 micrometer for critical assays. solution in phosphate buffer for dried protein components in Catalog Number Volume immunoassays. DDH999 1000 ml DDH3800 1 Gal. Preservative: 0.02% Bromonitrodioxane, 0.02% 2-Methyl-4- DDH-20000 20 L isothiazolin-3-one. pH 7.2 - 7.7 ELISA Kits Catalog Number Volume CSB125 125 ml CSB500 500 ml CSB999 1000 ml Easy ELISA HRP Kit ELISA Sample Diluent Complete "Do it Yourself" ELISA system. This reagent is formulated for use as a sample diluent to ensure The first ELISA system designed to deliver superior results to each that the analyte is measured accurately. It is used to dilute the and every research project, regardless of the level of technician sample within the assay target range. expertise. Everything that is required to obtain outstanding results is included in one convenient package. Easy ELISA has Catalog Number Volume been specifically developed to create an environment in which ESD125 125 ml the researcher can be assured of consistent results with each ESD500 500 ml project. All of the reagents contained in Easy ELISA are stable ESD999 1000 ml enough to ship at ambient temperature. Enzyme Label Diluent Contents: Provided as a ready-to-use diluent for enzyme labeled antibodies Super Block 125 ml and streptavidin/avidin enzyme conjugates. Diluted reagents can HRP Stabilizing Diluent 125 ml be stored at 2-8 deg. C for up to 18 months at Binding Buffer 125 ml immunohistochemical dilutions. This reagent is subjected to 0.2 Coating Stabilizer 125 ml micron filtration. TMB Soluble Reagent 125 ml Catalog Number Volume TMB Stop Buffer 125 ml ABI500 500 ml Sample Diluent 125 ml ABI999 1000 ml Wash Buffer (10X PBS) 500 ml Catalog Number Volume EEH-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
3 Enzyme Immunoassay
HRP Stabilizing Diluent (MOPS Buffered) Normal Antibody Diluent (Phosphate Buffered) HRP Stabilizing Diluent (MOPS Buffered) has been developed without BSA specifically for the stabilization of Horseradish Peroxidase Provided as a ready-to-use diluent for primary antibodies and conjugates in solution. HRP Stabilizer prevents the loss of link/secondary antibodies. Diluent is subjected to 0.2 micron catalytic activity and maintains the conformation of the antibody filtration. For longterm storage of diluted antibodies, a carrier or protein antigen portion of the conjugate. Product is filtered at protein should be added. 0.2 microns. Catalog Number Volume Contents: Aqueous, protein-containing diluent and stabilizer for ABD999 1000 ml Horseradish Peroxidase conjugates. Normal Antibody Diluent (Tris Buffered) Preservative: 0.02% Bromonitrodioxane, 0.02% 2-Methyl-4- Provided as a ready-to-use diluent for primary antibodies and isothiazolin-3-one, 0.005% Proclin 300 (Proclin is a registered link/secondary antibodies. In most cases, antibodies diluted in trademark of Rohm & Haas Company), and 0.0008% Neomycin. this reagent can be stored at 4-8 deg. C for up to 18 months. Catalog Number Volume Diluent is subjected to 0.2 micron filtration. HSM125 125 ml Catalog Number Volume HSM500 500 ml ADT125 125 ml HSM999 1000 ml ADT500 500 ml ADT999 1000 ml HRP Stabilizing Diluent (Phosphate Buffered) This product has been developed to significantly increase the shelf life of diluted peroxidase labeled proteins. Stability is Blocking Reagents (ELISA) increased at room temperature storage conditions in addition to 2-8 centigrade. This product is subjected to 0.45 micron filtration, and contains no mercury or azide. This formulation insures consistently high levels of activity for both the enzyme and the antibody following long-term storage at final-use Coating Stabilizer dilution. HRP Stabilizer greatly improves the signal to noise Coating Stabilizer has been developed specifically for the ratios which increases the immunoassay sensitivity and offers stabilization of adsorbed or immobilized proteins on microwell cleaner assays. This product has been chemically engineered to plates/strips. Coating Stabilizer maintains the conformation and increase conjugate stability providing the customer a longer shelf activity of the antibody or protein antigen portion of the dried life, resistance to various shipping conditions & storage immunoassay components. Product is filtered at 0.2 microns. temperatures and improved day to day assay precision. Contents: Aqueous, protein-containing stabilizer and blocking This product is recommended to be used in conjunction with solution in phosphate buffer for dried protein components in ScyTek's proprietary Coating Stabilizer, Blocking Buffer (Super immunoassays. Block), Washing solution, TMB and Stopping Solution. All of the ELISA products are available in bulk quantities, including custom Preservative: 0.02% Bromonitrodioxane, 0.02% 2-Methyl-4- lot sizes up to 5000 liters. ScyTek Laboratories, Inc. specializes in isothiazolin-3-one. custom manufacturing, vialing, labeling and packaging. Call today for a quote 800-729-8350. pH 7.2 - 7.7 Catalog Number Volume Catalog Number Volume HSB500 500 ml CSB125 125 ml HSB999 1000 ml CSB500 500 ml CSB999 1000 ml Normal Antibody Diluent (Phosphate Buffered) Provided as a ready-to-use diluent for primary antibodies and EZ Block link/secondary antibodies. In most cases, antibodies diluted in EZ Block has been developed to use with immunolabeling this reagent can be stored at 4-8 deg. C for up to 18 months. techniques for the reduction of nonspecific background staining, Diluent is subjected to 0.2 micron filtration. and simultaneously reducing the handling of animal serums in Catalog Number Volume the laboratory. The need to match species with the secondary antibody is eliminated due to the lack of normal serum in this ABB125 125 ml product. EZ Block has been shown to be effective for ABB500 500 ml immunohistochemical, ELISA, blot and In-situ techniques and ABB999 1000 ml requires no mixing or diluting. Catalog Number Volume EZB125 125 ml EZB500 500 ml EZB999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
4 Enzyme Immunoassay
Pro-Block Is a unique serum-free protein block for immunochemistry. Pro- Chromogens (ELISA) Block eliminates the need for matching species with the link antibody and is often, more effective at reducing non-specific background staining than normal serum. Soluble Pro-Block is similar to Super Block, but without casein. The reagent is filtered at 0.2 microns. Catalog Number Volume TMB Soluble Reagent (High Sensitivity) PBK125 125 ml TMB - This high sensitivity liquid substrate for peroxidase consists PBK500 500 ml of Tetramethylbenzidine (TMB) plus dilute hydrogen peroxide in PBK999 1000 ml a single-reagent stabilized form. The reagent has been PBK010 10 L specifically formulated for measuring peroxidase in ELISA PBK-20000 20 L systems which is stable for long-term storage providing sensitivity greater than OPD. This reagent is available as a single Super Block component, ready-to-use reagent. When used in conjunction Super Block is a unique serum-free blocking of non-specific with our proprietary TMB Stop Buffer (TSB), the resulting color antibody binding in IHC, ELISA and western blot. Super Block product will not fade or darken for several hours. Our TMB eliminates the need for matching species with the link antibody products have been in production for over twenty years and have and is often, more effective at reducing non-specific background built a reputation for robust performance, unparalleled stability staining than normal serum. Ready-to-use no mixing required and next to zero lot-to-lot variation. Each TMB formulation can Super Block reduces the handling of animal serums in the be specifically engineered to meet the needs of your specific laboratory. A streamlined formulation without normal serum in assay. Inquire about custom vialing, labeling, kit assembly and the product eliminates the need to match species with the drop shipping. secondary antibody. Catalog Number Volume TM4125 125 ml Summary Protocol: TM4500 500 ml IHC: Incubate on tissue section prior to application of the primary antibody. TM4999 1000 ml ELISA: Add Super Block to microtiter well and incubate prior to TM4010 10 L addition of sample. Rinse and continue procedure. Western Blot: An effective blocker for this technique at room TMB Soluble Reagent (Standard Sensitivity) temperature. TMB - This standard sensitivity liquid substrate for peroxidase Catalog Number Volume consists of Tetramethylbenzidine (TMB) plus dilute hydrogen peroxide in a single-reagent stabilized form. The reagent has AAA125 125 ml been specifically formulated for measuring peroxidase in ELISA AAA500 500 ml systems which is stable for long-term storage providing AAA999 1000 ml sensitivity greater than OPD. This reagent is available as a single component, ready-to-use reagent. When used in conjunction with our proprietary TMB Stop Buffer (TSB), the resulting color product will not fade or darken for several hours. Our TMB products have been in production for over twenty years and have built a reputation for robust performance, unparalleled stability and next to zero lot-to-lot variation. Each TMB formulation can be specifically engineered to meet the needs of your specific assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume TM1125 125 ml TM1500 500 ml TM1999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
5 Enzyme Immunoassay
TMB Stop Buffer DAB Chromogen/Substrate Bulk pack ScyTek's Stop Buffer (TSB) offers a unique combination of acid 3,3'-Diaminobenzidine (DAB) Ready-to-Use that produces a more stable stopped reaction product than other Is a widely used chromogen for immunohistochemical staining formulations of H2SO4 or HCL. Stopped reactions show and immunoblotting. When in the presence of the peroxidase increased absorbance values of approximately two-fold over enzyme, DAB produces a brown precipitate that is insoluble in unstopped reactions with minimal drift for up to six hours alcohol. Stained slides may be mounted in any commercially depending on various conditions. This reagent can be available permanent mounting media. This product is available customized to meet each customers specific needs. Inquire about in a convenient two component form. custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume ACK500 530 ml TSB125 125 ml ACK999 1060 ml TSB500 500 ml TSB999 1000 ml DAB Chromogen/Substrate Bulk Pack (High Contrast) Precipitating This product has been developed for applications that require high contrast between the chromogen and Hematoxylin counterstain. The resulting stain is a darker brown than standard DAB and somewhat more sensitive. 3,3'Diaminobenzidine (DAB) AEC Chromogen/Substrate Bulk Kit is a widely used chromogen for immunohistochemical staining 3-Amino-9-Ethylcarbazole (AEC) is a widely used chromogen for and immunoblotting. When in the presence of peroxidase immunohistochemical staining and immunoblotting. When in enzyme, DAB produces a brown precipitate that is insoluble in the presence of peroxidase enzyme , AEC produces a vivid red alcohol. This product is available in a two component form end product that is soluble in alcohol and must be used with an consisting of a liquid, refrigerator stable DAB Chromogen and aqueous counterstain and mounting media. This product is DAB Substrate (High Contrast). The use of liquid components available in a two component form consisting of a liquid, reduces some risks associated with handling powders (ie. dust refrigerator stable AEC Chromogen and AEC Substrate. Each inhalation), and eliminates waste which often results from using component is individually stable for 18 months from the date of tablets that require a predetermined final volume. manufacture. Catalog Number Volume Catalog Number Volume ACV500 530 ml ACJ500 515 ml ACV999 1060 ml ACJ999 1030 ml TMB Precipitating (High Sensitivity) BCIP/INT Solution This liquid substrate for peroxidase consists of 5-Bromo-4-Chloro-3-IndolylPhosphate/p-Iodonitrotetrazolium tetramethylbenzidine (TMB) plus dilute hydrogen peroxide in a (BCIP/INT) Solution single-reagent stabilized form. The reagent has been specifically Is a chromogen used in immunohistochemical and in-situ formulated for measuring peroxidase on membranes and other staining. This reagent is available as a single component, ready- surfaces and is not intended for use in microwell applications. to-use reagent. When in the presence of the Alkaline- This reagent is stable for long-term storage, and provides Phosphatase enzyme, BCIP/INT produces a brown precipitate sensitivity equal to, or greater than, that of other commercially that is soluble in alcohol. available chromogens. Catalog Number Volume Catalog Number Volume ACL125 125 ml TM5125 125 ml ACL500 500 ml TM5500 500 ml ACL999 1000 ml TM5999 1000 ml BCIP/NBT Solution TMB Precipitating (Standard Sensitivity) 5-Bromo-4-Chloro-3-Indolyl Phosphate/nitroblue Tetrazolium This liquid substrate for peroxidase consists of (BCIP/NBT) Solution tetramethylbenzidine (TMB) plus dilute hydrogen peroxide in a Is a widely used chromogen for immunohistochemical and in-situ single-reagent stabilized form. The reagent has been specifically staining. This reagent is available as a single component, ready- formulated for measuring peroxidase on membranes and other to-use reagent. When in the presence of the Alkaline- surfaces and is not intended for use in microwell applications. Phosphatase enzyme, BCIP/NBT produces a purple precipitate This reagent is stable for long-term storage, and provides that is soluble in alcohol. sensitivity equal to, or greater than, that of other commercially available chromogens. Catalog Number Volume Catalog Number Volume ACN125 125 ml ACN500 500 ml TM3125 125 ml ACN999 1000 ml TM3500 500 ml TM3999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
6 Enzyme Immunoassay
Phosphate Buffered Saline plus Tween 20 (10x) pH Buffers 7.4 ScyTek Phosphate Buffered Saline + Tween 20 (10x) pH of 7.4 is an optimal formulation of pH stabilizers, salts and detergents designed to effectively remove excess material from the ELISA Binding Buffer microtiter plate wells without disrupting the ELISA binding reaction. By maintaining the proper buffering environment, Formulated to maximize the adsorption efficiency of antibodies unbound components can be washed away without suppressing and antigens onto polystyrene plate surfaces. This reagent is antigen-antibody binding interactions, thereby reducing ready-to-use and requires no modification prior to use. nonspecific background and increasing the specific signal. Our Catalog Number Volume Wash buffers do not contain hazardous preservatives such as EBB125 125 ml Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience wash buffer is EBB500 500 ml offered in a wide variety of formulations to meet the needs of EBB999 1000 ml your specific ELISA application. This product can be customized Phosphate Buffered Saline (10x) pH 7.4 to meet the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. ScyTek Phosphate Buffered Saline (10x) pH 7.4 is an optimal Catalog Number Volume formulation of pH stabilizers and salts designed to effectively remove excess material from the microtiter plate wells without PBE500 500 ml disrupting the ELISA binding reaction. By maintaining the proper PBE999 1000 ml buffering environment, unbound components can be washed PBE010 10 L away without suppressing antigen-antibody binding interactions, PBE-20000 20 L thereby reducing nonspecific background and increasing the specific signal. Our Wash buffers do not contain hazardous Phosphate Buffered Saline plus Tween 20 (20x) pH preservatives such as Azide or Mercury that may interfere with 7.6 antibody-antigen binding interactions. For your convenience ScyTek Wash buffer formulations are an optimal formulation of wash buffer is offered in a wide variety of formulations to meet pH stabilizers, salts and detergents designed to effectively the needs of your specific ELISA application. This product can be remove excess material from the microtiter plate wells without customized to met the specific needs of your assay. Inquire disrupting the ELISA binding reaction. By maintaining the proper about custom vialing, labeling, kit assembly and drop shipping. buffering environment, unbound components can be washed Catalog Number Volume away without suppressing antigen-antibody binding interactions, PBD500 500 ml thereby reducing nonspecific background and increasing the PBD999 1000 ml specific signal. Our Wash buffers do not contain hazardous PBD010 10 L preservatives such as Azide or Mercury that may interfere with PBD-20000 20 L antibody-antigen binding interactions. For your convenience wash buffer is offered in a wide variety of formulations to meet Phosphate Buffered Saline (25x) pH 7.6 the needs of your specific ELISA application. This product can be customized to meet the specific needs of your assay. Inquire ScyTek Phosphate Buffered Saline (25x) pH of 7.6 is an optimal about custom vialing, labeling, kit assembly and drop shipping. formulation of pH stabilizers and salts designed to effectively remove excess material from the microtiter plate wells without Catalog Number Volume disrupting the ELISA binding reaction. By maintaining the proper PBT500 500 ml buffering environment, unbound components can be washed PBT999 1000 ml away without suppressing antigen-antibody binding interactions, PBT010 10 L thereby reducing nonspecific background and increasing the PBT-20000 20 L specific signal. Our Wash buffers do not contain hazardous preservatives such as Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience wash buffer is offered in a wide variety of formulations to meet the needs of your specific ELISA application. This product can be customized to meet the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume PBS125 125 ml PBS500 500 ml PBS999 1000 ml PBS010 10 L PBS-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
7 Enzyme Immunoassay
Tris Buffered Saline (10x) pH 7.5 Tris Buffered Saline plus Tween 20 (10x) pH 7.5 ScyTek Tris Buffered Saline (10x) pH of 7.5 is an optimal ScyTek Tris Buffered Saline + Tween 20 (10x) pH of 7.5 is an formulation of pH stabilizers, salts and detergents designed to optimal formulation of pH stabilizers, salts and detergents effectively remove excess material from the microtiter plate designed to effectively remove excess material from the wells without disrupting the ELISA binding reaction. By microtiter plate wells without disrupting the ELISA binding maintaining the proper buffering environment, unbound reaction. By maintaining the proper buffering environment, components can be washed away without suppressing antigen- unbound components can be washed away without suppressing antibody binding interactions, thereby reducing nonspecific antigen-antibody binding interactions, thereby reducing background and increasing the specific signal. Our Wash buffers nonspecific background and increasing the specific signal. Our do not contain hazardous preservatives such as Azide or Mercury Wash buffers do not contain hazardous preservatives such as that may interfere with antibody-antigen binding interactions. Azide or Mercury that may interfere with antibody-antigen For your convenience wash buffer is offered in a wide variety of binding interactions. For your convenience wash buffer is formulations to meet the needs of your specific ELISA offered in a wide variety of formulations to meet the needs of application. This product can be customized to meet the specific your specific ELISA application. This product can be customized needs of your assay. Inquire about custom vialing, labeling, kit to meet the specific needs of your assay. Inquire about custom assembly and drop shipping. vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBD500 500 ml TBE500 500 ml TBD999 1000 ml TBE999 1000 ml TBD010 10 L TBE010 10 L TBD-20000 20 L TBE-20000 20 L Tris Buffered Saline (25x) pH 7.4 Tris Buffered Saline plus Tween 20 (20x ScyTek Tris Buffered Saline (25x) pH of 7.4 is an optimal Concentrate) pH 7.4 formulation of pH stabilizers, salts and detergents designed to ScyTek Tris Buffered Saline + Tween 20 (20x Concentrate) pH of effectively remove excess material from the microtiter plate 7.4 is an optimal formulation of pH stabilizers, salts and wells without disrupting the ELISA binding reaction. By detergents designed to effectively remove excess material from maintaining the proper buffering environment, unbound the tissue sample or microtiter plate wells without disrupting the components can be washed away without suppressing antigen- antibody binding reaction. By maintaining the proper buffering antibody binding interactions, thereby reducing nonspecific environment, unbound components can be washed away background and increasing the specific signal. Our Wash buffers without suppressing antigen-antibody binding interactions, do not contain hazardous preservatives such as Azide or Mercury thereby reducing nonspecific background and increasing the that may interfere with antibody-antigen binding interactions. specific signal. Our Wash buffers do not contain hazardous For your convenience wash buffer is offered in a wide variety of preservatives such as Azide or Mercury that may interfere with formulations to meet the needs of your specific ELISA antibody-antigen binding interactions. For your convenience application. This product can be customized to met the specific wash buffer is offered in a wide variety of formulations to meet needs of your assay. Inquire about custom vialing, labeling, kit the needs of your specific ELISA application. assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBT500 500 ml TBS500 500 ml TBT999 1000 ml TBS999 1000 ml TBT010 10 L TBS010 10 L TBT-20000 20 L TBS-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
8 Immunohistochemistry
CD8 Control Slides Immunohistochemistry CD8 Control Slides - Human Lymphoid Catalog Number Volume Control Slides ICS2007-25 25 Slides CEA Control Slides CEA Control Slides - Human Colon Catalog Number Volume Alpha-1-Fetoprotein Control Slides ICS2012-25 25 Slides Alpha-1-Fetoprotein Control Slides - Fetal and Adult Liver Catalog Number Volume Chromogranin Control Slides ICS2001-25 25 Slides Chromogranin Control Slides - Human Pancreas Catalog Number Volume B-Cell, CD45RA Control Slides ICS2013-25 25 Slides B-Cell, CD45RA Control Slides - Human Lymphoid Catalog Number Volume CMV Control Slides ICS2002-25 25 Slides CMV Control Slides - Human Lung Bcl-2 Control Slides Catalog Number Volume ICS2016-25 25 Slides Bcl-2 Control Slides - Human Lymphoid Catalog Number Volume Cytokeratin (mono) Control Slides ICS2003-25 25 Slides Cytokeratin (mono) Control Slides - Human Skin Catalog Number Volume Bromodeoxyuridine Control Slides ICS2014-25 25 Slides Bromodeoxyuridine Control Slides - Human Colon Catalog Number Volume Cytokeratin (poly) Control Slides ICS2004-25 25 Slides Cytokeratin (poly) Control Slides - Human Skin Catalog Number Volume CD20 (L26) Control Slides ICS2015-25 25 Slides CD20 (L26) Control Slides - Human Lymphoid Catalog Number Volume Desmin Control Slides ICS2008-25 25 Slides Desmin Control Slides - Human Leiomyoma CD3 Control Slides Catalog Number Volume ICS2017-25 25 Slides CD3 Control Slides - Human Lymphoid Catalog Number Volume EMA Control Slides ICS2005-25 25 Slides EMA Control Slides - Human Kidney CD30 (Ki-1) Control Slides Catalog Number Volume ICS2018-25 25 Slides CD30 (Ki-1) Control Slides - Human Lymphoid Catalog Number Volume Factor VIII Control Slides ICS2009-25 25 Slides Factor VIII Control Slides - Human Lymphoid Catalog Number Volume CD43 Control Slides ICS2019-25 25 Slides CD43 Control Slides - Human Lymphoid Catalog Number Volume Glucagon Control Slides ICS2010-25 25 Slides Glucagon Control Slides - Human Pancreas Catalog Number Volume CD5 Control Slides ICS2020-25 25 Slides CD5 Control Slides - Human Lymphoid Catalog Number Volume Hepatitis B Core Ant Control Slides ICS2006-25 25 Slides Hepatitis B Core Anterior Control Slides - Human Liver Catalog Number Volume ICS2021-25 25 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
9 Immunohistochemistry
Hepatitis B Surface Control Slides PSA Control Slides Hepatitis B Surface Control Slides - Human Liver PSA Control Slides - Human Prostate Catalog Number Volume Catalog Number Volume ICS2022-25 25 Slides ICS2033-25 25 Slides HMB 45 Control Slides PSAP Control Slides HMB 45 Control Slides - Human Skin PSAP Control Slides - Human Prostate Catalog Number Volume Catalog Number Volume ICS2023-25 25 Slides ICS2034-25 25 Slides HSV-1 Control Slides S-100 Control Slides HSV-1 Control Slides - Human Lung S-100 Control Slides - Human Nerve Catalog Number Volume Catalog Number Volume ICS2024-25 25 Slides ICS2035-25 25 Slides HSV-2 Control Slides Somatostatin Control Slides HSV-2 Control Slides - Human Lung Somatostatin Control Slides - Human Pancreas Catalog Number Volume Catalog Number Volume ICS2025-25 25 Slides ICS2036-25 25 Slides Insulin Control Slides Synaptophysin Control Slides Insulin Control Slides - Human Pancreas Synaptophysin Control Slides - Human Pancreas Catalog Number Volume Catalog Number Volume ICS2026-25 25 Slides ICS2037-25 25 Slides Kappa Control Slides T-Cell, CD45RO Control Slides Kappa Control Slides - Human Lymphoid T-Cell, CD45RO Control Slides - Human Lymphoid Catalog Number Volume Catalog Number Volume ICS2027-25 25 Slides ICS2038-25 25 Slides Lambda Control Slides Vimentin Control Slides Lambda Control Slides - Human Lymphoid Vimentin Control Slides - Human Tumor Catalog Number Volume Catalog Number Volume ICS2028-25 25 Slides ICS2039-25 25 Slides LCA Control Slides LCA Control Slides - Human Lymphoid UltraTek Catalog Number Volume ICS2029-25 25 Slides UltraTek Kits LN 2 Control Slides LN 2 Control Slides - Human Lymphoid UltraTek HRP Catalog Number Volume ICS2030-25 25 Slides Retrieval HRP Anti-Polyvalent Lab Pack NSE Control Slides The Retrieval Lab Pack is the optimal kit for the retrieval process. It is designed to provide crisp staining with incubation times of NSE Control Slides - Human Pancreas 10 minutes for the Link Antibody and Enzyme Label. The Catalog Number Volume antibodies have been highly purified and specially formulated to assure crisp, clear staining when used in conjunction with each ICS2031-25 25 Slides other. P53 Protein Control Slides Catalog Number Volume P53 Protein Control Slides - Human Colon RLP015 150 Slides Catalog Number Volume RLP125 1250 Slides ICS2032-25 25 Slides RLP500 5000 Slides RLP999 10000 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
10 Immunohistochemistry
UltraTek HRP Anti-Mouse (AEC) Staining System UltraTek HRP Anti-Polyvalent Lab Pack Contains: 1 x 8ml Peroxide Block The UltraTek staining kit provides unmatched sensitivity with 1 x 8ml Super Block incubation times of 10 minutes each for the Link Antibody and 1 x 8ml Anti-Mouse Enzyme Label. The bulk kits are ideal for high volume 1 x 8ml HRP laboratories. Each Pack contains one bottle of Super Block 1 x 3ml AEC Chromogen (universal protein block), one bottle of Biotinylated Antibody 7 x 5ml AEC Substrate (Polyvalent), and one bottle of Horseradish Peroxidase Labeled Catalog Number Volume Streptavidin. Each bottle contains 125, 500, or 1000ml of reagent. These Lab-Packs provide an extremely economical AKB080 70 Slides alternative for automated staining systems and we encourage you to evaluate the addition of this in your current system. UltraTek HRP Anti-Mouse (DAB) Staining System Contains: 1 x 8ml Peroxide Block Contains: One container of Super Block. 1 x 8ml Super Block One container of Antipolyvalent. 1 x 8ml Anti-Mouse One container of HRP. 1 x 8ml HRP Catalog Number Volume 1 x 3ml DAB Chromogen 7 x 5ml DAB Substrate UHP125 1250 Slides UHP500 5000 Slides Catalog Number Volume UHP999 10000 Slides AKA080 70 Slides UltraTek HRP Anti-Polyvalent Staining System UltraTek HRP Anti-Mouse Lab Pack Contains: 4 x 15ml Super Block Contains: One container of Super Block. 4 x 15ml Anti-Polyvalent One container of Anti-Mouse. 4 x 15ml HRP One container of HRP. Catalog Number Volume Catalog Number Volume AFN600 500 Slides UHM125 1250 Slides UHM500 5000 Slides UltraTek HRP Anti-Rabbit (AEC) Staining System UHM999 10000 Slides Contains: 1 x 8ml Peroxide Block 1 x 8ml Super Block UltraTek HRP Anti-Mouse Staining System 1 x 8ml Anti-Rabbit Contains: 4 x 15ml Super Block 1 x 8ml HRP 4 x 15ml Anti-Mouse 1 x 3ml AEC Chromogen 4 x 15ml HRP 7 x 5ml AEC Substrate Catalog Number Volume Catalog Number Volume AFJ600 500 Slides AKD080 70 Slides UltraTek HRP Anti-Polyvalent (AEC) Staining System UltraTek HRP Anti-Rabbit (DAB) Staining System Contains: 1 x 8ml Peroxide Block Contains: 1 x 8ml Peroxide Block 1 x 8ml Super Block 1 x 8ml Super Block 1 x 8ml Anti-Polyvalent 1 x 8ml Anti-Rabbit 1 x 8ml HRP 1 x 8ml HRP 1 x 3ml AEC Chromogen 1 x 3ml DAB Chromogen 7 x 5ml AEC Substrate 7 x 5ml DAB Substrate Catalog Number Volume Catalog Number Volume AMG080 70 Slides AKC080 70 Slides UltraTek HRP Anti-Polyvalent (DAB) Staining System Contains: 1 x 8ml Peroxide Block 1 x 8ml Super Block 1 x 8ml Anti-Polyvalent 1 x 8ml HRP 1 x 3ml DAB Chromogen 7 x 5ml DAB Substrate Catalog Number Volume AMF080 70 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
11 Immunohistochemistry
UltraTek HRP Anti-Rabbit Lab Pack UltraTek Alk-Phos Anti-Polyvalent (Permanent The UltraTek staining kit provides unmatched sensitivity with Red) Staining System incubation times of 10 minutes each for the Link Antibody and The UltraTek staining kit provides unmatched sensitivity with Enzyme Label. The bulk kits are ideal for high volume incubation times of 10 minutes each for the Link Antibody and laboratories. Each Pack contains one bottle of Super Block Enzyme Label. This kit includes our Permanent Red chromogen, (universal protein block), one bottle of Biotinylated Anti-Rabbit, which can be coverslipped with solvent based mounting media and one bottle of Horseradish Peroxidase Labeled Streptavidin. for long term storage. Each bottle contains 125, 500, or 1000ml of reagent. These Lab- Packs provide an extremely economical alternative for Contains: 1 x 8ml Super Block automated staining systems and we encourage you to evaluate 1 x 8ml Anti-Polyvalent the addition of this in your current system. 1 x 8ml Alk-Phos 1 x 2ml Permanent Red Concentrate Contains: One container of Super Block. 8 x 5ml Permanent Red Buffer One container of Anti-Rabbit. Catalog Number Volume One container of HRP. AMH080 70 Slides Catalog Number Volume UHR125 1250 Slides UltraTek Alk-Phos Anti-Polyvalent Lab Pack UHR500 5000 Slides Contains: One container of Super Block. UHR999 10000 Slides One container of Anti-Polyvalent. One container of Alk-Phos. UltraTek HRP Anti-Rabbit Staining System Catalog Number Volume Contains: 4 x 15ml Super Block 4 x 15ml Anti-Rabbit UAP125 1250 Slides 4 x 15ml HRP UAP500 5000 Slides UAP999 10000 Slides Catalog Number Volume AFK600 500 Slides UltraTek Alk-Phos Anti-Polyvalent Staining System Contains: 4 x 15ml Super Block UltraTek Alk-Phos 4 x 15ml Anti-Polyvalent 4 x 15ml Alk-Phos UltraTek Alk-Phos Anti-Mouse (Permanent Red) Catalog Number Volume Staining System AFP600 500 Slides The UltraTek staining kit provides unmatched sensitivity with incubation times of 10 minutes each for the Link Antibody and UltraTek Alk-Phos Anti-Rabbit (Permanent Red) Enzyme Label. This kit includes our Permanent Red chromogen, Staining System which can be coverslipped with solvent based mounting media The UltraTek staining kit provides unmatched sensitivity with for long term storage. incubation times of 10 minutes each for the Link Antibody and Enzyme Label. This kit includes our Permanent Red chromogen, Contains: 1 x 8ml Super Block which can be coverslipped with solvent based mounting media 1 x 8ml Anti-Mouse for long term storage. 1 x 8ml Alk-Phos 1 x 2ml Permanent Red Concentrate Contains: 1 x 8ml Super Block 8 x 5ml Permanent Red Buffer 1 x 8ml Anti-Rabbit Catalog Number Volume 1 x 8ml Alk-Phos AET080 70 Slides 1 x 2ml Permanent Red Concentrate 8 x 5ml Permanent Red Buffer UltraTek Alk-Phos Anti-Mouse Lab Pack Catalog Number Volume Contains: One container of Super Block. AME080 70 Slides One container of Anti-Mouse. One container of Alk-Phos. UltraTek Alk-Phos Anti-Rabbit Lab Pack Catalog Number Volume Contains: One container of Super Block. One container of Anti-Rabbit. UAM125 1250 Slides One container of Alk-Phos. UAM500 5000 Slides UAM999 10000 Slides Catalog Number Volume UAR125 1250 Slides UltraTek Alk-Phos Anti-Mouse Staining System UAR500 5000 Slides Contains: 4 x 15ml Super Block UAR999 10000 Slides 4 x 15ml Anti-Mouse 4 x 15ml Alk-Phos Catalog Number Volume AFL600 500 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
12 Immunohistochemistry
UltraTek Alk-Phos Anti-Rabbit Staining System UltraTek Anti-Mouse Contains: 4 x 15ml Super Block The UltraTek line is our leading edge system, designed to provide 4 x 15ml Anti-Rabbit optimal staining with incubation times of 10 minutes each for the 4 x 15ml Alk-Phos link antibody and enzyme label. For most procedures, Catalog Number Volume commercially available primary antibodies can be diluted up to 50% further than with other systems. AFM600 500 Slides Catalog Number Volume ABJ008 8 ml UltraTek Individual Reagents ABJ015 15 ml ABJ125 125 ml ABJ500 500 ml Super Block ABJ999 1000 ml Super Block is a unique serum-free blocking of non-specific UltraTek Anti-Polyvalent antibody binding in IHC, ELISA and western blot. Super Block eliminates the need for matching species with the link antibody The UltraTek line is our leading edge system, designed to provide and is often, more effective at reducing non-specific background optimal staining with incubation times of 10 minutes each for the staining than normal serum. Ready-to-use no mixing required link antibody and enzyme label. UltraTek Anti-Polyvalent is Super Block reduces the handling of animal serums in the specially formulated and optimized to be used in a labeled laboratory. A streamlined formulation without normal serum in streptavidin-biotin immunoenzymatic antigen detection system. the product eliminates the need to match species with the This technique requires the sequential incubation of the secondary antibody. specimen with an unconjugated primary antibody specific to the target antigen, a biotinylated secondary antibody which reacts Summary Protocol: with the primary antibody, enzyme-labeled streptavidin, and IHC: Incubate on tissue section prior to application of the primary substrate-chromogen. For most procedures, commercially antibody. available primary antibodies can be diluted up to 50% more than ELISA: Add Super Block to microtiter well and incubate prior to with other systems. addition of sample. Rinse and continue procedure. Western Blot: An effective blocker for this technique at room Summary Protocol: temperature. Incubate on tissue section after application of the primary Catalog Number Volume antibody. AAA125 125 ml Catalog Number Volume AAA500 500 ml ABN008 8 ml AAA999 1000 ml ABN015 15 ml ABN125 125 ml UltraTek Alkaline Phosphatase ABN500 500 ml The UltraTek line is our leading edge system, designed to provide ABN999 1000 ml optimal staining with incubation times of 10 minutes each for the link antibody and enzyme label. For most procedures, UltraTek Anti-Rabbit commercially available primary antibodies can be diluted up to The UltraTek line is our leading edge system, designed to provide 50% further than with other systems. optimal staining with incubation times of 10 minutes each for the Catalog Number Volume link antibody and enzyme label. For most procedures, commercially available primary antibodies can be diluted up to ABM008 8 ml 50% further than with other systems. ABM015 15 ml ABM125 125 ml Catalog Number Volume ABM500 500 ml ABK008 8 ml ABM999 1000 ml ABK015 15 ml ABK125 125 ml UltraTek Anti-Goat ABK500 500 ml The UltraTek line is our leading edge system, designed to provide ABK999 1000 ml optimal staining with incubation times of 10 minutes each for the link antibody and enzyme label. For most procedures, commercially available primary antibodies can be diluted up to 50% further than with other systems. Catalog Number Volume AGL008 8 ml AGL015 15 ml AGL125 125 ml AGL250 250 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
13 Immunohistochemistry
UltraTek Horseradish Peroxidase SensiTek HRP Anti-Mouse Staining System The UltraTek line is our leading edge system, designed to provide Contains: 4 x 15ml Super Block optimal staining with incubation times of 10 minutes each for the 4 x 15ml Anti-Mouse link antibody and enzyme label. UltraTek Horseradish Peroxidase 4 x 15ml Alk-Phos is specially formulated and optimized to be used in a labeled Catalog Number Volume streptavidin-biotin immunoenzymatic antigen detection system. This technique requires the sequential incubation of the AFA600 500 Slides specimen with an unconjugated primary antibody specific to the target antigen, a biotinylated secondary antibody which reacts SensiTek HRP Anti-Polyvalent (AEC) Staining with the primary antibody, enzyme-labeled streptavidin, and System substrate-chromogen. For most procedures, commercially Contains: 1 x 8ml Peroxide Block available primary antibodies can be diluted up to 50% more than 1 x 8ml Super Block with other systems. 1 x 8ml Anti-Polyvalent 1 x 8ml HRP Summary Protocol: 1 x 3ml AEC Chromogen Incubate on tissue section after application of the primary 7 x 5ml AEC Substrate antibody. Catalog Number Volume Catalog Number Volume AEN080 70 Slides ABL008 8 ml ABL015 15 ml SensiTek HRP Anti-Polyvalent (DAB) Staining ABL125 125 ml System ABL500 500 ml Contains: 1 x 8ml Peroxide Block ABL999 1000 ml 1 x 8ml Super Block 1 x 8ml Anti-Polyvalent 1 x 8ml HRP SensiTek 1 x 3ml DAB Chromogen 7 x 5ml DAB Substrate SensiTek Kits Catalog Number Volume AEM080 70 Slides SensiTek HRP SensiTek HRP Anti-Polyvalent Lab Pack Contains: One container of Super Block One container of Anti-Polyvalent SensiTek HRP Anti-Mouse (AEC) Staining System One container of HRP Contains: 1 x 8ml Peroxide Block Catalog Number Volume 1 x 8ml Super Block 1 x 8ml Anti-Mouse SHP125 1250 Slides 1 x 8ml HRP SHP500 5000 Slides 1 x 3ml AEC Chromogen SHP999 10000 Slides 7 x 5ml AEC Substrate SensiTek HRP Anti-Polyvalent Staining System Catalog Number Volume The SensiTek staining kit provides an unmatched combination of AEB080 70 Slides economy and sensitivity with incubation times of 20 minutes SensiTek HRP Anti-Mouse (DAB) Staining System each for the Link Antibody and Enzyme Label. Contains: 1 x 8ml Peroxide Block Contains: 4 x 15ml Super Block 1 x 8ml Super Block 4 x 15ml Anti-Polyvalent 1 x 8ml Anti-Mouse 4 x 15ml HRP 1 x 8ml HRP Catalog Number Volume 1 x 3ml DAB Chromogen 7 x 5ml DAB Substrate AFG600 500 Slides Catalog Number Volume SensiTek HRP Anti-Rabbit (AEC) Staining System AEA080 70 Slides Contains: 1 x 8ml Peroxide Block SensiTek HRP Anti-Mouse Lab Pack 1 x 8ml Super Block 1 x 8ml Anti-Rabbit Contains: One container of Super Block 1 x 8ml HRP One container of Anti-Mouse 1 x 3ml AEC Chromogen One container of HRP 7 x 5ml AEC Substrate Catalog Number Volume Catalog Number Volume SHM125 1250 Slides AEJ080 70 Slides SHM500 5000 Slides SHM999 10000 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
14 Immunohistochemistry
SensiTek HRP Anti-Rabbit (DAB) Staining System SensiTek Alk-Phos Anti-Polyvalent (Permanent Contains: 1 x 8ml Peroxide Block Red) Staining System 1 x 8ml Super Block The SensiTek staining kit provides unmatched sensitivity with 1 x 8ml Anti-Rabbit incubation times of 20 minutes each for the Link Antibody and 1 x 8ml HRP Enzyme Label. This kit includes our Permanent Red chromogen, 1 x 3ml DAB Chromogen which can be coverslipped with solvent based mounting media 7 x 5ml DAB Substrate for long term storage. Catalog Number Volume Contains: 1 x 8ml Super Block AEI080 70 Slides 1 x 8ml Anti-Polyvalent SensiTek HRP Anti-Rabbit Lab Pack 1 x 8ml Alk-Phos 1 x 2ml Permanent Red Concentrate Contains: One container of Super Block 8 x 5ml Permanent Red Buffer One container of Anti-Rabbit Catalog Number Volume One container of HRP AES080 70 Slides Catalog Number Volume SHR125 1250 Slides SensiTek Alk-Phos Anti-Polyvalent Lab Pack SHR500 5000 Slides Contains: One container of Super Block SHR999 10000 Slides One container of Anti-Polyvalent One container of Alk-Phos. SensiTek HRP Anti-Rabbit Staining System Catalog Number Volume Contains: 4 x 15ml Super Block 4 x 15ml Anti-Rabbit SAP125 1250 Slides 4 x 15ml HRP SAP500 5000 Slides SAP999 10000 Slides Catalog Number Volume AFE600 500 Slides SensiTek Alk-Phos Anti-Polyvalent Staining System Contains: 4 x 15ml Super Block SensiTek Alk-Phos 4 x 15ml Anti-Polyvalent 4 x 15ml Alk-Phos SensiTek Alk-Phos Anti-Mouse (Fast Red) Staining Catalog Number Volume System AFH600 500 Slides Contains: 1 x 8ml Super Block 1 x 8ml Anti-Mouse SensiTek Alk-Phos Anti-Rabbit (Fast Red) Staining 1 x 8ml Alk-Phos System 8 Fast-Red Tablets Contains: 1 x 8ml Super Block 8 x 5ml Naphthol Phosphate Buffer 1 x 8ml Anti-Rabbit Catalog Number Volume 1 x 8ml Alk-Phos AEC080 70 Slides 8 Fast-Red Tablets 8 x 5ml Naphthol Phosphate Buffer SensiTek Alk-Phos Anti-Mouse Lab Pack Catalog Number Volume Contains: One container of Super Block AEK080 70 Slides One container of Anti-Mouse One container of Alk-Phos. SensiTek Alk-Phos Anti-Rabbit Lab Pack Catalog Number Volume Contains: One container of Super Block One container of Anti-Rabbit SAM125 1250 Slides One container of Alk-Phos. SAM500 5000 Slides SAM999 10000 Slides Catalog Number Volume SAR125 1250 Slides SensiTek Alk-Phos Anti-Mouse Staining System SAR500 5000 Slides Contains: 4 x 15ml Super Block SAR999 10000 Slides 4 x 15ml Anti-Mouse 4 x 15ml Alk-Phos SensiTek Alk-Phos Anti-Rabbit Staining System Catalog Number Volume Contains: 4 x 15ml Super Block 4 x 15ml Anti-Rabbit AFB600 500 Slides 4 x 15ml Alk-Phos Catalog Number Volume AFF600 500 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
15 Immunohistochemistry SensiTek Individual Reagents SensiTek Horseradish Peroxidase The SensiTek reagents are ideal for laboratories that require both performance and economy. The link antibody and enzyme label each require a 20-minute incubation period. The reagents SensiTek Alkaline Phosphatase produce clear, crisp staining with almost any commercially The SensiTek reagents are ideal for laboratories that require both available primary antibody. performance and economy. The link antibody and enzyme label Catalog Number Volume each require a 20-minute incubation period. The reagents ABG008 8 ml produce clear, crisp staining with almost any commercially ABG015 15 ml available primary antibody. ABG125 125 ml Catalog Number Volume ABG500 500 ml ABH008 8 ml ABG999 1000 ml ABH015 15 ml ABH125 125 ml Super Block ABH500 500 ml Super Block is a unique serum-free blocking of non-specific ABH999 1000 ml antibody binding in IHC, ELISA and western blot. Super Block eliminates the need for matching species with the link antibody SensiTek Anti-Mouse and is often, more effective at reducing non-specific background The SensiTek reagents are ideal for laboratories that require both staining than normal serum. Ready-to-use no mixing required performance and economy. The link antibody and enzyme label Super Block reduces the handling of animal serums in the each require a 20-minute incubation period. The reagents laboratory. A streamlined formulation without normal serum in produce clear, crisp staining with almost any commercially the product eliminates the need to match species with the available primary antibody. secondary antibody. Catalog Number Volume Summary Protocol: ABC008 8 ml IHC: Incubate on tissue section prior to application of the primary ABC015 15 ml antibody. ABC125 125 ml ELISA: Add Super Block to microtiter well and incubate prior to ABC500 500 ml addition of sample. Rinse and continue procedure. ABC999 1000 ml Western Blot: An effective blocker for this technique at room temperature. SensiTek Anti-Polyvalent Catalog Number Volume The SensiTek reagents are ideal for laboratories that require both AAA125 125 ml performance and economy. The link antibody and enzyme label AAA500 500 ml each require a 20-minute incubation period. The reagents AAA999 1000 ml produce clear, crisp staining with almost any commercially available primary antibody. Catalog Number Volume EconoTek ABF008 8 ml ABF015 15 ml ABF125 125 ml HRP ABF500 500 ml ABF999 1000 ml EconoTek HRP Anti-Polyvalent (DAB) SensiTek Anti-Rabbit The EconoTek reagents are ideal for laboratories that require The SensiTek reagents are ideal for laboratories that require both both performance and maximum economy. The link antibody performance and economy. The link antibody and enzyme label and enzyme label each require a 30-minute incubation period. each require a 20-minute incubation period. The reagents The reagents produce clear, crisp staining with almost any produce clear, crisp staining with almost any commercially commercially available primary antibody. Our Anti-Polyvalent available primary antibody. systems may be used with primary antibodies derived from Catalog Number Volume Mouse, Rat, Rabbit and Guinea Pig. ABE008 8 ml Contains: 1 x 8ml Peroxide Block ABE015 15 ml 1 x 8ml Super Block ABE125 125 ml 1 x 8ml Anti-Polyvalent ABE500 500 ml 1 x 8ml HRP ABE999 1000 ml 1 x 3ml DAB Chromogen 7 x 5ml DAB Substrate Catalog Number Volume AEX080 70 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
16 Immunohistochemistry
EconoTek HRP Anti-Polyvalent Lab Pack The EconoTek reagents are ideal for laboratories that require Polymer IHC both performance and maximum economy. The link antibody and enzyme label each require a 30-minute incubation period. The reagents produce clear, crisp staining with almost any Polymer Kits commercially available primary antibody. Our Anti-Polyvalent systems may be used with primary antibodies derived from Mouse, Rat, Rabbit and Guinea Pig. CRF Anti-Polyvalent HRP Polymer (DAB) Lab Pack The bulk kits are ideal for high volume laboratories. Each Pack The CRF Anti-Polyvalent HRP Polymer (DAB) Lab Pack based on contains one bottle of Super Block (universal protein block), one proprietary CRF Technology has been developed to provide the bottle of Biotinylated Antibody (Polyvalent), and one bottle of cleanest, most consistent staining available. Developed in the Enzyme Labeled Streptavidin. Each bottle contains 125, 500, or research laboratories of ScyTek, the system utilizes a polymerized 1000ml of reagent. These Lab-Packs provide an extremely peroxidase label that eliminates biotin and its' associated economical alternative for automated staining systems. background issues from the equation. In addition, this product Catalog Number Volume reduces the steps required for immunohistochemical staining by combining two steps from the traditional Biotin-Streptavidin EHP125 1250 Slides system. The CRF technology based Anti-Polyvalent system is EHP500 5000 Slides effective with antibodies of mouse, rat, rabbit and guinea pig. EHP999 10000 Slides Each Lab Pack includes either 125ml, 500ml, or 1000ml of each component. Alk-Phos Contains: One bottle of Super Block. One bottle of CRF Anti-Polyvalent HRP Polymer. One bottle of DAB Substrate (High Contrast) EconoTek Alk-Phos Anti-Polyvalent Lab Pack One vial of DAB Chromogen Concentrate. The EconoTek reagents are ideal for laboratories that require Catalog Number Volume both performance and maximum economy. The link antibody CPP125 1250 Slides and enzyme label each require a 30-minute incubation period. CPP500 5000 Slides The reagents produce clear, crisp staining with almost any CPP999 10000 Slides commercially available primary antibody. Our Anti-Polyvalent systems may be used with primary antibodies derived from Mouse, Rat, Rabbit and Guinea Pig. Polymer HRP
The bulk kits are ideal for high volume laboratories. Each Pack CRF Anti-Polyvalent HRP Polymer (DAB) Stain Kit contains one bottle of Super Block (universal protein block), one bottle of Biotinylated Antibody (Polyvalent), and one bottle of The CRF Anti-Polyvalent HRP Polymer (DAB) Stain Kit based on Enzyme Labeled Streptavidin. Each bottle contains 125, 500, or proprietary CRF Technology has been developed to provide the 1000ml of reagent. These Lab-Packs provide an extremely cleanest, most consistent staining available. Developed in the economical alternative for automated staining systems. research laboratories of ScyTek, the system utilizes a polymerized peroxidase label that eliminates biotin and its' associated Catalog Number Volume background issues from the equation. In addition, this product EAP125 1250 Slides reduces the steps required for immunohistochemical staining by EAP500 5000 Slides combining two steps from the traditional Biotin-Streptavidin EAP999 10000 Slides system. The CRF technology based Anti-Polyvalent system is effective with antibodies of mouse, rat, rabbit and guinea pig. EconTek Alk-Phos Anti-Polyvalent (Fast Red) Kit Contents: Peroxide Block 8 ml The EconoTek reagents are ideal for laboratories that require Super Block 8 ml both performance and maximum economy. The link antibody CRF An -Polyvalent HRP 8 ml and enzyme label each require a 30-minute incubation period. DAB Chromogen Concentrate 3 ml The reagents produce clear, crisp staining with almost any DAB Substrate (High Contrast) 5 ml x 8 vials commercially available primary antibody. Our Anti-Polyvalent systems may be used with primary antibodies derived from Catalog Number Volume Mouse, Rat, Rabbit and Guinea Pig. CPH080 80 Slides
Contains: 1 x 8ml Super Block 1 x 8ml Anti-Polyvalent 1 x 8ml Alk-Phos 8 Fast-Red Tablets 8 x 5ml Naphthol Phosphate Buffer Catalog Number Volume AEY080 70 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
17 Immunohistochemistry
PolyTek Anti-Mouse (DAB) Polymerized HRP Imaging System Polymer Individual Reagents PolyTek HRP Anti-Mouse (DAB) Polymerized Imaging System has been developed to provide the cleanest, most consistent staining available. Developed in the research laboratories of ScyTek, the CRF Anti-Polyvalent HRP Polymer system is based on a polymerized peroxidase label that CRF Anti-Polyvalent HRP Polymer has been developed to provide eliminates biotin and its' associated background issues from the the cleanest, most consistent staining available. Developed in the equation. In addition, this product reduces the steps required for research laboratories of ScyTek, the system is based on a immunohistochemical staining by combining two steps from the polymerized peroxidase label that eliminates biotin and its' traditional Biotin-Streptavidin system. PolyTek HRP Anti-Mouse associated background issues from the equation. In addition, this Polymerized Imaging System is effective with antibodies of product reduces the steps required for immunohistochemical mouse or rat origin. staining by combining two steps from the traditional Biotin- Streptavidin system. CRF Anti-Polyvalent HRP Polymer is effective Contains: 1 x 8ml Peroxide Block for Image Analysis with antibodies of mouse, rat, rabbit and guinea pig. 1 x 8ml Super Block 1 x 8ml PolyTek Anti-Mouse HRP Summary Protocol: 1 x 3ml DAB Chromogen Incubate on tissue section after application of the primary 8 x 5ml DAB Substrate (High Contrast) antibody. Catalog Number Volume Recommended Components not Included: PIR080 70 Slides PolyTek Anti-Mouse HRP Polymer (DAB) Large HIER Solu on 1 x 500ml Peroxide Block for Image 1 x 500ml ADA500 Volume Kit Super Block 1 x 500ml AAA500 PolyTek Anti-Mouse HRP Polymer (DAB) Large Volume Kit has DAB Chromogen/Substrate Kit 1 x 500ml ACT500 been developed to provide the cleanest, most consistent staining Hematoxylin 1 x 500ml HMM500 available. Developed in the research laboratories of ScyTek, the Bluing Reagent 1 x 500ml BRT500 system is based on a polymerized peroxidase label that Catalog Number Volume eliminates biotin and its' associated background issues from the equation. In addition, this product reduces the steps required for ABZ008 8 ml immunohistochemical staining by combining two steps from the ABZ015 15 ml traditional Biotin-Streptavidin system. PolyTek Anti-Mouse HRP ABZ125 125 ml Polymer Large Volume Kit is effective with antibodies of mouse ABZ500 500 ml or rat origin. ABZ999 1000 ml Catalog Number Volume PolyTek Anti-Mouse Polymerized Alk-Phos PIR500 500 ml PIR999 1000 ml PolyTek Anti-Mouse Polymerized Alk-Phos has been developed to provide the cleanest, most consistent staining available. PolyTek HRP Anti-Rabbit Polymerized Imaging Developed in the research laboratories of ScyTek, the system is System based on a polymerized alkaline phosphatase label that eliminates biotin and its' associated background issues from the PolyTek HRP Anti-Rabbit (DAB) Polymerized Imaging System has equation. In addition, this product reduces the steps required for been developed to provide the cleanest, most consistent staining immunohistochemical staining by combining two steps from the available. Developed in the research laboratories of ScyTek, the traditional Biotin-Streptavidin system. PolyTek Anti-Mouse system is based on a polymerized peroxidase label that Polymerized Alk-Phos is effective with antibodies of mouse or rat eliminates biotin and its' associated background issues from the origin. equation. In addition, this product reduces the steps required for Catalog Number Volume immunohistochemical staining by combining two steps from the traditional Biotin-Streptavidin system. PolyTek HRP Anti-Rabbit PAT008 8 ml Polymerized Imaging System is effective with antibodies of rabbit PAT015 15 ml or guinea pig origin. PAT125 125 ml PAT500 500 ml Contains: 1 x 8ml Peroxide Block for Image Analysis PAT999 1000 ml 1 x 8ml Super Block 1 x 8ml PolyTek Anti-Rabbit HRP 1 x 3ml DAB Chromogen 8 x 5ml DAB Substrate (High Contrast) Catalog Number Volume PIP080 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
18 Immunohistochemistry
PolyTek, Anti-Mouse Polymerized HRP Super Block PolyTek, Anti-Mouse Polymerized HRP has been developed to Super Block is a unique serum-free blocking of non-specific provide the cleanest, most consistent staining available. The antibody binding in IHC, ELISA and western blot. Super Block system is based on a polymerized peroxidase label that eliminates the need for matching species with the link antibody eliminates biotin from the equation, thereby eliminating a major and is often, more effective at reducing non-specific background cause of background staining. In addition, this product reduces staining than normal serum. Ready-to-use no mixing required the steps required for immunohistochemical staining by Super Block reduces the handling of animal serums in the combining two steps from the traditional Biotin-Streptavidin laboratory. A streamlined formulation without normal serum in system. the product eliminates the need to match species with the Catalog Number Volume secondary antibody. PAM008 8 ml Summary Protocol: PAM015 15 ml IHC: Incubate on tissue section prior to application of the primary PAM125 125 ml antibody. PAM500 500 ml ELISA: Add Super Block to microtiter well and incubate prior to PAM999 1000 ml addition of sample. Rinse and continue procedure. Western Blot: An effective blocker for this technique at room PolyTek, Anti-Rabbit Polymerized Alk-Phos temperature. PolyTek Anti-Rabbit Polymerized Alk-Phos has been developed to Catalog Number Volume provide the cleanest, most consistent staining available. AAA125 125 ml Developed in the research laboratories of ScyTek, the system is AAA500 500 ml based on a polymerized alkaline phosphatase label that AAA999 1000 ml eliminates biotin and its' associated background issues from the equation. In addition, this product reduces the steps required for immunohistochemical staining by combining two steps from the Species Specific Reagents traditional Biotin-Streptavidin system. PolyTek Anti-Rabbit Polymerized Alk-Phos is effective with antibodies of rabbit or guinea pig origin. Mouse to Mouse Catalog Number Volume PAL008 8 ml PAL015 15 ml PAL125 125 ml Mouse to Mouse Alk-Phos (Permanent Red) PAL500 500 ml Staining System PAL999 1000 ml The Mouse to Mouse staining kit provides unmatched sensitivity with incubation times of 10 minutes each for the Link Antibody PolyTek, Anti-Rabbit Polymerized HRP and Enzyme Label. This kit includes our Permanent Red PolyTek, Anti-Rabbit Polymerized HRP has been developed to chromogen, which can be coverslipped with solvent based provide the cleanest, most consistent staining available. The mounting media for long term storage. system is based on a polymerized peroxidase label that eliminates biotin from the equation, thereby eliminating a major Contains: 1 x 8ml Super Block cause of background staining. In addition, this product reduces 1 x 8ml Mouse Block the steps required for immunohistochemical staining by 1 x 8ml Anti-Polyvalent combining two steps from the traditional Biotin-Streptavidin 1 x 8ml Alk-Phos system. 1 x 2ml Permanent Red Concentrate 7 x 5ml Permanent Red Buffer Catalog Number Volume Catalog Number Volume PAR008 8 ml PAR015 15 ml MTM004 70 Slides PAR125 125 ml Mouse to Mouse Alk-Phos Staining System PAR500 500 ml PAR999 1000 ml Contains: 3 x 15ml Super Block 3 x 15ml Mouse Block 3 x 15ml Anti-Polyvalent 3 x 15ml Alk-Phos Catalog Number Volume MTM005 400 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
19 Immunohistochemistry Mouse to Mouse HRP (AEC) Staining System Rabbit to Rabbit Contains: 1 x 8ml Peroxide Block 1 x 8ml Super Block 1 x 8ml Mouse Block 1 x 8ml Anti-Polyvalent Rabbit-to-Rabbit Blocking Reagent 1 x 8ml HRP ScyTek's Rabbit-to-Rabbit reagent has been formulated to 1 x 3ml Chromogen provide the researcher with a staining system capable of 6 x 5ml Substrate visualizing Rabbit antibodies on Rabbit tissue. In most cases a 30- Catalog Number Volume minute incubation with Rabbit-to-Rabbit block will virtually MTM002 70 Slides eliminate background staining that is caused by endogenous immunoglobulins. We highly recommend that this reagent be Mouse to Mouse HRP (DAB) Staining System used in conjunction with ScyTek's UltraTek Anti-Rabbit staining system for optimal results. Contains: 1 x 8ml Peroxide Block 1 x 8ml Super Block Catalog Number Volume 1 x 8ml Mouse Block RTR008 8 ml 1 x 8ml Anti-Polyvalent RTR015 15 ml 1 x 8ml HRP RTR125 125 ml 1 x 3ml Chromogen RTR500 500 ml 6 x 5ml Substrate Catalog Number Volume MTM001 70 Slides Blocking Reagents (IHC) Mouse to Mouse HRP Staining System Contains: 3 x 15ml Super Block 3 x 15ml Mouse Block Biotin Blocking Kit for Image Analysis 3 x 15ml Anti-Polyvalent Biotin Blocking Kit has been developed to use with 3 x 15ml HRP immunohistochemical (IHC) techniques for the reduction of Catalog Number Volume nonspecific background staining due to endogenous biotin. MTM003 400 Slides Biotin is a coenzyme of decarboxylase. It is present in many tissues, such as liver, pancreas, kidney, and intestine. Mouse-to-Mouse Blocking Reagent Endogenous biotin can interfere with staining systems that employ the use of biotin. This product is designed to effectively ScyTek's Mouse to Mouse reagent has been formulated to eliminate the interfering tendencies of endogenous biotin. provide the researcher with a staining system capable of visualizing mouse monoclonal antibodies on mouse tissue. In Clear liquid, two components (A and B). most cases a 30-minute incubation with Mouse to Mouse block will virtually eliminate background staining that is caused by Store Biotin Blocking Kit at 2-8 deg. C. Product is stable for 18 endogenous immunoglobulins. We highly recommend that this months from date of manufacture. reagent be used in conjunction with ScyTek's UltraTek Anti- Mouse staining system for optimal results. Catalog Number Volume Catalog Number Volume BBK030 15 ml ea. BBK120 60 ml ea. MTM008 8 ml MTM015 15 ml Human-to-Human Blocking Reagent MTM125 125 ml MTM500 500 ml ScyTek's Human to Human reagent has been formulated to provide the researcher with a staining system capable of visualizing human monoclonal antibodies on human tissue. In Human to Human most cases a 30-minute incubation with Human to Human block will virtually eliminate background staining that is caused by endogenous immunoglobulins. Human-to-Human Blocking Reagent Catalog Number Volume ScyTek's Human to Human reagent has been formulated to HTH008 8 ml provide the researcher with a staining system capable of HTH015 15 ml visualizing human monoclonal antibodies on human tissue. In HTH100 100 ml most cases a 30-minute incubation with Human to Human block will virtually eliminate background staining that is caused by endogenous immunoglobulins. Catalog Number Volume HTH008 8 ml HTH015 15 ml HTH100 100 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
20 Immunohistochemistry
Mouse-to-Mouse Blocking Reagent Rabbit-to-Rabbit Blocking Reagent ScyTek's Mouse to Mouse reagent has been formulated to ScyTek's Rabbit-to-Rabbit reagent has been formulated to provide the researcher with a staining system capable of provide the researcher with a staining system capable of visualizing mouse monoclonal antibodies on mouse tissue. In visualizing Rabbit antibodies on Rabbit tissue. In most cases a 30- most cases a 30-minute incubation with Mouse to Mouse block minute incubation with Rabbit-to-Rabbit block will virtually will virtually eliminate background staining that is caused by eliminate background staining that is caused by endogenous endogenous immunoglobulins. We highly recommend that this immunoglobulins. We highly recommend that this reagent be reagent be used in conjunction with ScyTek's UltraTek Anti- used in conjunction with ScyTek's UltraTek Anti-Rabbit staining Mouse staining system for optimal results. system for optimal results. Catalog Number Volume Catalog Number Volume MTM008 8 ml RTR008 8 ml MTM015 15 ml RTR015 15 ml MTM125 125 ml RTR125 125 ml MTM500 500 ml RTR500 500 ml Peroxide Block Super Block Peroxide Block: Super Block is a unique serum-free blocking of non-specific Hydrogen Peroxide Blocking Reagent is designed for use in antibody binding in IHC, ELISA and western blot. Super Block peroxidase-based immunohistochemical staining procedures on eliminates the need for matching species with the link antibody cell preparations and paraffin-embedded tissue sections. It is and is often, more effective at reducing non-specific background recommended for the reduction of background staining due to staining than normal serum. Ready-to-use no mixing required endogenous peroxidase. Super Block reduces the handling of animal serums in the laboratory. A streamlined formulation without normal serum in Summary Protocol: the product eliminates the need to match species with the Incubation on tissue section prior to application of the primary secondary antibody. antibody. The approximate concentration of hydrogen peroxide is 10%. Summary Protocol: Catalog Number Volume IHC: Incubate on tissue section prior to application of the primary antibody. ACA015 15 ml ELISA: Add Super Block to microtiter well and incubate prior to ACA125 125 ea. addition of sample. Rinse and continue procedure. ACA500 500 ml Western Blot: An effective blocker for this technique at room ACA999 1000 ml temperature. Peroxide Block for Image Analysis Catalog Number Volume AAA125 125 ml This reagent has been developed for use with AAA500 500 ml immunohistochemical (IHC) techniques for the reduction of nonspecific background staining due to endogenous peroxidase. AAA999 1000 ml Traditional methods describe blocking peroxidase with hydrogen peroxide. This reagent employs hydrogen peroxide in Chromogens (IHC) combination with additional novel components to further quench endogenous peroxidase.
Storage: 2-8 deg. Centigrade HRP Catalog Number Volume ADA015 15 ml HRP Kits ADA500 500 ml ADA999 1000 ml AEC Chromogen/Substrate Bulk Kit Pro-Block 3-Amino-9-Ethylcarbazole (AEC) is a widely used chromogen for Is a unique serum-free protein block for immunochemistry. Pro- immunohistochemical staining and immunoblotting. When in Block eliminates the need for matching species with the link the presence of peroxidase enzyme , AEC produces a vivid red antibody and is often, more effective at reducing non-specific end product that is soluble in alcohol and must be used with an background staining than normal serum. aqueous counterstain and mounting media. This product is Pro-Block is similar to Super Block, but without casein. The available in a two component form consisting of a liquid, reagent is filtered at 0.2 microns. refrigerator stable AEC Chromogen and AEC Substrate. Each component is individually stable for 18 months from the date of Catalog Number Volume manufacture. PBK125 125 ml Catalog Number Volume PBK500 500 ml PBK999 1000 ml ACJ500 515 ml PBK010 10 L ACJ999 1030 ml PBK-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
21 Immunohistochemistry
AEC Chromogen/Substrate Kit DAB Chromogen/Substrate Bulk Pack (High 3-Amino-9-Ethylcarbazole (AEC) is a widely used chromogen for Contrast) immunohistochemical staining and immunoblotting. When in This product has been developed for applications that require the presence of peroxidase enzyme , AEC produces a vivid red high contrast between the chromogen and Hematoxylin end product that is soluble in alcohol and must be used with an counterstain. The resulting stain is a darker brown than standard aqueous counterstain and mounting media. This product is DAB and somewhat more sensitive. 3,3'Diaminobenzidine (DAB) available in a two component form consisting of a liquid, is a widely used chromogen for immunohistochemical staining refrigerator stable AEC Chromogen and AEC Substrate. Each and immunoblotting. When in the presence of peroxidase component is individually stable for 18 months from the date of enzyme, DAB produces a brown precipitate that is insoluble in manufacture. This kit is formatted using convenient dropper-top alcohol. This product is available in a two component form vials. consisting of a liquid, refrigerator stable DAB Chromogen and DAB Substrate (High Contrast). The use of liquid components Substrate Pack: reduces some risks associated with handling powders (ie. dust 55ml Substrate (5 x 11 vials) inhalation), and eliminates waste which often results from using 3ml AEC Chromogen tablets that require a predetermined final volume. Catalog Number Volume Catalog Number Volume ACG500 500 Slides ACV500 530 ml ACV999 1060 ml DAB (Post) Enhancing Solution 3,3'Diaminobenzidine (DAB) is a widely used chromogen for DAB Chromogen/Substrate Kit immunohistochemical staining and immunoblotting. When in 3,3'-Diaminobenzidine (DAB) Ready-to-Use the presence of peroxidase enzyme, DAB produces a brown Is a widely used chromogen for immunohistochemical staining precipitate that is insoluble in alcohol. This solution has been and immunoblotting. When in the presence of the peroxidase developed to enhance DAB staining in a post staining procedure. enzyme, DAB produces a brown precipitate that is insoluble in The DAB will turn a darker and more intense brown after post- alcohol. Stained slides may be mounted in any commercially staining treatment. available permanent mounting media. This product is available Catalog Number Volume in a convenient two component form. For maximum flexibility, this product is available in bulk amounts or convenient dropper- DES500 500 ml top substrate packs. DES999 1000 ml DAB Away Kit Substrate Pack: 55ml DAB Substrate (x11 vials) Contamination with Diaminobenzidine residue is a problem seen 3ml DAB Chromogen in many laboratories. Of particular concern to the technician is Catalog Number Volume the reusable glassware and staining pads. This product completely removes the stain, rather than simply reduce the ACH500 500 Slides color intensity as the use of bleach does. The three component kit makes one liter of cleaning solution. DAB Chromogen/Substrate Kit (High Contrast) This product has been developed for applications that require COMPONENTS: high contrast between the chromogen and Hematoxylin DAB Reagent #1 - 125 ml counterstain. The resulting stain is a darker brown than standard DAB Reagent #2 - 125 ml DAB and somewhat more sensitive. ScyTek recommends using Decolorizer - 250 ml Hematoxyling for Automation (catalog # HAQ500) for optimal Catalog Number Volume contrast. 3,3'Diaminobenzidine (DAB) is a widely used chromogen for immunohistochemical staining and ACP001 500 ml immunoblotting. When in the presence of peroxidase enzyme, DAB Chromogen/Substrate Bulk pack DAB produces a brown precipitate that is insoluble in alcohol. This product is available in a two component form consisting of a 3,3'-Diaminobenzidine (DAB) Ready-to-Use liquid, refrigerator stable DAB Chromogen and DAB Substrate Is a widely used chromogen for immunohistochemical staining (High Contrast). The standard working dilution is 50ul (0.9mg) of and immunoblotting. When in the presence of the peroxidase DAB Chromogen per 1ml of DAB Substrate (High Contrast), enzyme, DAB produces a brown precipitate that is insoluble in although the ratio can be adjusted as desired. The use of liquid alcohol. Stained slides may be mounted in any commercially components reduces some risks associated with handling available permanent mounting media. This product is available powders (ie. dust inhalation), and eliminates waste which often in a convenient two component form. results from using tablets that require a predetermined final Catalog Number Volume volume. Once the two components are combined, the reagent can be used for up to six hours, making it ideal for automated ACK500 530 ml stainers. ACK999 1060 ml Catalog Number Volume ACT500 500 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
22 Immunohistochemistry
DAB Differentiating Solution DAB Enhancer Solution May be used for removal of excess DAB staining from tissue 3,3'Diaminobenzidine (DAB) is a widely used chromogen for specimens. immunohistochemical staining and immunoblotting. When in Catalog Number Volume the presence of peroxidase enzyme, DAB produces a brown precipitate that is insoluble in alcohol. This solution has been DDS500 500 ml developed to enhance DAB staining in a post staining procedure. The use of DAB Enhancer Solution will result a darker and more DAB Enhancer Solution intense blackish-brown stain 3,3'Diaminobenzidine (DAB) is a widely used chromogen for Catalog Number Volume immunohistochemical staining and immunoblotting. When in the presence of peroxidase enzyme, DAB produces a brown ACM030 30 ml precipitate that is insoluble in alcohol. This solution has been developed to enhance DAB staining in a post staining procedure. DAB Substrate (High Contrast) The use of DAB Enhancer Solution will result a darker and more This product is available in a convenient two component form. intense blackish-brown stain For maximum flexibility, this product is available in bulk amounts Catalog Number Volume or convenient dropper-top. Use with ScyTek catalog number ACB030, DAB Chromogen. ACM030 30 ml Catalog Number Volume HRP Individual Reagents ACU250 250 ml ACU500 500 ml ACU999 1000 ml AEC Chromogen Concentrate Catalog Number Volume DAB Substrate Buffer ACD015 15 ml This product is available in a convenient two component form. ACD030 30 ml For maximum flexibility, this product is available in bulk amounts ACD125 125 ml or convenient dropper-top. Use with ScyTek catalog number ACB030, DAB Chromogen. AEC Substrate Buffer Catalog Number Volume Catalog Number Volume ACC500 500 ml ACE500 500 ml ACC999 1000 ml ACE999 1000 ml Alk-Phos DAB (Post) Enhancing Solution 3,3'Diaminobenzidine (DAB) is a widely used chromogen for immunohistochemical staining and immunoblotting. When in Alk-Phos Kits the presence of peroxidase enzyme, DAB produces a brown precipitate that is insoluble in alcohol. This solution has been BCIP/INT Solution developed to enhance DAB staining in a post staining procedure. The DAB will turn a darker and more intense brown after post- 5-Bromo-4-Chloro-3-IndolylPhosphate/p-Iodonitrotetrazolium staining treatment. (BCIP/INT) Solution Is a chromogen used in immunohistochemical and in-situ Catalog Number Volume staining. This reagent is available as a single component, ready- DES500 500 ml to-use reagent. When in the presence of the Alkaline- DES999 1000 ml Phosphatase enzyme, BCIP/INT produces a brown precipitate that is soluble in alcohol. DAB Chromogen Concentrate Catalog Number Volume 3,3'-Diaminobenzidine (DAB) Concentrate is a widely used ACL125 125 ml chromogen for immunohistochemical staining and ACL500 500 ml immunoblotting. When in the presence of the peroxidase enzyme, DAB produces a brown precipitate that is insoluble in ACL999 1000 ml alcohol. Stained slides may be mounted in any commercially BCIP/NBT Solution available permanent mounting media. This product is available in a convenient two component form. For maximum flexibility, 5-Bromo-4-Chloro-3-Indolyl Phosphate/nitroblue Tetrazolium this product is available in bulk amounts or convenient dropper- (BCIP/NBT) Solution top. Use with ScyTek catalog number ACC999, DAB Substrate. Is a widely used chromogen for immunohistochemical and in-situ Catalog Number Volume staining. This reagent is available as a single component, ready- to-use reagent. When in the presence of the Alkaline- ACB030 30 ml Phosphatase enzyme, BCIP/NBT produces a purple precipitate ACB060 60 ml that is soluble in alcohol. ACB125 125 ml Catalog Number Volume ACB500 500 ml ACB999 1000 ml ACN125 125 ml ACN500 500 ml ACN999 1000 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
23 Immunohistochemistry
Permanent Red Bulk Pack (For Alkaline BCIP/NBT Solution Phosphatase) 5-Bromo-4-Chloro-3-Indolyl Phosphate/nitroblue Tetrazolium Permanent Red is a chromogen for immunohistochemical (BCIP/NBT) Solution staining and immunoblotting. When in the presence of alkaline Is a widely used chromogen for immunohistochemical and in-situ phosphatase enzyme, Permanent Red produces an intense red staining. This reagent is available as a single component, ready- precipitate that may be permanently mounted. Reagent may be to-use reagent. When in the presence of the Alkaline- mixed for up to 2 hours prior to application making it suitable for Phosphatase enzyme, BCIP/NBT produces a purple precipitate automated staining. that is soluble in alcohol. Catalog Number Volume Catalog Number Volume PRD500 515 ml ACN125 125 ml PRD999 1030 ml ACN500 500 ml ACN999 1000 ml Permanent Red Kit (For Alkaline Phosphatase) Permanent Red (For Alkaline Phosphatase) is a two-component Ancillary (IHC) chromogen for immunohistochemical staining and immunoblotting. When in the presence of alkaline phosphatase enzyme, Permanent Red produces an intense red precipitate that is insoluble in alcohol and may be permanently mounted in synthetic resin. The working solution may be mixed for up to 2 BRIJ 35 Solution (25-30%) hours prior to application making it suitable for automated staining. BRIJ 35 Solution is a nonionic polyoxyethylene surfactant used in Contents: a variety of protein methods. The reagent is an aqueous base containing 25-30% w/v proteomics grade BRIJ 35 making it Catalog# PRD-15 1ml Permanent Red optimal for use as a wetting agent in immunohistochemical 15ml Buffer reagents. Catalog Number Volume Catalog# PRD-61 2ml Permanent Red BRJ500 500 ml 60ml Buffer BRJ999 1000 ml Catalog Number Volume PRD-15 15 ml Primary Antibody Dropper Vial PRD-61 61 ml Provides a simple solution for storing and dispensing of diluted primary antibodies. Using a permanent marker, simply fill in the Alk-Phos Individual Reagents Antibody, Species, Date Manufactured, and the Expiration Date. Store diluted antibody at 2-8 C.
Alkaline Phosphatase Enhancer Contains: 1x15ml Vial, 1 Dropper Tip, 1 Green Cap, and 3 printed Is a single component, ready-to-use reagent which produces a labels. several-fold increase in staining intensity. To use, simply Catalog Number Volume incubate the tissue section for one minute in this reagent, just PAV015 1 ea. prior to incubation with Fast-Red, BCIP, or New Fuchsin. Catalog Number Volume Tween 20 APE125 125 ml Polyoxyethylenesorbitan Monolaurate - Tween 20. APE500 500 ml Catalog Number Volume APE999 1000 ml TWN500 500 ml BCIP/INT Solution TWN999 1000 ml 5-Bromo-4-Chloro-3-IndolylPhosphate/p-Iodonitrotetrazolium Water, Deionized/Distilled (BCIP/INT) Solution Is a chromogen used in immunohistochemical and in-situ Water for use in laboratory procedures has been deionized, staining. This reagent is available as a single component, ready- distilled and filtered at 0.2 micrometer for critical assays. to-use reagent. When in the presence of the Alkaline- Catalog Number Volume Phosphatase enzyme, BCIP/INT produces a brown precipitate DDH999 1000 ml that is soluble in alcohol. DDH3800 1 Gal. Catalog Number Volume DDH-20000 20 L ACL125 125 ml ACL500 500 ml ACL999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
24 Immunohistochemistry Antibody Diluents and HRP Stabilizing Diluent (Phosphate Buffered) This product has been developed to significantly increase the Stabilizers shelf life of diluted peroxidase labeled proteins. Stability is increased at room temperature storage conditions in addition to 2-8 centigrade. This product is subjected to 0.45 micron filtration, and contains no mercury or azide. This formulation Alk-Phos Stabilizing Diluent insures consistently high levels of activity for both the enzyme This reagent is formulated specifically for Alkaline Phosphatase and the antibody following long-term storage at final-use conjugates. The product insures consistently high levels of dilution. HRP Stabilizer greatly improves the signal to noise activity for both the enzyme and the antibody following long- ratios which increases the immunoassay sensitivity and offers term storage at final dilution. This product has been chemically cleaner assays. This product has been chemically engineered to engineered to increase conjugate stability providing the increase conjugate stability providing the customer a longer shelf customer a longer shelf life, resistance to various shipping life, resistance to various shipping conditions & storage conditions and storage temperatures. Alk-Phos Stabilizing temperatures and improved day to day assay precision. Diluent is filtered at 0.2 um and reinforced with a non-mercury or azide-free preservative. Inquire about custom vialing, labeling, This product is recommended to be used in conjunction with kit assembly and drop shipping. ScyTek's proprietary Coating Stabilizer, Blocking Buffer (Super Block), Washing solution, TMB and Stopping Solution. All of the Catalog Number Volume ELISA products are available in bulk quantities, including custom APD500 500 ml lot sizes up to 5000 liters. ScyTek Laboratories, Inc. specializes in APD999 1000 ml custom manufacturing, vialing, labeling and packaging. Call today for a quote 800-729-8350. Enzyme Label Diluent Catalog Number Volume Provided as a ready-to-use diluent for enzyme labeled antibodies HSB500 500 ml and streptavidin/avidin enzyme conjugates. Diluted reagents can HSB999 1000 ml be stored at 2-8 deg. C for up to 18 months at immunohistochemical dilutions. This reagent is subjected to 0.2 Normal Antibody Diluent (Phosphate Buffered) micron filtration. Provided as a ready-to-use diluent for primary antibodies and Catalog Number Volume link/secondary antibodies. In most cases, antibodies diluted in ABI500 500 ml this reagent can be stored at 4-8 deg. C for up to 18 months. ABI999 1000 ml Diluent is subjected to 0.2 micron filtration. Catalog Number Volume HRP Stabilizing Diluent (MOPS Buffered) ABB125 125 ml HRP Stabilizing Diluent (MOPS Buffered) has been developed ABB500 500 ml specifically for the stabilization of Horseradish Peroxidase ABB999 1000 ml conjugates in solution. HRP Stabilizer prevents the loss of catalytic activity and maintains the conformation of the antibody Normal Antibody Diluent (Tris Buffered) or protein antigen portion of the conjugate. Product is filtered at 0.2 microns. Provided as a ready-to-use diluent for primary antibodies and link/secondary antibodies. In most cases, antibodies diluted in Contents: Aqueous, protein-containing diluent and stabilizer for this reagent can be stored at 4-8 deg. C for up to 18 months. Horseradish Peroxidase conjugates. Diluent is subjected to 0.2 micron filtration. Catalog Number Volume Preservative: 0.02% Bromonitrodioxane, 0.02% 2-Methyl-4- ADT125 125 ml isothiazolin-3-one, 0.005% Proclin 300 (Proclin is a registered ADT500 500 ml trademark of Rohm & Haas Company), and 0.0008% Neomycin. ADT999 1000 ml Catalog Number Volume HSM125 125 ml HSM500 500 ml HSM999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
25 Immunohistochemistry
Primary Antibody Diluent (Phosphate, Green) Citrate Plus (10x) HIER Solution Provided as a ready-to-use (Phosphate Buffered) diluent This is a unique citrate buffer designed to significantly enhance containing green dye for diluting primary antibodies and for use immunohistochemical staining with many commercially available as a negative control. Both monoclonal and polyclonal primary antibodies. Diluted 1:10 with deionized or distilled antibodies are stabilized for long-term storage thereby reducing water, this product is easy to use and highly effective. Citrate the number of titrations required from concentrated form. This Plus (10X) can be used in a vegetable steamer, autoclave, or product contains a highly purified carrier protein that minimizes pressure cooker. However, for optimal results we recommend proteolytic enzyme degradation, a wetting agent to reduce the autoclave or pressure cooker. surface tension and an anti-microbial agent to prevent microbial pH 6.5 ±0.5 growth. Not for antibodies that have been conjugated with Catalog Number Volume peroxidase. In most cases, antibodies diluted in this reagent can be stored for 24 months at 2-8 C. Diluent is subjected to 0.2 CPL500 500 ml micron filtration. CPL999 1000 ml pH 7.4 EDTA - Saline Buffer (10X Concentrate); pH 8.0 Catalog Number Volume EDTA Buffer (10X) HIER Solution (pH 8.0) is a unique buffer designed to significantly enhance immunohistochemical staining APG125 125 ml with many commercially available primary antibodies. Diluted APG500 500 ml 1:10 with deionized or distilled water, this product is easy to use APG999 1000 ml and highly effective. APG010 10 L Catalog Number Volume Primary Antibody Diluent (Tris, Green) ETA500 500 ml Provided as a ready-to-use (Tris Buffered) diluent containing ETA999 1000 ml green dye for diluting primary antibodies and for use as a Pepsin, Stabilized Solution negative control. Both monoclonal and polyclonal antibodies are stabilized for long-term storage thereby reducing the number of The tissue section is incubated 10 minutes at 37 deg. centigrade titrations required from concentrated form. This product in this single component, ready-to-use solution. This product is contains a highly purified carrier protein that minimizes stable for 12 months at 4 deg. Centigrade. Pepsin is a commonly proteolytic enzyme degradation, a wetting agent to reduce used digestive enzyme for immunohistochemical procedures. surface tension and an anti-microbial agent to prevent microbial This product is provided as a single component, ready-to-use growth. Not for antibodies that have been conjugated with solution. peroxidase. In most cases, antibodies diluted in this reagent can Catalog Number Volume be stored for 24 months at 2-8 C. Diluent is subjected to 0.2 micron filtration. PSS060 60 ml PSS125 125 ml pH 7.4 Tris-EDTA HIER Solution (10x) pH 9.0 Catalog Number Volume Tris-EDTA HIER Solution (10x) pH 9.0 is a unique buffer designed ATG125 125 ml to significantly enhance immunohistochemical staining with ATG500 500 ml many commercially available primary antibodies. Diluted 1:10 ATG999 1000 ml with deionized or distilled water, this product is easy to use and ATG-20000 20 L highly effective. Catalog Number Volume Digestion Enzymes and TES500 500 ml Enhancers TES999 1000 ml Trypsin Enzymatic Digestion Kit The tissue section is incubated 10 minutes at 37 deg. centigrade Citrate Buffer (10x) pH 6.0 in this two component, ready-to-use solution. This product is stable for 9 months at 2-8 deg. Centigrade. This product contains Citrate Buffer (10X) HIER Solution (pH 6.0) is a unique citrate 30 or 60 ml of Trypsin concentrate, and 125 or 250 ml of Buffer. buffer designed to significantly enhance immunohistochemical staining with many commercially available primary antibodies. Catalog Number Volume Diluted 1:10 with deionized or distilled water, this product is easy TSS155 155 ml to use and highly effective. TSS310 310 ml Catalog Number Volume CBB125 125 ml CBB500 500 ml CBB999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
26 Immunohistochemistry
Phosphate Buffered Saline plus Tween 20 (10x) pH Buffers 7.4 ScyTek Phosphate Buffered Saline + Tween 20 (10x) pH of 7.4 is an optimal formulation of pH stabilizers, salts and detergents Phosphate Buffered Saline (10x) pH 7.4 designed to effectively remove excess material from the ScyTek Phosphate Buffered Saline (10x) pH 7.4 is an optimal microtiter plate wells without disrupting the ELISA binding formulation of pH stabilizers and salts designed to effectively reaction. By maintaining the proper buffering environment, remove excess material from the microtiter plate wells without unbound components can be washed away without suppressing disrupting the ELISA binding reaction. By maintaining the proper antigen-antibody binding interactions, thereby reducing buffering environment, unbound components can be washed nonspecific background and increasing the specific signal. Our away without suppressing antigen-antibody binding interactions, Wash buffers do not contain hazardous preservatives such as thereby reducing nonspecific background and increasing the Azide or Mercury that may interfere with antibody-antigen specific signal. Our Wash buffers do not contain hazardous binding interactions. For your convenience wash buffer is preservatives such as Azide or Mercury that may interfere with offered in a wide variety of formulations to meet the needs of antibody-antigen binding interactions. For your convenience your specific ELISA application. This product can be customized wash buffer is offered in a wide variety of formulations to meet to meet the specific needs of your assay. Inquire about custom the needs of your specific ELISA application. This product can be vialing, labeling, kit assembly and drop shipping. customized to met the specific needs of your assay. Inquire Catalog Number Volume about custom vialing, labeling, kit assembly and drop shipping. PBE500 500 ml Catalog Number Volume PBE999 1000 ml PBD500 500 ml PBE010 10 L PBD999 1000 ml PBE-20000 20 L PBD010 10 L PBD-20000 20 L Phosphate Buffered Saline plus Tween 20 (20x) pH 7.6 Phosphate Buffered Saline (25x) pH 7.6 ScyTek Wash buffer formulations are an optimal formulation of ScyTek Phosphate Buffered Saline (25x) pH of 7.6 is an optimal pH stabilizers, salts and detergents designed to effectively formulation of pH stabilizers and salts designed to effectively remove excess material from the microtiter plate wells without remove excess material from the microtiter plate wells without disrupting the ELISA binding reaction. By maintaining the proper disrupting the ELISA binding reaction. By maintaining the proper buffering environment, unbound components can be washed buffering environment, unbound components can be washed away without suppressing antigen-antibody binding interactions, away without suppressing antigen-antibody binding interactions, thereby reducing nonspecific background and increasing the thereby reducing nonspecific background and increasing the specific signal. Our Wash buffers do not contain hazardous specific signal. Our Wash buffers do not contain hazardous preservatives such as Azide or Mercury that may interfere with preservatives such as Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience antibody-antigen binding interactions. For your convenience wash buffer is offered in a wide variety of formulations to meet wash buffer is offered in a wide variety of formulations to meet the needs of your specific ELISA application. This product can be the needs of your specific ELISA application. This product can be customized to meet the specific needs of your assay. Inquire customized to meet the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. about custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume PBT500 500 ml PBS125 125 ml PBT999 1000 ml PBS500 500 ml PBT010 10 L PBS999 1000 ml PBT-20000 20 L PBS010 10 L PBS-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
27 Immunohistochemistry
Tris Buffered Saline (10x) pH 7.5 Tris Buffered Saline plus Tween 20 (10x) pH 7.5 ScyTek Tris Buffered Saline (10x) pH of 7.5 is an optimal ScyTek Tris Buffered Saline + Tween 20 (10x) pH of 7.5 is an formulation of pH stabilizers, salts and detergents designed to optimal formulation of pH stabilizers, salts and detergents effectively remove excess material from the microtiter plate designed to effectively remove excess material from the wells without disrupting the ELISA binding reaction. By microtiter plate wells without disrupting the ELISA binding maintaining the proper buffering environment, unbound reaction. By maintaining the proper buffering environment, components can be washed away without suppressing antigen- unbound components can be washed away without suppressing antibody binding interactions, thereby reducing nonspecific antigen-antibody binding interactions, thereby reducing background and increasing the specific signal. Our Wash buffers nonspecific background and increasing the specific signal. Our do not contain hazardous preservatives such as Azide or Mercury Wash buffers do not contain hazardous preservatives such as that may interfere with antibody-antigen binding interactions. Azide or Mercury that may interfere with antibody-antigen For your convenience wash buffer is offered in a wide variety of binding interactions. For your convenience wash buffer is formulations to meet the needs of your specific ELISA offered in a wide variety of formulations to meet the needs of application. This product can be customized to meet the specific your specific ELISA application. This product can be customized needs of your assay. Inquire about custom vialing, labeling, kit to meet the specific needs of your assay. Inquire about custom assembly and drop shipping. vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBD500 500 ml TBE500 500 ml TBD999 1000 ml TBE999 1000 ml TBD010 10 L TBE010 10 L TBD-20000 20 L TBE-20000 20 L Tris Buffered Saline (25x) pH 7.4 Tris Buffered Saline plus Tween 20 (20x ScyTek Tris Buffered Saline (25x) pH of 7.4 is an optimal Concentrate) pH 7.4 formulation of pH stabilizers, salts and detergents designed to ScyTek Tris Buffered Saline + Tween 20 (20x Concentrate) pH of effectively remove excess material from the microtiter plate 7.4 is an optimal formulation of pH stabilizers, salts and wells without disrupting the ELISA binding reaction. By detergents designed to effectively remove excess material from maintaining the proper buffering environment, unbound the tissue sample or microtiter plate wells without disrupting the components can be washed away without suppressing antigen- antibody binding reaction. By maintaining the proper buffering antibody binding interactions, thereby reducing nonspecific environment, unbound components can be washed away background and increasing the specific signal. Our Wash buffers without suppressing antigen-antibody binding interactions, do not contain hazardous preservatives such as Azide or Mercury thereby reducing nonspecific background and increasing the that may interfere with antibody-antigen binding interactions. specific signal. Our Wash buffers do not contain hazardous For your convenience wash buffer is offered in a wide variety of preservatives such as Azide or Mercury that may interfere with formulations to meet the needs of your specific ELISA antibody-antigen binding interactions. For your convenience application. This product can be customized to met the specific wash buffer is offered in a wide variety of formulations to meet needs of your assay. Inquire about custom vialing, labeling, kit the needs of your specific ELISA application. assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBT500 500 ml TBS500 500 ml TBT999 1000 ml TBS999 1000 ml TBT010 10 L TBS010 10 L TBT-20000 20 L TBS-20000 20 L Mounting Media (IHC)
Aqueous Mount Is formulated for coverslipping sections stained with alcohol soluble chromogens, such as Fast-Red or AEC. Available in convenient dropper top bottles. Coverslips can be removed by soaking in water. No heating is required before use. Catalog Number Volume AMT030 30 ml AMT060 60 ml AMT500 500 ml AMT999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
28 Immunohistochemistry
Aqueous Mount (Low Viscosity) Permanent Mounting Media (Aqueous) Is formulated for coverslipping sections stained with alcohol AEC and Fast Red are two of the most commonly used soluble chromogens, such as Fast-Red or AEC. Available in chromogens for peroxidase and alkaline phosphatase based convenient dropper top bottles. Coverslips can be removed by immunostaining systems respectively. However, slides stained soaking in water. No heating is required before use. Flows more with these chromogens cannot be stored permanently. freely than AMT. Permanent Mounting Medium (Aqueous) has been designed to Catalog Number Volume overcome this limitation. This product is an aqueous mounting medium with a very high refractive index, which when applied to AML030 30 ml the stained tissue sections can store the tissue specimens AML060 60 ml permanently without fading of the chromogens. Because of the AML500 500 ml superior refractive index, tissues mounted in this medium look AML999 1000 ml like dehydrated specimens. No coverslipping is required. However, if coverslipping is desired, dry slides can be post Buffered Glycerol Mounting Media mounted using an organic based mounting medium. Advantages Buffered Glycerol Mounting Media is a non-drying formulation of this product include: no coverslip, no exposure to the organic that is useful in a variety of procedures, such as fumes, permanent storage of slides and high resolution of tissue immunofluorescence, immunohistochemistry, special stains, etc. specimens. This reagent is compatible with AEC, DAB, Fast Red, Coverslips may be easily removed by soaking in water. BCIP/NBT, BCIP/INT and fluorescent dyes like FITC and No heating is required before use. phycobiliproteins. High pH ensures increased stability of Contains no Anti-Fade components. fluorescence. pH 8.0 Catalog Number Volume Catalog Number Volume PMT030 30 ml GMM003 3 ml GMM030 30 ml Miscellaneous (IHC) GMM500 500 ml GMM999 1000 ml FluoreGuard Mounting Medium KP Marker Plus FluoreGuard Mounting Medium is a water-soluble medium Klinipath KP Marker Plus is a solvent resistant marking pen for designed for semi-permanent coverslipping of fluorescent slide permanent writing on glass slides, cassettes and other items in preparations. FluoreGuard dries to a semi-rigid layer which the laboratory. One box contains 12 pens. eliminates tissue damage due to moving coverslips and facilitates Catalog Number Volume long term storage. KPM-1 12 Pen(s) Catalog Number Volume FMM030 30 ml PAP Pen FMM060 60 ml This marking pen has been designed to provide a thin film-like FMM500 500 ml barrier when a circle is drawn around the specimen on a slide. FMM999 1000 ml This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen FluoreGuard Mounting Medium (Hard Set) contains a special formulation which is insoluble in alcohol and FluoreGuard Mounting Medium (Hard Set) is a water-soluble acetone. It can be removed, if desired, by xylene after the medium designed for semi-permanent coverslipping of staining procedure is completed. fluorescent slide preparations. FluoreGuard dries to a semi-rigid Catalog Number Volume layer which eliminates tissue damage due to moving coverslips LP0001 1 ea. and facilitates long term storage. Catalog Number Volume PAP Pen-Mini FMH030 30 ml This marking pen has been designed to provide a thin film-like FMH060 60 ml barrier when a circle is drawn around the specimen on a slide. FMH500 500 ml This barrier creates the proper surface tension to hold an FMH999 1000 ml antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed. Catalog Number Volume LP0002 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
29 Immunohistochemistry
CoreDish for Prostate Biopsies Equipment (IHC) Few recommendations concerning how the biopsies should be handled have been published. Performing a large number of biopsies means an increase in the number of containers handled and consequently a technical overload of the transmission Blue Base for Dissecting Board network, which occurs without any financial counterpart. A new approach had to be developed in order to increase productivity. To make dissecting more confortable, this heavy-duty base is used to elevate the DissecTable Board to the right height. The Simport is proud to offer a multi-compartment container for bases are stackable and will not move sideways during the prostate biopsies. The CoreDish is in the shape of a dish dissecting work. The base will also retain excess fluid if necessary. measuring only 15 mm high x 95 mm diameter and is half prefilled with 10% Neutral Buffered Formalin. The screw on lid Dimensions: 481 mm x 656 mm x 91 mm (19 1/4 x 26 1/4 x 3 5/8 incorporates an O-ring in order to make it leakproof and protect in H) its contents. The CoreDish conforms to OSHA directives. An area Catalog Number Volume for patient information is provided on the label. Each compartment is clearly identified to allow proper placement and M625 1 ea. visualization of the prostate biopsy being inserted. Out of eight Cassettes in QuickLoad Sleeves compartments, six are labeled: Base, Lateral Base, Medial, Lateral Medial, Apex, Lateral Apex. The sleeved cassettes are especially made to be used with ThermoFisher printers. Cassettes with tape are to be used with Thanks to the CoreDish it is no more necessary to use a multitude Leica and Sakura Ink Jet printers. Molded from a special high of individual containers, thereby reducing risks of confusion. density acetal polymer, they keep specimens safely submerged and are totally resistant to the chemical action of solvents used in Qty/Cs 10 histology laboratories. The efficient flow-through slots maximize Catalog Number Volume fluid exchange and ensure proper reagent drainage. M971-D8P 1 Case(s) Catalog Number Volume M970-D8P-PREFILLED 1 Case(s) M480-6SL-BLUE 1 ea. M480-7SL-PEACH 1 ea. CoreDish Prostate Biopsy Container with 10% M480-12SL-AQUA 1 ea. Formalin M480-8SL-TAN 1 ea. Few recommendations concerning how the biopsies should be M480-5SL-YELLOW 1 ea. handled have been published. Performing a large number of M480-4SL-GREEN 1 ea. biopsies means an increase in the number of containers handled M480-2SL-WHITE 1 ea. and consequently a technical overload of the transmission M480-11SL-ORANGE 1 ea. network, which occurs without any financial counterpart. A new M480-10SL-GRAY 1 ea. approach had to be developed in order to increase productivity. M480-9SL-GRAY 1 ea. M480-3SL-PINK 1 ea. Simport is proud to offer a multi-compartment container for prostate biopsies. The CoreDish is in the shape of a dish CoreDish for Lower GI Track Biopsies measuring only 15 mm high x 95 mm diameter and is half prefilled with 10% Neutral Buffered Formalin. The screw on lid For lower GI track biopsies. Twelve compartments. An area for incorporates an O-ring in order to make it leakproof and protect patient information is provided. Ten labeled compartments: its contents. The CoreDish conforms to OSHA directives. An area Proximal Flexure Colon, Hepatic Flexure Colon, Distal Transverse for patient information is provided on the label. Each Colon, Ascending Colon, Splenic flexure Colon, Cecum, compartment is clearly identified to allow proper placement and Decending Colon, Terminal Ileum, Rectum, Sigmoid Colon. visualization of the prostate biopsy being inserted. All twelve Leakproof seal, thanks to O-ring lid, allows for safe and easy compartments are labeled: transport of the specimens from collection to analysis. L Base, R Base, L Lateral Base, R Lateral Base, L Lateral Medial, L Medial, R Medial, R Lateral Medial, Made of polystyrene. L Lateral Apex, L Apex, R Apex, R Lateral Apex. Qty/Cs 10 Thanks to the CoreDish it is no more necessary to use a multitude Catalog Number Volume of individual containers, thereby reducing risks of confusion. M971-D12LGI 1 Case(s) M970-D12LGIPREFILLE 1 Case(s) Made of polystyrene.
Qty/Cs 10 Catalog Number Volume M971-D12P 1 Case(s) M970-D12P-PREFILLED 1 Case(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
30 Immunohistochemistry
CoreDish Upper GI Tract EasyDip Slide Staining System Upper GI track biopsy container with 10% formalin. For upper GI Finally a user-friendly approach for staining your microscope track biopsies. Eight compartments. An area for patient slides, the EasyDip Slide Staining System has two components: a information is provided. Seven labeled compartments: Gastric square staining jar and a 12 - position vertical slide rack. Jars can Card, Gastric Body, GE Junction, Gastric ATR, Distal Esophage, be loosely joined to each other laterally, therefore making sure Pylorus, Duodeum. Leakproof seal, thanks to O-ring lid, allows for they are kept in the same order when moved around on the lab safe and easy transport of the specimens from collection to counter. As an extra benefit, they are available in 5 different analysis. 10 per case. colors to help better identifying contents or applications.
Made of polystyrene. The staining jar being made of resistant acetal plastic will not Catalog Number Volume break like most glass jars do. It will resist most staining agents including alcohol and xylene (but not phenol, iodine or ferric M971-D8UGI 1 Case(s) chloride ). The wide stable base offers greater stability while the M970-D8UGI-PREFILLE 1 Case(s) inside is recessed, allowing for a smaller reagent volume of only 80 ml. Easy to clean and no metals to corrode. Ideal for special Dissecting Board stains, frozen sections and special processes. Will resist A new and unique approach makes this dissecting board more temperatures between -170 C and +121 C. Autoclavable. convenient than any other found on the market today. It is no Dimensions: 64 x 76 x 92 mm H (2 1/2 x 3 x 3 5/8 in. H). more necessary to buy different sizes as this board offers a large surface on one side and two smaller ones on the other side. Each case indudes 5 jars (one of each color) and 1 rack M905- 12DGY. Made of heavy-duty stain resistant thick polyethylene, it will last Catalog Number Volume for years to come without changing shape, bending or swelling. Will not dull fine surgical blades. In order to contain fluids, a M900-12Y-YELLOW 1 Case(s) drain groove is carved all around the edge of the DissecTable. M900-12B-BLUE 1 Case(s) M900-12P-PINK 1 Case(s) On one side, you will find a large cutting area including M900-12G-GREEN 1 Case(s) dimensional scales in inches and centimeters, along with a 60 x M900-12W-WHITE 1 Case(s) 80 mm grid made of 48 x 10 mm squares. Six dimensional circles M900-12AS-ASSORTED 1 Case(s) are also printed from 1/8 to 5/8 in. and 4 to 14 mm in diameter. Flip it over and the other side offers two cutting boards half the EASYDIP Stainless Steel Holder size with the same dimensional features printed on each one of Made of Stainless Steel. Will hold up to 6 Jars. them. All corners have rubber feet giving more stability to the working surface. Catalog Number Volume M906 1 ea. Dimensions: 575 mm x 400 mm x 12.5 mm (23 x 16 x 1/2 in H) Catalog Number Volume Embedding Cassettes M620 1 ea. Disposable plastic tissue cassettes are suitable for holding and identifying tissue samples in processing, embedding, and Dissecting Board Jr. sectioning procedures. The cassettes fit securely in microtome chuck adapters. They are molded from a high density polymer A smaller DissecTable is also available with the same features that is totally resistant to the chemical action of histological and benefits as the M620. Perfect for smaller counter area. solvents. These cassettes are designed to accept standard metal lids (cat.# M481) and will keep specimens in complete safety Dimensions: 330.2 mm x 279.4 mm x 12.5 mm (13 x 11 x 1/2 in during processing. The slanted writing surface accepts markings H) easily, permitting sample identification throughout all stages of Catalog Number Volume embedding and long afterwards when in archives. They are M618 1 ea. available in 11 colors. Each case contains 3 dispenser boxes of 500 cassettes. Catalog Number Volume M480-2-WHITE 1 ea. M480-3-PINK 1 ea. M480-4-GREEN 1 ea. M480-5-YELLOW 1 ea. M480-6-BLUE 1 ea. M480-12-AQUA 1 ea. M480-7-PEACH 1 ea. M480-11-ORANGE 1 ea. M480-8-TAN 1 ea. M480-9-GRAY 1 ea. M480-10-LILAC 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
31 Immunohistochemistry
Metal Lid for M480 Cassette Slidefile Storage System 100 Positions Metal Lid for M480 Cassette. Each SlideFile Storage System includes a slide box and a Qty/Pk 25 removable tray. A tinted hinged cover makes the contents of the Catalog Number Volume box easy to see at a glance.The base is available in five different colors to help in slide classification and to minimize the possibility M481 1 ea. of sample mix-up.
Slide Master The key to the SlideFile System is a removable tray inside the (An Innovative Immunohistochemistry Humidity Chamber) storage box having a hundred individual numbered slots. All slides are stored upright for easier insertion and removal. Simply ScyTek Laboratories, Inc. proudly introduces SlideMaster. A tilt them forward and backward with one finger to easily and humidity chamber designed by a histotechnologist that rapidly pick up the slide you need. A unique feature with this eliminates the majority of individual slide handling. system is to be able to read bar codes without having to remove SlideMaster has three different parts: A humidity chamber, two the slides from the box. individual slide holders with white contrast bars, and a waste receptacle. It has been designed so that all three components For space saving purposes, you can double the amount of slides are compact and easy to use. A maximum of 20 slides can be simply by storing two slides per slot. For maximum storage used per unit. space, simply remove the tray and line up 400 slides in 3 rows for This is how it works. A hydrophobic barrier (PAP Pen, Catalog long term storage. Will resist temperatures between -80 C and #LP0001) is drawn around the tissue section and slides are put in +80 C. Not autoclavable. a special slide holder that secures them into place. Drops of antibody are placed on the slides and incubated. After Dimensions: 82 x 245 x 86 mm H (3 1/4 x 9 5/8 x 3 3/8 in. H) incubation, the individual slide holders can be tilted and secured Catalog Number Volume at a 45 degree angle. All 20 slides are rinsed off in one easy motion and the buffer (PBS-Tween 20, Catalog # ABA125 or TBS- M700-100W-WHITE 1 Case(s) Tween 20, Catalog # TBS125) drains into the waste receptacle. Slides are gently blotted (tissue paper) at the bottom portion of Stain Tray Slide Staining System the hydrophobic barrier, which draws off any remaining liquid on Made of ABS Plastic the tissue. The slide holders are then placed back in the horizontal position and incubation and rinse steps are repeated Another user friendly approach to immunohistochemistry in the same fashion. staining. This tray is also suitable not only for routine staining requiring a humid chamber but is also ideal for Hematology, For chromogen development, the SlideMaster unit has a contrast Cytology and Microbiology laboratories. Manipulation is made bar that changes the background from black to white. The black safe and easy by using only one hand. background produces high contrast so that the tissues mounted The StainTray has a black base made of tough ABS plastic glass slides can be easily seen, and the white background withstanding a wide range of chemicals (Avoid chlorinated produces high contrast and allows the technician to monitor the hydrocarbons). It will accept up to 20 slides on four plastic rails chromogen development. Slides are then rinsed and covered with a polymer strip to perfectly hold slides even if tray counterstained and are then ready for coverslipping. is held at an angle. When humidity is needed, wells between rails SlideMaster is very easy to use. It is light weight and durable. will hold up to one ml of water securely without splashing. Middle wells will hold up to 2 ml each. Rails are raised not only to By making the hydrophobic barrier around the tissue section as avoid water touching the slides but to make them more easily small as possible, the total volume of antibody reagent can be retrieveable. The base will also hold excess stain solution significantly reduced per slide. Instead of using 100-200 dripping from the slides. Four rubber feet ensure greater base microliters of antibodies per tissue section usually 50 microliters stability. Units are stackable for space saving purposes. will completely cover small tissues and 100 microliters will cover larger tissues. With this method, slide staining is much more Two covers are available: efficient, more consistent, drying-out of slides is minimized, and A clear one (M920-1) allowing for visual examination. Made of the cost of reagents is reduced. PETG with a temperature range of -20 C to +60 C. Catalog Number Volume A black lid (M920-2) for fluorescent work. Made of ABS with a temperature range of -80 C to +80 C. E00001 1 ea. Dimensions with cover: 38 W x 24 D x 4.5 H cm (15 W x 9 3/8 D x 1 3/4 H in.) Catalog Number Volume M920-1 1 Clear M920-2 1 Black
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
32 Immunohistochemistry
Vertical Slide Staining Rack Dark Gray The EasyDip Slide Staining Rack will hold up to 12 microscope slides with dimensions such as 75 x 25 mm, (3 x 1 in.) and even 76 x 26 mm and with a thickness of 1.0 and 1.2 mm. The slides fit into individual slots for free passage and rapid drainage of staining fluids. Since they are placed vertically in the rack and not horizontally, their writing area will not be stained by the fluid, allowing their removal without the use of forceps. The lid completely covers the EasyDip Slide Staining Jar to minimize spill and evaporation. A handle is permanently attached to the rack for easy insertion and removal of slides without your fingers touching the solution. Available in dark gray only. Will resist temperatures between -170 C and +121 C. Autoclavable. Dimensions: 60 x 64 x 97 mm H (2 1/4 x 2 1/2 x 3 3/4 in. H). Catalog Number Volume M905-12DGY 1 Case(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
33 Antibodies
ACTH (Adrenocorticotrophic Hormone); Clone 57 Antibodies (Concentrate) Species: Mouse Immunogen: N-terminal fragment of human ACTH conjugated Research Antibodies to KLH Clone: 57 Isotype: IgG1, kappa Species Reac vity: Human and Rat. Expected to show a broad species reactivity. Carcinoembryonic Antigen (CEA) / CD66; Clone Posi ve Control: Normal pituitary gland or pituitary tumor. C66/1030 (Concentrate) Specificity: This an body is specific to Synacthen (aa 1-24 of Species: Mouse ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Immunogen: Recombinant full-length human CEA protein Anti-ACTH is a useful marker in classification of pituitary tumors Clone: C66/1030 and in the study of pituitary disease. It reacts with ACTH- Isotype: IgG1, kappa producing cells (corticotrophs). It also may react with other Species Reactivity: Human,Others not known. tumors (e.g. some small cell carcinomas of the lung) causing Positive Control: MCF7 or 293T cells. Colon carcinoma. paraneoplastic syndromes by secreting ACTH. Specificity: This antibody recognizes proteins of 80-200kDa, Status: RUO identified as different members of CEA family. This MAb does not Catalog Number Volume react with nonspecific cross-reacting antigen (NCA) and with RA0266-C.1 0.1 ml human polymorphonuclear leucocytes. It shows no reaction with RA0266-C.5 0.5 ml a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. ACTH (Adrenocorticotrophic Hormone); Clone Status: RUO AH26 & 57 (Concentrate) Catalog Number Volume Species: Mouse RA0490-C.1 0.1 ml Immunogen: Synthe c pep de corresponding to aa 1-24 of RA0490-C.5 0.5 ml human ACTH (AH26); N-terminal fragment of human ACTH RA0490-C1 1 ml conjugated to KLH (57). Clone: AH26 & 57 Isotype: IgG1, kappa (AH26); IgG1, kappa (57). Monoclonal Concentrate Species Reac vity: Human, Mouse, and Rat. Expected to show a broad species reactivity. Posi ve Control: Normal pituitary gland or pituitary tumor. ACTH (Adrenocorticotrophic Hormone); Clone 2F6 Specificity: This an body is specific to Synacthen (aa 1-24 of (Concentrate) ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Anti-ACTH is a useful marker in classification of pituitary tumors Species: Mouse and in the study of pituitary disease. It reacts with ACTH- Immunogen: Synthe c pep de corresponding to aa 1-24 of producing cells (corticotrophs). It also may react with other human ACTH tumors (e.g. some small cell carcinomas of the lung) causing Clone: 2F6 paraneoplastic syndromes by secreting ACTH. Isotype: IgG1, kappa Status: RUO Species Reac vity: Human, Mouse, and Rat. Expected to show Catalog Number Volume a broad species reactivity. Posi ve Control: Normal pituitary gland or pituitary tumor. RA0268-C.1 0.1 ml Specificity: This an body is specific to Synacthen (aa 1-24 of RA0268-C.5 0.5 ml ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Anti-ACTH is a useful marker in classification of pituitary tumors and in the study of pituitary disease. It reacts with ACTH- producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH. Status: RUO Catalog Number Volume RA0267-C.1 0.1 ml RA0267-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
34 Antibodies
ACTH (Adrenocorticotrophic Hormone); Clone Actin, Smooth Muscle (Leiomyosarcoma Marker); AH26 (Concentrate) Clone 1A4 (Concentrate) Species: Mouse Species: Mouse Immunogen: Synthe c pep de corresponding to aa 1-24 of Immunogen: N-terminal decapep de of alpha smooth muscle human ACTH isoform of actin and conjugated to KLH. Clone: AH26 Clone: 1A4 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human, Mouse and Rat. Expected to show a Species Reac vity: Human, Baboon, Monkey, Cow, Pig, Sheep, broad species reactivity. Goat, Cat, Dog, Rabbit, Mouse, Rat, Guinea Pig and Chicken. Posi ve Control: Normal pituitary gland or pituitary tumor. Others not known. Specificity: This an body is specific to Synacthen (aa 1-24 of Posi ve Control: Blood vessels in all ssues, smooth muscle or ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). leiomyosarcoma. Anti-ACTH is a useful marker in classification of pituitary tumors Specificity: This MAb is highly specific to ac n from smooth and in the study of pituitary disease. It reacts with ACTH- muscles. Its epitope lies in the first four N-terminal amino acids. producing cells (corticotrophs). It also may react with other This MAb does not stain cardiac or skeletal muscle; however, it tumors (e.g. some small cell carcinomas of the lung) causing does stain myofibroblasts and myoepithelial cells. In most cases paraneoplastic syndromes by secreting ACTH. of rhabdomyosarcoma, this antibody yields negative results Status: RUO whereas anti-muscle specific actin and myogenin are positive. Catalog Number Volume Leiomyosarcomas are positive only with anti-muscle specific actin and anti-smooth muscle actin and are negative with anti- RA0265-C.1 0.1 ml myogenin. RA0265-C.5 0.5 ml Status: RUO Actin, Muscle Specific (Muscle Cell Marker); Clone Catalog Number Volume HHF35 (Concentrate) RA0001-C.1 0.1 ml RA0001-C.5 0.5 ml Species: Mouse Immunogen: SDS extract of human myocardium. Actin, Smooth Muscle (Leiomyosarcoma Marker); Clone: HHF35 Isotype: IgG1, kappa Clone ACTA2/791 (Concentrate) Species Reac vity: Human, Rabbit, and Rat. Others not known. Species: Mouse Posi ve Control: Muscle or sarcoma. Immunogen: Recombinant human ACTA2 protein Specificity: This an body recognizes ac n of skeletal, cardiac, Clone: ACTA2/791 and smooth muscle cells. It is not reactive with other Isotype: IgG2a, kappa mesenchymal cells except for myoepithelium. Species Reac vity: Human. Shows a broad reac vity. Status: RUO Posi ve Control: Blood vessels in all ssues, smooth muscle or Catalog Number Volume leiomyosarcoma. Specificity: This MAb is highly specific to ac n from smooth RA0405-C.1 0.1 ml muscles. This MAb does not stain cardiac or skeletal muscle; RA0405-C.5 0.5 ml however, it does stain myofibroblasts and myoepithelial cells. In most cases of rhabdomyosarcoma, this antibody yields negative Actin, Muscle Specific (Muscle Cell Marker); Clone results whereas anti-muscle specific actin and myogenin are MSA/953 (Concentrate) positive. Leiomyosarcomas are positive only with anti-muscle Species: Mouse specific actin and anti-smooth muscle actin and are negative with Immunogen: Recombinant human ac n protein. anti-myogenin. Clone: MSA/953 Status: RUO Isotype: IgG1, kappa Catalog Number Volume Species Reac vity: Human, Rabbit, and Rat. Others not known. RA0002-C.1 0.1 ml Posi ve Control: Muscle or sarcoma. RA0002-C.5 0.5 ml Specificity: This an body recognizes ac n of skeletal, cardiac, and smooth muscle cells. It is not reactive with other mesenchymal cells except for myoepithelium. Status: RUO Catalog Number Volume RA0406-C.1 0.1 ml RA0406-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
35 Antibodies
AFP (Alpha Fetoprotein) (Hepatocellular/Germ Cell AFP (Alpha Fetoprotein) (Hepatocellular/Germ Cell Tumor Marker); Clone C2 (Concentrate) Tumor Marker); Clone MBS-12 (Concentrate) Species: Mouse. Species: Mouse. Immunogen: Alpha fetoprotein (AFP) purified from serum of a Immunogen: Recombinant full-length human Alpha fetoprotein. hepatoma patient. Clone: MBS-12. Clone: C2. Isotype: IgG1, kappa. Isotype: IgG1, kappa. Species Reactivity: Reacts with human. Others not known. Species Reactivity: Reacts with human and mouse. Does not Positive Control: Hep-G2 cells. Fetal liver or hepatocellular react with cow, dog, and rat. Others not known. carcinoma. Positive Control: Hep-G2 cells. Fetal liver or hepatocellular Specificity: It recognizes an oncofetal glycoprotein with a single carcinoma. chain of 70kDa, which is identified as alpha fetoprotein (AFP). Specificity: It recognizes an oncofetal glycoprotein with a single This monoclonal antibody is highly specific to AFP and shows no chain of 70kDa, which is identified as alpha fetoprotein (AFP) cross-reaction with other oncofetal antigens or serum albumin. (ISOBM TD-2 workshop). This monoclonal antibody is highly Status: RUO specific to AFP and shows no cross-reaction with other oncofetal Catalog Number Volume antigens or serum albumin. Status: RUO RA0557-C.1 0.1 ml RA0557-C.5 0.5 ml Catalog Number Volume RA0557-C1 1 ml RA0558-C.1 0.1 ml RA0558-C.5 0.5 ml AFP (Alpha Fetoprotein) (Hepatocellular/Germ Cell RA0558-C1 1 ml Tumor Marker); Clone SPM334 (Concentrate) AFP (Alpha Fetoprotein) (Hepatocellular/Germ Cell Species: Mouse. Immunogen: Alpha fetoprotein (AFP) purified from serum of a Tumor Marker); Clone C3 (Concentrate) hepatoma patient. Species: Mouse Clone: SPM334. Immunogen: Alpha fetoprotein (AFP) purified from serum of a Isotype: IgG2a, kappa. hepatoma patient Species Reactivity: Reacts with human, monkey, dog, and pig. It Clone: C3 does not react with cow, cat, mouse, and rat. Isotype: IgG2a, kappa Positive Control: Hep-G2 cells. Fetal liver or hepatocellular Species Reac vity: Human, Monkey, Dog, and Pig. It does not carcinoma. react with Cow, Dog, Mouse, and Rat. Specificity: This monoclonal antibody recognizes an oncofetal Posi ve Control: Hep-G2 cells. Fetal liver or hepatocellular glycoprotein with a single chain of 70kDa, which is identified as carcinoma. alpha fetoprotein (AFP). This monoclonal antibody is highly Specificity: This MAb is highly specific to AFP and shows no specific to AFP and shows no cross-reaction with other oncofetal cross-reaction with other oncofetal antigens or serum albumin. antigens or serum albumin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0003-C.1 0.1 ml RA0555-C.1 0.1 ml RA0003-C.5 0.5 ml RA0555-C.5 0.5 ml RA0555-C1 1 ml AFP (Alpha Fetoprotein) (Hepatocellular/Germ Cell Tumor Marker); Clone FETA/810 (Concentrate) Alpha-1-Antichymotrypsin (SERPINA3) Species: Mouse (Histiocytoma Marker); Clone AACT/1451 & Immunogen: Recombinant human alpha fetoprotein AACT/1452 (Concentrate) Clone: FETA/810 Species: Mouse. Isotype: IgG2a, kappa Immunogen: Recombinant human Antichymotrypsin (AACT) Species Reac vity: Human. Others not known. protein fragment (aa49-187) (exact sequence is proprietary). Posi ve Control: Hep-G2 cells. Fetal liver or hepatocellular Clone: AACT/1451 & AACT/1452 carcinoma. Isotype: IgG1 & IgG1 Specificity: This MAb recognizes an oncofetal glycoprotein with Species Reactivity: Reacts with human. Others not known. a single chain of 70kDa, which is identified as alpha fetoprotein Positive Control: HeLa Cells. Tonsil, pancreas, or histiocytoma. (AFP). It is highly specific to AFP and shows no cross-reaction Specificity: It recognizes a protein of 65-76kDa, which is with other oncofetal antigens or serum albumin. identified antichymotrypsin (AACT). Acinar tumors of the Status: RUO pancreas and salivary gland may also exhibit AACT positivity. Catalog Number Volume Status: RUO RA0004-C.1 0.1 ml Catalog Number Volume RA0004-C.5 0.5 ml RA0523-C.1 0.1 ml RA0523-C.5 0.5 ml RA0523-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
36 Antibodies
Alpha-1-Antichymotrypsin (SERPINA3) AMP Deaminase, Isoform E (AMPD3) (Erythroid (Histiocytoma Marker); Clone AACT/1451 Marker); Clone AMPD3/901 (Concentrate) (Concentrate) Species: Mouse Species: Mouse. Immunogen: Recombinant human AMDP3 protein Immunogen: Recombinant human Antichymotrypsin (AACT) Clone: AMPD3/901 protein fragment (aa49-187) (exact sequence is proprietary). Isotype: IgG2b, kappa Clone: AACT/1451 Species Reac vity: Human. Others not known. Isotype: IgG1. Posi ve Control: RBC. Fetal liver; Spleen or Placenta. Species Reactivity: Reacts with human. Others not known. Specificity: This an body recognizes a protein of ~90kDa, which Positive Control: HeLa Cells. Tonsil, Pancreas or Histiocytoma. is identified as Adenosine Monophosphate Deaminase, isoform E Specificity: It recognizes a protein of 65-76kDa, which is (AMPD3). identified antichymotrypsin (AACT). Acinar tumors of the Status: RUO pancreas and salivary gland may also exhibit AACT positivity. Catalog Number Volume Status: RUO RA0423-C.5 0.5 ml Catalog Number Volume RA0521-C.1 0.1 ml Androgen Receptor (Marker of Androgen RA0521-C.5 0.5 ml Dependence); Clone AR441 & DHTR/882 RA0521-C1 1 ml (Concentrate) Species: Mouse Alpha-1-Antichymotrypsin (SERPINA3) Immunogen: A synthetic peptide, aa 299-315, (Histiocytoma Marker); Clone AACT/1452 (STEDTAEYSPFKGGYTK) of human AR (AR441); Recombinant (Concentrate) human DHTR protein (DHTR/882) Species: Mouse. Clone: AR441 & DHTR/882 Immunogen: Recombinant human Antichymotrypsin (AACT) Isotype: IgG1, kappa & IgG1, kappa protein fragment (aa49-187) (exact sequence is proprietary). Species Reactivity: Human. Does not react with mouse. Others Clone: AACT/1452 not known Isotype: IgG1 Positive Control: LNCap cells or Prostate carcinoma Species Reactivity: Reacts with human. Others not known. Specificity: Recognizes a protein of 110kDa, which is identified as Positive Control: HeLa Cells. Tonsil, pancreas, or histiocytoma. androgen receptor (AR). It reacts with full length, and the newly Specificity: It recognizes a protein of 65-76kDa, which is described A form of the receptor. It does not cross react with identified antichymotrypsin (AACT). Acinar tumors of the estrogen, progesterone, or glucocorticoid receptors. pancreas and salivary gland may also exhibit AACT positivity. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0012-C.1 0.1 ml RA0522-C.1 0.1 ml RA0012-C.5 0.5 ml RA0522-C.5 0.5 ml Androgen Receptor (Marker of Androgen RA0522-C1 1 ml Dependence); Clone AR441 (Concentrate) AMACR / p504S (Prostate Cancer Marker); Clone Species: Mouse AMACR/2748R (Concentrate) Immunogen: A synthe c pep de, aa 299-315, (STEDTAEYSPFKGGYTK) of human AR Species: Rabbit Clone: AR441 Immunogen: Recombinant human AMACR protein fragment Isotype: IgG1, kappa (around aa 297-394), exact sequence is proprietary. Species Reac vity: Human. Does not react with mouse. Others- Clone: AMACR/2748R not known. Isotype: IgG Posi ve Control: LNCap cells or Prostate carcinoma. Species Reactivity: Human. Others not known. Specificity: Recognizes a protein of 110kDa, which is iden fied Positive Control: HEK cells, Prostate Adenocarcinoma. as androgen receptor (AR). It reacts with full length, and the Specificity: This antibody recognizes a protein of 42kDa, which is newly described A form of the receptor. It does not cross react identified as AMACR, also known as p504S. with estrogen, progesterone, or glucocorticoid receptors. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0526-C.1 0.1 ml RA0010-C.1 0.1 ml RA0526-C.5 0.5 ml RA0010-C.5 0.5 ml RA0526-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
37 Antibodies
Androgen Receptor (Marker of Androgen ATRX; Clone AX1 (Concentrate) Dependence); Clone DHTR/882 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant protein fragment of human ATRX. Immunogen: Recombinant human DHTR protein Clone: AX1 Clone: DHTR/882 Isotype: IgG1/k Isotype: IgG1, kappa Species Reactivity: Human Species Reactivity: Human. Does not react with mouse. Others- Positive Control: 1p/19q co-deleted glioma. not known. Specificity: Reacts specifically with ATRX in tissue sections. Positive Control: LNCap cells or Prostate carcinoma Status: RUO Specificity: Recognizes a protein of 110kDa, which is identified as Manufactured By: Dianova GmbH androgen receptor (AR). It reacts with full length, and the newly Catalog Number Volume described A form of the receptor. It does not cross react with DIA-AX1 0.5 ml estrogen, progesterone, or glucocorticoid receptors. Status: RUO Bax (Apoptosis Marker); Clone 2D2 (Concentrate) Catalog Number Volume Species: Mouse RA0011-C.1 0.1 ml Immunogen: A synthetic peptide, aa 3-16 (Cys- RA0011-C.5 0.5 ml GSGEQPRGGGPTSS) of human bax protein. Clone: 2D2 Arginase 1 (Hepatocellular Carcinoma Marker); Isotype: IgG1 Clone ARG1/1125 (Concentrate) Species Reactivity: Human and Monkey. Does not react with Species: Mouse mouse and rat. Others not known. Immunogen: Recombinant fragment (87 amino acid residues Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Reed- around 1-150) of human ARG1 protein. Sternberg cells in Hodgkin's lymphoma. Clone: ARG1/1125 Specificity: Recognizes a protein of 21kDa, identified as the Bax Isotype: IgG2b, kappa protein. This MAb is highly specific to Bax and shows no cross- Species Reactivity: Human. Others not known. reaction with Bcl-2 or Bcl-X protein. Positive Control: 293T cells. Hepatocellular Carcinoma (HCC) Status: RUO Specificity: This antibody recognizes a protein of 35-38kDa, Catalog Number Volume which is identified as Arginase 1 (ARG1). RA0013-C.1 0.1 ml Status: RUO RA0013-C.5 0.5 ml Catalog Number Volume RA0457-C.1 0.1 ml BCL10 (MALT-Lymphoma Marker); Clone BL10/411 RA0457-C.5 0.5 ml (Concentrate) RA0457-C1 1 ml Species: Mouse Immunogen: Human BCL10 recombinant protein (epitope aa Arginase 1 (Hepatocellular Carcinoma Marker); 122-168) Clone ARG1/1126 (Concentrate) Clone: BL10/411 Isotype: IgG1, kappa Species: Mouse Species Reac vity: Human. Others not known. Immunogen: Recombinant fragment (87 amino acid residues Posi ve Control: WEHI-231 or Ramos cells or lymphoma. around 1-150) of human ARG1 protein. Specificity: This an body labels subpopula ons of normal B- Clone: ARG1/1126 cells and T-cells and is a useful tool for the sub-classification of Isotype: IgG3, kappa lymphomas. Species Reactivity: Human. Others not known. Status: RUO Positive Control: 293T cells. Hepatocellular Carcinoma (HCC). Specificity: This antibody recognizes a protein of 35-38kDa, Catalog Number Volume which is identified as Arginase 1 (ARG1). RA0347-C.1 0.1 ml Status: RUO RA0347-C.5 0.5 ml Catalog Number Volume RA0458-C.1 0.1 ml RA0458-C.5 0.5 ml RA0458-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
38 Antibodies
Bcl-2 (Apoptosis & Follicular Lymphoma Marker); Bcl-2 (Apoptosis & Follicular Lymphoma Marker); Clone 100/D5 & 124 (Concentrate) Clone BCL2/796 (Concentrate) Species: Mouse Species: Mouse Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Immunogen: Recombinant human Bcl-2 protein Cys) of human Bcl-2 (100/D5 & 124) Clone: BCL2/796 Clone: 100/D5 & 124 Isotype: IgG1, kappa Isotype: IgG1, kappa (100/D5); IgG1, kappa (124) Species Reactivity: Human. Others not known. Species Reactivity: Human. Does not react with mouse and rat. Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Others not known. follicular lymphomas. Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Specificity: This antibody recognizes a protein of 25-26kDa, follicular lymphomas. identified as the Bcl-2 alpha oncoprotein. It shows no cross- Specificity: This antibody recognizes a protein of 25-26kDa, reaction with Bcl-x or Bax protein. identified as the Bcl-2 alpha oncoprotein. It shows no cross- Status: RUO reaction with Bcl-x or Bax protein. Catalog Number Volume Status: RUO RA0019-C.1 0.1 ml Catalog Number Volume RA0019-C.5 0.5 ml RA0017-C.1 0.1 ml RA0017-C.5 0.5 ml Bcl-2 (Apoptosis and Follicular Lymphoma Marker); Clone 100/D5 (Concentrate) Bcl-2 (Apoptosis & Follicular Lymphoma Marker); Species: Mouse Clone 100/D5 & BCL2/796 Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Species: Mouse Cys) of human Bcl-2 protein. Immunogen ;A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Clone: 100/D5 Cys) of human Bcl-2 protein (100/D5); Recombinant human Bcl-2 Isotype: IgG1, kappa protein (BCL2/796). Species Reactivity: Human. Does not react with Mouse and Rat. Clone: 100/D5 & BCL2/796 Others not known. Isotype:IgG1, kappa (100/D5); IgG1, kappa (BCL2/796). Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Species Reac vity:Human. Others not known. follicular lymphomas. Posi ve Control:Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Specificity: This antibody recognizes a protein of 25-26kDa, follicular lymphomas. identified as the Bcl-2 alpha oncoprotein. It shows no cross- Specificity:This an body recognizes a protein of 25-26kDa, reaction with Bcl-x or Bax protein. identified as the Bcl-2 alpha oncoprotein. It shows no cross- Status: RUO reaction with Bcl-x or Bax protein. Catalog Number Volume Status: RUO RA0015-C.1 0.1 ml Catalog Number Volume RA0015-C.5 0.5 ml RA0020-C.1 0.1 ml RA0020-C.5 0.5 ml Bcl-2 (Apoptosis and Follicular Lymphoma Marker); Clone 124 (Concentrate) Bcl-2 (Apoptosis & Follicular Lymphoma Marker); Species: Mouse Clone BCL2/782 (Concentrate) Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Species: Mouse Cys) of human Bcl-2 protein Immunogen: Recombinant human Bcl-2 protein Clone: 124 Clone: BCL2/782 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reactivity: Human. Does not react with Mouse and Rat. Species Reactivity: Human. Others not known. Others not known. Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or follicular lymphomas. follicular lymphomas. Specificity: This antibody recognizes a protein of 25-26kDa, Specificity: This antibody recognizes a protein of 25-26kDa, identified as the Bcl-2 alpha oncoprotein. It shows no cross- identified as the Bcl-2 alpha oncoprotein. It shows no cross- reaction with Bcl-x or Bax protein. reaction with Bcl-x or Bax protein. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0018-C.1 0.1 ml RA0016-C.1 0.1 ml RA0018-C.5 0.5 ml RA0016-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
39 Antibodies
Bcl-X (Apoptosis Marker); Clone 2H12 Beta-2 Microglobulin (Renal Failure & Tumor (Concentrate) Marker); Clone B2M/1118 (Concentrate) Species: Mouse Species: Mouse Immunogen: A synthetic peptide, aa 3-14 (Cys-QSNRELVVDFLS) Immunogen: Full length recombinant human B2M protein of human Bcl-X protein Clone: B2M/1118 Clone: 2H12 Isotype: IgG2b, kappa Isotype: IgG2a Species Reac vity: Human and non-human primates. Others Species Reactivity: Human, Mouse, Rat, and Pig. Others not not known. tested. Posi ve Control: HL-60 or HeLa cells. Melanomas and Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Reed- Lymphoma. Carcinoma of Stomach, Cervix, Endometrial, Kidney Sternberg cells in Hodgkin's lymphoma. or Colon. Specificity: Recognizes a protein of 27kDa, identified as the Bcl-X Specificity: This an body is specific for the 12kDa protein protein. This MAb shows no cross-reaction with Bcl-2 or Bax known as Beta-2 Microglobulin. protein. This MAb reacts with both Bcl-XS and Bcl-XL proteins. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0424-C.5 0.5 ml RA0022-C.1 0.1 ml RA0022-C.5 0.5 ml Beta-2 Microglobulin (Renal Failure & Tumor Marker); Clone B2M/961 (Concentrate) Bcl-X (Apoptosis Marker); Clone BX006 & 2H12 Species: Mouse (Concentrate) Immunogen: Full length recombinant human B2M protein Species: Mouse Clone: B2M/961 Immunogen: A synthetic peptide, aa 3-14 (Cys-QSNRELVVDFLS) Isotype: IgG2b, kappa of human Bcl-X protein Species Reactivity: Human and non-human primates. Others not Clone: BX006 & 2H12 known. Isotype: IgG2a (BX006) & IgG2a (2H12) Positive Control: HL-60 or HeLa cells. Melanomas and Species Reactivity: Human, Mouse, Rat, and Pig. Others not Lymphoma. Carcinoma of Stomach, Cervix, Endometrial, Kidney tested. or Colon. Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Reed- Specificity: This antibody recognizes a protein of 12kDa, Sternberg cells in Hodgkin's lymphoma. identified as Beta-2 Microglobulin. Specificity: Recognizes a protein of 27kDa, identified as the Bcl-X Status: RUO protein. This MAb shows no cross-reaction with Bcl-2 or Bax Catalog Number Volume protein. This MAb reacts with both Bcl-XS and Bcl-XL proteins. Status: RUO RA0425-C.1 0.1 ml RA0425-C.5 0.5 ml Catalog Number Volume RA0023-C.1 0.1 ml Bromodeoxyuridine (BrdU) (Proliferation Marker); RA0023-C.5 0.5 ml Clone 85-2C8 (Concentrate) Bcl-X (Apoptosis Marker); Clone BX006 Species: Mouse Immunogen: Bromodeoxyuridine (BrdU) conjugated to (Concentrate) hemocyanine (isolated from Helix pomatia) Species: Mouse Clone: 85-2C8 Immunogen: A synthetic peptide, aa 3-14 (Cys-QSNRELVVDFLS) Isotype: IgG1 of human Bcl-X protein. Species Reac vity: All species Clone: BX006 Posi ve Control: Cells grown in presence of BrdU or ssues Isotype: IgG2a from experimental animals injected with BrdU. Species Reactivity: Human, Mouse, Rat, and Pig. Others not Specificity: This an body reacts with Bromodeoxyuridine tested. (BrdU) in single stranded DNA (produced by partial denaturation Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Reed- of double stranded DNA), BrdU coupled to a protein carrier, as Sternberg cells in Hodgkin's lymphoma. well as free BrdU. Specificity: Recognizes a protein of 27kDa, identified as the Bcl-X Status: RUO protein. This MAb shows no cross-reaction with Bcl-2 or Bax Catalog Number Volume protein. This MAb reacts with both Bcl-XS and Bcl-XL proteins. Status: RUO RA0378-C.1 0.1 ml RA0378-C.5 0.5 ml Catalog Number Volume RA0021-C.1 0.1 ml RA0021-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
40 Antibodies
Bromodeoxyuridine (BrdU) (Proliferation Marker); Bromodeoxyuridine (BrdU) (Proliferation Marker); Clone BRD.3 (Concentrate) Clone BU20a (Concentrate) Species: Mouse Species: Mouse Immunogen: Bromodeoxyuridine (BrdU) conjugated to BSA Immunogen: Bromodeoxyuridine (BrdU) conjugated to KLH Clone: BRD.3 Clone: BU20a Isotype: IgG1 Isotype: IgG1 Species Reac vity: All species Species Reac vity: All species Posi ve Control: Cells grown in presence of BrdU or ssues Posi ve Control: Cells grown in presence of BrdU or ssues from experimental animals injected with BrdU from experimental animals injected with BrdU Specificity: This an body reacts with Bromodeoxyuridine Specificity: This an body reacts with Bromodeoxyuridine (BrdU) in single stranded DNA (produced by partial denaturation (BrdU) in single stranded DNA (produced by partial denaturation of double stranded DNA), BrdU coupled to a protein carrier, as of double stranded DNA), BrdU coupled to a protein carrier, as well as free BrdU. well as free BrdU. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0377-C.1 0.1 ml RA0375-C.1 0.1 ml RA0377-C.5 0.5 ml RA0375-C.5 0.5 ml Bromodeoxyuridine (BrdU) (Proliferation Marker); Bromodeoxyuridine (BrdU) (Proliferation Marker); Clone BRD469 (Concentrate) Clone MoBu-1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Bromodeoxyuridine (BrdU) conjugated to KLH Immunogen: Bromodeoxyuridine (BrdU) conjugated to Clone: BRD469 hemocyanine (isolated from Helix pomatia) Isotype: IgG1 Clone: MoBu-1 Species Reac vity: All species Isotype: IgG1 Posi ve Control: Cells grown in presence of BrdU or ssues Species Reac vity: All species from experimental animals injected with BrdU Posi ve Control: Cells grown in presence of BrdU or ssues Specificity: This an body reacts with Bromodeoxyuridine from experimental animals injected with BrdU (BrdU) in single stranded DNA (produced by partial denaturation Specificity: This an body reacts with Bromodeoxyuridine of double stranded DNA), BrdU coupled to a protein carrier, as (BrdU) in single stranded DNA (produced by partial denaturation well as free BrdU. of double stranded DNA), BrdU coupled to a protein carrier, as Status: RUO well as free BrdU. Catalog Number Volume Status: RUO RA0372-C.1 0.1 ml Catalog Number Volume RA0372-C.5 0.5 ml RA0376-C.1 0.1 ml RA0376-C.5 0.5 ml Bromodeoxyuridine (BrdU) (Proliferation Marker); Clone BRD494 (Concentrate) CA19-9/Sialyl Lewisa (GI Tumor Marker); Clone Species: Mouse 121SLE (Concentrate) Immunogen: Bromodeoxyuridine (BrdU) conjugated to KLH Species: Mouse Clone: BRD494 Immunogen: Precipi n lines obtained a er immuno-diffusion Isotype: IgG1 using monoclonal antibody 116-NS-19-9 and mucins isolated Species Reac vity: All species from an ovarian cyst of a Lewis A+B- patient (0Le). Posi ve Control: Cells grown in presence of BrdU or ssues Clone: 121SLE from experimental animals injected with BrdU Isotype: IgM, kappa Specificity: This an body reacts with Bromodeoxyuridine Species Reac vity: Human. Others not known. (BrdU) in single stranded DNA (produced by partial denaturation Posi ve Control: Stomach of double stranded DNA), BrdU coupled to a protein carrier, as Specificity: CA19-9, a carbohydrate epitope expressed on a high well as free BrdU. MW (>400kDa) mucin glycoprotein, is a sialyl Lewis a structure Status: RUO which is synthesized from type 1 blood group precursor chains Catalog Number Volume and is present in individuals expressing the Lewis a and/or Lewis b blood group antigens. RA0374-C.1 0.1 ml Status: RUO RA0374-C.5 0.5 ml Catalog Number Volume RA0397-C.1 0.1 ml RA0397-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
41 Antibodies
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Calponin-1 (Smooth Muscle Marker); Clone CALP Marker); Clone CALD1/820 & h-CALD (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CALD1 protein (CALD1/820); Immunogen: Crude human uterus extract Crude human uterus extract (h-CALD) Clone: CALP Clone: CALD1/820 & h-CALD Isotype: IgG1, kappa Isotype: IgG1, kappa (CALD1/820); IgG1, kappa (h-CALD) Species Reac vity: Human and Rat. Others not known. Species Reactivity: Human. Others not known. Posi ve Control: Myoepithelial cells in breast ducts. Positive Control: Uterus Specificity: In Western blo ng, this an body reacts with only Specificity: Recognizes a protein of 150kDa, which is identified as the 34kDa form of calponin in extracts of human aortic medial the high molecular weight variant of Caldesmon. This MAb smooth muscle and is unreactive with fibroblast extracts of recognizes only the 150kDa variant (h-Caldesmon) in Western cultivated human foreskin. blots of human aortic media extracts and is unreactive with Status: RUO fibroblast extracts from cultivated human foreskin. Catalog Number Volume Status: RUO RA0099-C.1 0.1 ml Catalog Number Volume RA0099-C.5 0.5 ml RA0030-C.1 0.1 ml RA0030-C.5 0.5 ml Calponin-1 (Smooth Muscle Marker); Clone CNN1/832 & CALP (Concentrate) Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Species: Mouse Marker); Clone CALD1/820 (Concentrate) Immunogen: Recombinant human CNN1 protein (CNN1/832); Species: Mouse Crude human uterus extract (CALP) Immunogen: Recombinant human CALD1 protein Clone: CNN1/832 & CALP Clone: CALD1/820 Isotype: IgG1, kappa (CNN1/832); IgG1, kappa (CALP) Isotype: IgG1, kappa Species Reac vity: Human and Rat. Others not known. Species Reactivity: Human. Others not known. Posi ve Control: Myoepithelial cells in breast ducts. Positive Control: Uterus Specificity: In Western blo ng, this an body reacts with only Specificity: Recognizes a protein of 150kDa, which is identified as the 34kDa form of calponin in extracts of human aortic medial the high molecular weight variant of Caldesmon. This MAb smooth muscle and is unreactive with fibroblast extracts of recognizes only the 150kDa variant (h-Caldesmon) in Western cultivated human foreskin. blots of human aortic media extracts and is unreactive with Status: RUO fibroblast extracts from cultivated human foreskin. Catalog Number Volume Status: RUO RA0101-C.1 0.1 ml Catalog Number Volume RA0101-C.5 0.5 ml RA0029-C.1 0.1 ml RA0029-C.5 0.5 ml Calponin-1 (Smooth Muscle Marker); Clone CNN1/832 (Concentrate) Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Species: Mouse Marker); Clone h-CALD (Concentrate) Immunogen: Recombinant human CNN1 protein Species: Mouse Clone: CNN1/832 Immunogen: Crude human uterus extract Isotype: IgG1, kappa Clone: h-CALD Species Reac vity: Human and Rat. Others not known. Isotype: IgG1, kappa Posi ve Control: Myoepithelial cells in breast ducts. Species Reactivity: Human. Others not known. Specificity: In Western blo ng, this an body reacts with only Positive Control: Uterus the 34kDa form of calponin in extracts of human aortic medial Specificity: Recognizes a protein of 150kDa, which is identified as smooth muscle and is unreactive with fibroblast extracts of the high molecular weight variant of Caldesmon. This MAb cultivated human foreskin. recognizes only the 150kDa variant (h-caldesmon) in Western Status: RUO blots of human aortic media extracts and is unreactive with Catalog Number Volume fibroblast extracts from cultivated human foreskin. Status: RUO RA0100-C.1 0.1 ml RA0100-C.5 0.5 ml Catalog Number Volume RA0028-C.1 0.1 ml RA0028-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
42 Antibodies
Calponin-1 (Smooth Muscle Marker); Clone Carcinoembryonic Antigen (CEA) / CD66 ; Clone SPM169 (Concentrate) SPM541 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Crude human uterus extract. Immunogen: Human colon carcinoma extract Clone: SPM169 Clone: SPM541 Isotype: IgG1, kappa. Isotype: IgG1, kappa Species Reactivity: Reacts with human and rat. Others not Species Reactivity: Human and Monkey. Others not known. known. Positive Control: MCF7 or 293T cells. Colon carcinoma. Positive Control: Myoepithelial cells in breast ducts. Specificity: This antibody recognizes proteins of 80-200kDa, Specificity: In Western blotting, this monoclonal antibody reacts identified as different members of CEA family. This MAb does not with only the 34kDa form of calponin in extracts of human aortic react with nonspecific cross-reacting antigen (NCA) and with medial smooth muscle and is unreactive with fibroblast extracts human polymorphonuclear leucocytes. It shows no reaction with of cultivated human foreskin. a variety of normal tissues and is suitable for staining of Status: RUO formalin/paraffin tissues. Catalog Number Volume Status: RUO RA0532-C.1 0.1 ml Catalog Number Volume RA0532-C.5 0.5 ml RA0488-C.1 0.1 ml RA0532-C1 1 ml RA0488-C.5 0.5 ml RA0488-C1 1 ml Calreticulin Mutation / CALR; Clone CAL2 (Concentrate) Carcinoembryonic Antigen (CEA) / CD66; Clone Species: Mouse C66/1009 (Concentrate) Immunogen: C-neoterminus of mutated CALR. Species: Mouse Clone: CAL2 Immunogen: Human recombinant CEA protein Isotype: IgG2a Clone: C66/1009 Species Reactivity: Human Isotype: IgG1, kappa Positive Control: Megakaryocytes from CALR mutated PMNs. Species Reactivity: Human. Others not known. Specificity: Human CALR protein expressed by all types of Exon 9 Positive Control: MCF7 or 293T cells. Colon carcinoma. CALR mutations (deletion/insertion in 19p 13.3-13.2 of). Specificity: This antibody recognizes proteins of 80-200kDa, Status: RUO identified as different members of the CEA family. This antibody Catalog Number Volume does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction DIA-CAL-100 0.1 ml with a variety of normal tissues and is suitable for staining of DIA-CAL-250 0.25 ml formalin/paraffin tissues. Status: RUO Carcinoembryonic Antigen (CEA) / CD66 ; Clone SPM506 (Concentrate) Catalog Number Volume RA0432-C.1 0.1 ml Species: Mouse RA0432-C.5 0.5 ml Immunogen: Human colon carcinoma extract Clone: SPM506 RA0432-C1 1 ml Isotype: IgG1, kappa Carcinoembryonic Antigen (CEA) / CD66; Clone Species Reactivity: Human and Monkey. Others not known. Positive Control: MCF7 or 293T cells. Colon carcinoma. C66/1260 (Concentrate) Specificity: This antibody recognizes proteins of 80-200kDa, Species: Mouse identified as different members of the CEA family. This MAb does Immunogen: Purified human CEA protein not react with nonspecific cross-reacting antigen (NCA) and with Clone: C66/1260 human polymorphonuclear leucocytes. It shows no reaction with Isotype: IgG2b, kappa a variety of normal tissues and is suitable for staining of Species Reactivity: Human. Others not known. formalin/paraffin tissues. Positive Control: MCF7 or 293T cells. Colon carcinoma. Status: RUO Specificity: This antibody recognizes proteins of 80-200kDa, Catalog Number Volume identified as different members of CEA family. This MAb reacts with nonspecific cross-reacting antigen (NCA). It shows no RA0489-C.1 0.1 ml reaction with a variety of normal tissues and is suitable for RA0489-C.5 0.5 ml staining of formalin/paraffin tissues. RA0489-C1 1 ml Status: RUO Catalog Number Volume RA0481-C.1 0.1 ml RA0481-C.5 0.5 ml RA0481-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
43 Antibodies
Carcinoembryonic Antigen (CEA) / CD66; Clone Carcinoembryonic Antigen (CEA) / CD66; Clone C66/195 (Concentrate) COL-1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant full-length human CEA protein Immunogen: Human colon carcinoma extract Clone: C66/195 Clone: COL-1 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reactivity: Human and Monkey. Others not known. Species Reac vity: Human. Others not known. Positive Control: MCF7 or 293T cells. Colon carcinoma. Posi ve Control: MCF7 or 293T cells. Colon carcinoma. Specificity: This antibody recognizes proteins of 80-200kDa, Specificity: This an body recognizes proteins of 80-200kDa, identified as different members of CEA family. This MAb reacts identified as different members of the CEA family. This antibody with nonspecific cross-reacting antigen (NCA) and shows a cross- does not react with nonspecific cross-reacting antigen (NCA) and reaction with human polymorphonuclear leucocytes. It shows no with human polymorphonuclear leucocytes. It shows no reaction reaction with a variety of normal tissues and is suitable for with a variety of normal tissues and is suitable for staining of staining of formalin/paraffin tissues. formalin/paraffin tissues. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0485-C.1 0.1 ml RA0082-C.1 0.1 ml RA0485-C.5 0.5 ml RA0082-C.5 0.5 ml RA0485-C1 1 ml Carcinoembryonic Antigen (CEA) / CD66; Clone Carcinoembryonic Antigen (CEA) / CD66; Clone COL-1, CEA31 & C66/261 (Concentrate) C66/261 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human colon carcinoma extract (COL-1 & CEA31); Immunogen: Human recombinant CEA protein CEA recombinant protein (C66/261) Clone: C66/261 Clone: COL-1, CEA31 & C66/261 Isotype: IgG1, kappa Isotype: IgG2a (COL-1); IgG1 (CEA31 & C66/261) Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: MCF7 or 293T cells. Colon carcinoma. Posi ve Control: MCF7 or 293T cells. Colon carcinoma. Specificity: This an body recognizes proteins of 80-200kDa, Specificity: This monoclonal an body recognizes proteins of 80- identified as different members of the CEA family. This antibody 200kDa, identified as different members of the CEA family. It does not react with nonspecific cross-reacting antigen (NCA) and does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. formalin/paraffin tissues. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0083-C.1 0.1 ml RA0085-C.1 0.1 ml RA0083-C.5 0.5 ml RA0085-C.5 0.5 ml Carcinoembryonic Antigen (CEA) / CD66; Clone Carcinoembryonic Antigen (CEA) / CD66; Clone CEA31 (Concentrate) SPM330 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human colon carcinoma extract Immunogen: Purified human CEA protein Clone: CEA31 Clone: SPM330 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human and Monkey. Others not known. Species Reactivity: Human and Monkey. Others not known. Posi ve Control: MCF7 or 293T cells. Colon carcinoma. Positive Control: MCF7 or 293T cells. Colon carcinoma Specificity: This an body recognizes proteins of 80-200kDa, Specificity: This antibody recognizes proteins of 80-200kDa, identified as different members of the CEA family. This antibody identified as different members of CEA family, and is re- does not react with nonspecific cross-reacting antigen (NCA) and expressed in increased amounts in intestinal carcinomas and with human polymorphonuclear leucocytes. It shows no reaction several other tumors. This MAb reacts with nonspecific cross- with a variety of normal tissues and is suitable for staining of reacting antigen (NCA) and shows a cross-reaction with human formalin/paraffin tissues. polymorphonuclear leucocytes. It shows no reaction with a Status: RUO variety of normal tissues and is suitable for staining of formalin/paraffin tissues. Catalog Number Volume Status: RUO RA0084-C.1 0.1 ml Catalog Number Volume RA0084-C.5 0.5 ml RA0486-C.1 0.1 ml RA0486-C.5 0.5 ml RA0486-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
44 Antibodies
Carcinoembryonic Antigen (CEA) / CD66; Clone Catenin, beta (p120); Clone 15B8 (Concentrate) SPM551 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Recombinant chicken beta-catenin. Immunogen: Human recombinant CEA protein Clone: 15B8 Clone: SPM551 Isotype: IgG1, kappa. Isotype: IgG1, kappa Species Reactivity: Reacts with human, mouse, rat, cow, dog, Species Reactivity: Human. Others not known. and chicken. Others not known. Positive Control: MCF7 or 293T cells. Colon Carcinoma. Positive Control: HeLa or MCF-7 cells. Breast carcinoma. Specificity: This antibody recognizes proteins of 80-200kDa, Specificity: Recognizes a 92kDa protein known as beta-Catenin. identified as different members of CEA family. This MAb does not Status: RUO react with nonspecific cross-reacting antigen (NCA) and with Catalog Number Volume human polymorphonuclear leucocytes. It shows no reaction with RA0544-C.1 0.1 ml a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. RA0544-C.5 0.5 ml Status: RUO RA0544-C1 1 ml Catalog Number Volume Catenin, beta (p120); Clone 5H10 (Concentrate) RA0487-C.1 0.1 ml Species: Mouse. RA0487-C.5 0.5 ml Immunogen: Fusion protein consisting of the maltose binding RA0487-C1 1 ml protein fused to a 100 amino acid segment of the C-terminus of chicken beta-Catenin. Carcinoembryonic Antigen (CEA) / CD66; Clone Clone: 5H10 SPM584 (Concentrate) Isotype: IgG1, kappa. Species: Mouse Species Reactivity: Reacts with human, mouse, and chicken. Immunogen: Human colon carcinoma extract Others not known. Clone: SPM584 Positive Control: HeLa or MCF-7 cells. Breast carcinoma. Isotype: IgG2a, kappa Specificity: Recognizes a 92kDa protein which is identified as Species Reactivity: Human. Others not known. beta-Catenin. Positive Control: MCF7 or 293T cells. Colon carcinoma Status: RUO Specificity: This antibody recognizes proteins of 80-200kDa, Catalog Number Volume identified as different members of CEA family. This MAb does not RA0545-C.1 0.1 ml react with nonspecific cross-reacting antigen (NCA) and with RA0545-C.5 0.5 ml human polymorphonuclear leucocytes. It shows no reaction with RA0545-C1 1 ml a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. Catenin, beta (p120); Clone 6F9 (Concentrate) Status: RUO Species: Mouse. Catalog Number Volume Immunogen: Recombinant chicken beta-catenin. RA0484-C.1 0.1 ml Clone: 6F9 RA0484-C.5 0.5 ml Isotype: IgG1, kappa. RA0484-C1 1 ml Species Reactivity: Reacts with human, cow, dog, and chicken. Others not known. Carcinoembryonic Antigen, pan (CEA) / CD66; Positive Control: HeLa or MCF-7 cells. Breast carcinoma. Clone Cocktail (Concentrate) Specificity: This monoclonal antibody recognizes a protein of 92kDa, which is identified as beta-catenin. It shows no cross- Species: Mouse reaction with gamma-catenin (also known as plakoglobin). Immunogen: Recombinant full-length human CEA protein Status: RUO (C66/195; C66/261; C66/1009 & C66/1030) Clone: C66/195 & C66/1009 & C66/1030 Catalog Number Volume Isotype: IgGs RA0546-C.1 0.1 ml Species Reactivity: Human. Others not known. RA0546-C.5 0.5 ml Positive Control: MCF7 or 293T cells. Colon carcinoma. RA0546-C1 1 ml Specificity: This antibody recognizes proteins of 80-200kDa, identified as different members of CEA family. This antibody does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. Status: RUO Catalog Number Volume RA0491-C.1 0.1 ml RA0491-C.5 0.5 ml RA0491-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
45 Antibodies
Catenin, beta (p120); Clone CTNNB1/1507 CD10 (Membrane Metalloendopeptidase); Clone (Concentrate) 56C6 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Recombinant human full-length beta-Catenin Immunogen: Recombinant human CD10 protein fragment. (p120) protein fragment. Clone: 56C6 Clone: CTNNB1/1507. Isotype: IgG1, kappa Isotype: IgG1, kappa. Species Reactivity: Human, Rat. Others not tested. Species Reactivity: Reacts with human, mouse, and rat. Others Positive Control: Kidney, small intestine, or tonsil. not known. Specificity: Recognizes a 100kDa glycoprotein, identified as Positive Control: HeLa or MCF-7 cells. Breast carcinoma. CD10, also known as Common Acute Lymphatic Leukemia Specificity: Recognizes a 92kDa protein known as beta-Catenin. Antigen (CALLA). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0548-C.1 0.1 ml RA0461-C.1 0.1 ml RA0548-C.5 0.5 ml RA0461-C.5 0.5 ml RA0548-C1 1 ml RA0461-C1 1 ml Catenin, beta (p120); Clone CTNNB1/1508 CD100 (Semaphorin-4D); Clone 133-1C6 (Concentrate) (Concentrate) Species: Mouse. Species: Mouse Immunogen: Recombinant human full-length beta-Catenin Immunogen: PHA stimulated human peripheral blood (p120) protein fragment. lymphocytes. Clone: CTNNB1/1508. Clone: 133-1C6 Isotype: IgG1, kappa. Isotype: IgM, kappa Species Reactivity: Reacts with human, mouse, and rat. Others Species Reactivity: Human and Baboon. Does not react with not known. horse. Others not-tested. Positive Control: HeLa or MCF-7 cells. Breast carcinoma. Positive Control: Daudi, Raji, HUT-78, Kg1a, U937, and human Specificity: Recognizes a protein of 92kDa known as beta- lymphocytes. Human tonsil and lymph node. Catenin. Specificity: Recognizes a homodimeric protein comprised of Status: RUO 50kDa subunits, identified as CD100 (Workshop VI; Code N-L026). Catalog Number Volume Status:RUO RA0549-C.1 0.1 ml Catalog Number Volume RA0549-C.5 0.5 ml RA0492-C.1 0.1 ml RA0549-C1 1 ml RA0492-C.5 0.5 ml RA0492-C1 1 ml Catenin, beta (p120); Clone CTNNB1/1509 (Concentrate) CD100 (Semaphorin-4D); Clone A8 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Recombinant human full-length beta-Catenin Immunogen: PHA stimulated human peripheral blood (p120) protein fragment. lymphocytes Clone: CTNNB1/1509. Clone: A8 Isotype: IgG1, kappa. Isotype: IgG1, kappa Species Reactivity: Reacts with human, mouse, and rat. Others Species Reactivity: Human, Monkey and Mouse. Others not- not known. tested. Positive Control: HeLa or MCF-7 cells. Breast carcinoma. Positive Control: Daudi, Raji, HUT-78, Kg1a, U937, and human Specificity: Recognizes a protein of 92kDa known as beta- lymphocytes. Human tonsils and lymph nodes. Catenin. Specificity: Recognizes a homodimeric protein comprised of Status: RUO 50kDa subunits, identified as CD100. Status: RUO Catalog Number Volume Catalog Number Volume RA0550-C.1 0.1 ml RA0550-C.5 0.5 ml RA0493-C.1 0.1 ml RA0550-C1 1 ml RA0493-C.5 0.5 ml RA0493-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
46 Antibodies
CD106 / VCAM1 (Activated Endothelial Cell CD147 / EMMPRIN / Basigin (BSG); Clone BSG/963 Marker); Clone 1.4C3 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: S mulated human umbilical vein endothelial cells Immunogen: Recombinant human Basigin (BSG) or CD147 protein (HUVEC) Clone: BSG/963 Clone: 1.4C3 Isotype: IgG1 Isotype: IgG1, kappa Species Reactivity: Human. Others not known. Species Reac vity: Human. Others not known. Positive Control: HSB2 cells. Renal Cell, Colon or Testicular Posi ve Control: Human placenta or tonsil. carcinoma. Specificity: Recognizes a protein of 110kDa, iden fied as CD106 Specificity: This antibody recognizes an extracellular epitope of (also known as vascular cell adhesion molecule-1 (VCAM-1) and human CD147. INCAM-100). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0428-C.1 0.1 ml RA0335-C.1 0.1 ml RA0428-C.5 0.5 ml RA0335-C.5 0.5 ml RA0428-C1 1 ml CD106 / VCAM1 (Activated Endothelial Cell CD15 / FUT4 (Reed-Sternberg Cell Marker); Clone Marker); Clone VCAM1/843 (Concentrate) FUT4/815 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human VCAM1 protein Immunogen: Recombinant human FUT4 protein Clone: VCAM1/843 Clone: FUT4/815 Isotype: IgG1, kappa Isotype: IgM, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Human placenta or tonsil. Posi ve Control: U937 cells, Reed-Sternberg's cells in Hodgkin's Specificity: Recognizes a protein of 110kDa, iden fied as CD106 lymphoma. (also known as vascular cell adhesion molecule-1 (VCAM-1) and Specificity: This an body reacts with a 220 kDa protein, CD15 / INCAM-100). FUT4 expressed on Reed-Sternberg cells. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0336-C.1 0.1 ml RA0120-C.1 0.1 ml RA0336-C.5 0.5 ml RA0120-C.5 0.5 ml CD117/c-Kit (Marker for Gastrointestinal Stromal CD15 / FUT4 (Reed-Sternberg Cell Marker); Clone Tumors); Clone C117/370 (Concentrate) Leu-M1 (MMA) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CD117 protein Immunogen: U937 his ocy c cell line Clone: C117/370 Clone: Leu-M1 (MMA) Isotype: IgG1, kappa Isotype: IgM, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Gastrointes nal Stromal Tumor (GIST) or Posi ve Control: U937 cells, Reed-Sternberg's cells in Hodgkin's testicular germ cell tumor. Melanocytes in the basal layer of the lymphoma. epidermis and mast cells in the dermis of normal skin. Specificity: This an body reacts with a 220 kDa protein, CD15 / Specificity: This an body recognizes a protein of 145kDa, FUT4 expressed on Reed-Sternberg cells. identified as CD117/p145kit. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0119-C.1 0.1 ml RA0168-C.1 0.1 ml RA0119-C.5 0.5 ml RA0168-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
47 Antibodies
CD1a / HTA1 (Mature Langerhans Cells Marker); CD20 / MS4A1 (B-Cell Marker); Clone IGEL/773 Clone C1A/711 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CD1a protein Immunogen: Recombinant human MS4A1 protein Clone: C1A/711 Clone: IGEL/773 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: MOLT-4 cells. Paracortex in a tonsil or a Posi ve Control: Daudi, Raji, and U266, and human reactive lymph node. lymphocytes, lymph nodes and tonsils. Specificity: An -CD1a labels Langerhans cell his ocytosis Specificity: Recognizes a protein of 30-33kDa, which is (Histiocytosis X), extranodal histiocytic sarcoma, a subset of T- identified as CD20. lymphoblastic lymphoma/leukemia, and interdigitating dendritic Status: RUO cell sarcoma of the lymph node. Catalog Number Volume Status: RUO RA0046-C.1 0.1 ml Catalog Number Volume RA0046-C.5 0.5 ml RA0032-C.1 0.1 ml RA0032-C.5 0.5 ml CD20 / MS4A1 (B-Cell Marker); Clone L26 & IGEL/773 (Concentrate) CD1a / HTA1 (Mature Langerhans Cells Marker); Species: Mouse Clone O10 & C1A/711 (Concentrate) Immunogen: Human tonsil B-cells (L26); Recombinant human Species: Mouse MS4A1 protein (IGEL/773) Immunogen: Human thymus cells (O10); Recombinant human Clone: L26 & IGEL/773 CD1a protein (C1A/711) Isotype: IgG2a, kappa (L26); IgG2a, kappa (IGEL/773) Clone: O10 & C1A/711 Species Reactivity: Human. Others not known. Isotype: IgG1, kappa (O10) & IgG1, kappa (C1A/711) Positive Control: Daudi, Raji, and U266, and human Species Reac vity: Human. Others not known. lymphocytes, lymph nodes and tonsils. Posi ve Control: MOLT-4 cells. Paracortex in a tonsil or a Specificity: Recognizes a protein of 30-33kDa, which is identified reactive lymph node. as CD20. Its epitope is located in the cytoplasmic domain of CD20 Specificity: An -CD1a labels Langerhans cell his ocytosis and was, therefore, ascribed as CD20cy in the 5th Workshop. (Histiocytosis X), extranodal histiocytic sarcoma, a subset of T- Status: RUO lymphoblastic lymphoma/leukemia, and interdigitating dendritic Catalog Number Volume cell sarcoma of the lymph node. Status: RUO RA0047-C.1 0.1 ml RA0047-C.5 0.5 ml Catalog Number Volume RA0033-C.1 0.1 ml CD20 / MS4A1 (B-Cell Marker); Clone L26 RA0033-C.5 0.5 ml (Concentrate) CD1a / HTA1 (Mature Langerhans Cells Marker); Species: Mouse Immunogen: Human tonsil B-cells Clone O10 (Concentrate) Clone: L26 Species: Mouse Isotype: IgG2a, kappa Immunogen: Human thymus cells Species Reac vity: Human, Baboon, and Monkey. Does not Clone: O10 react with Cow, Cog, Pig, and Rat. Others not known. Isotype: IgG1, kappa Posi ve Control: Daudi, Raji, and U266, and human Species Reac vity: Human. Others not known. lymphocytes, lymph nodes and tonsils. Posi ve Control: MOLT-4 cells. Paracortex in a tonsil or a Specificity: Recognizes a protein of 30-33kDa, which is reactive lymph node. identified as CD20. Its epitope is located in the cytoplasmic Specificity: An -CD1a labels Langerhans cell his ocytosis domain of CD20 and was, therefore, ascribed as CD20cy in the (Histiocytosis X), extranodal histiocytic sarcoma, a subset of T- 5th Workshop. lymphoblastic lymphoma/leukemia, and interdigitating dendritic Status: RUO cell sarcoma of the lymph node. Catalog Number Volume Status: RUO RA0045-C.1 0.1 ml Catalog Number Volume RA0045-C.5 0.5 ml RA0031-C.1 0.1 ml RA0031-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
48 Antibodies
CD26 (DPP IV / ADA-Binding Protein); Clone 134- CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell 2C2 (Concentrate) Marker); Clone Ber-H2 & CD30/412 (Concentrate) Species: Mouse. Species: Mouse Immunogen: A synthetic peptide from the amino terminal Immunogen: Cancer cell line established from a pa ent with region of CD26. Hodgkin's disease of T-cell lineage (Ber-H2); human CD30 Clone: 134-2C2. recombinant protein (CD30/412) Isotype: IgM, kappa. Clone: Ber-H2 & CD30/412 Species Reactivity: Reacts with human. Others not known. Isotype: IgG1, kappa (Ber-H2); IgG1, kappa (CD30/412) Positive Control: U-87 MG (Human glioblastoma astrocytoma), Species Reac vity: Human. Others not known. Ramos (Human Burkitt's lymphoma, HEP-G2 cells, and Posi ve Control: Hodgkin's lymphoma lymphocytes. Lymph nodes and tonsils. Specificity: Recognizes a single chain glycoprotein of Specificity: Recognizes a glycoprotein of 110kDa, identified as 105/120kDa, identified as CD30/Ki-1. This MAb distinguishes CD26. large cell lymphomas derived from activated lymphoid cells from Status: RUO histiocytic malignancies and lymphomas derived from resting and Catalog Number Volume precursor lymphoid cells or from anaplastic carcinomas. Status: RUO RA0561-C.1 0.1 ml RA0561-C.5 0.5 ml Catalog Number Volume RA0561-C1 1 ml RA0051-C.1 0.1 ml RA0051-C.5 0.5 ml CD26 (DPP IV / ADA-Binding Protein); Clone 202.36 (Concentrate) CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Species: Mouse. Marker); Clone Ber-H2 (Concentrate) Immunogen: Human T-cell clone. Species: Mouse Clone: 202.36. Immunogen: Cancer cell line established from a patient with Isotype: IgG2b, kappa. Hodgkin's disease of T-cell lineage Species Reactivity: Reacts with human and rat. Does not react Clone: Ber-H2 with pig and sheep. Others not known. Isotype: IgG1, kappa Positive Control: YT, HEP-G2 cells, and lymphocytes. Lymph Species Reactivity: Human. Others not known. nodes and tonsils. Positive Control: Hodgkin's lymphoma Specificity: Recognizes a glycoprotein of 110kDa, identified as Specificity: Recognizes a single chain glycoprotein of CD26 (Workshop VI; Code: N-L039). It is an atypical serine 105/120kDa, identified as CD30/Ki-1. This Mab distinguishes protease belonging to the prolyl oligopeptidase family. In large cell lymphomas derived from activated lymphoid cells from Western blotting, this monoclonal antibody reacts with only histiocytic malignancies and lymphomas derived from resting and glycosylated CD26, but not with the deglycosylated form. It does precursor lymphoid cells or from anaplastic carcinomas. not prevent ADA binding to CD26. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0049-C.1 0.1 ml RA0559-C.1 0.1 ml RA0049-C.5 0.5 ml RA0559-C.5 0.5 ml RA0559-C1 1 ml CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker); Clone CD30/412 (Concentrate) CD26 (DPP IV / ADA-Binding Protein); Clone Species: Mouse DPP4/910 (Concentrate) Immunogen: Human CD30 recombinant protein Species: Mouse. Clone: CD30/412 Immunogen: Recombinant human DPP4 protein. Isotype: IgG1, kappa Clone: DPP4/910. Species Reac vity: Human. Others not known. Isotype: IgG2b, kappa. Posi ve Control: Hodgkin's lymphoma Species Reactivity: Reacts with human and rat. Does not react Specificity: Recognizes a single chain glycoprotein of with pig and sheep. Others not known. 105/120kDa, identified as CD30/Ki-1. This MAb distinguishes Positive Control: U-87 MG (Human glioblastoma astrocytoma), large cell lymphomas derived from activated lymphoid cells from Ramos (Human Burkitt's lymphoma, HEP-G2 cells, and histiocytic malignancies and lymphomas derived from resting and lymphocytes. Lymph nodes and tonsils. precursor lymphoid cells or from anaplastic carcinomas. Specificity: Recognizes a glycoprotein of 110kDa, identified as Status: RUO CD26. Catalog Number Volume Status: RUO RA0048-C.1 0.1 ml Catalog Number Volume RA0048-C.5 0.5 ml RA0560-C.1 0.1 ml RA0560-C.5 0.5 ml RA0560-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
49 Antibodies
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell CD31 / PECAM-1 (Endothelial Cell Marker); Clone Marker); Clone Ki-1/779 (Concentrate) 1A10 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human TNFRSF8 protein Immunogen: Prokaryo c recombinant fusion protein Clone: Ki-1/779 corresponding to a portion of the extracellular domain Isotype: IgG1, kappa downstream of the signal sequence of the CD31 (PECAM-1). Species Reactivity: Human. Others not known. Clone: 1A10 Positive Control: Hodgkin's lymphoma Isotype: IgG1, kappa Specificity: Recognizes a single chain glycoprotein of Species Reac vity: Human. Others not known. 105/120kDa, identified as CD30/Ki-1. This MAb distinguishes Posi ve Control: Tonsil, Angiosarcoma. large cell lymphomas derived from activated lymphoid cells from Specificity: An -CD31 has shown to be highly specific and histiocytic malignancies and lymphomas derived from resting and sensitive for vascular endothelial cells. Staining of nonvascular precursor lymphoid cells or from anaplastic carcinomas. tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 Status: RUO reacts with normal, benign, and malignant endothelial cells Catalog Number Volume which make up blood vessel lining. Status: RUO RA0050-C.1 0.1 ml RA0050-C.5 0.5 ml Catalog Number Volume RA0260-C.1 0.1 ml CD31 (Anti-Mouse); Clone SZ31 (Concentrate) RA0260-C.5 0.5 ml Species: Rat Immunogen: Murine amino acid fragment. CD31 / PECAM-1 (Endothelial Cell Marker); Clone Clone: SZ31 C31.3 & JC/70A (Concentrate) Isotype: IgG2a Species: Mouse Species Reactivity: Mouse, Pig. Does not react with Rat or Immunogen: Human recombinant CD31 protein (C31.3); Human. Membrane preparation of a spleen from a patient with hairy cell Positive Control: Adult or embryonic mouse endothelial cells. leukemia (JC/70A). Specificity: Murine CD31 (PECAM-1). Clone: C31.3 & JC/70A Status: RUO Isotype: IgG1, kappa (C31.3); IgG1, kappa (JC/70A) Manufactured By: Dianova GmbH Species Reac vity: Human, Cynomolgus Monkey, and Rabbit. Catalog Number Volume Others not known. Posi ve Control: Tonsil, Angiosarcoma. DIA-310 0.5 ml Specificity: An -CD31 has shown to be highly specific and CD31 / PECAM-1 (Endothelial Cell Marker); Clone sensitive for vascular endothelial cells. Staining of nonvascular tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 158-2B3 (Concentrate) reacts with normal, benign, and malignant endothelial cells Species: Mouse which make up blood vessel lining. Immunogen: S mulated human leukocytes (Workshop VI) Status: RUO Clone: 158-2B3 Catalog Number Volume Isotype: IgG1, kappa Species Reac vity: Human. Others not known. RA0258-C.1 0.1 ml Posi ve Control: Tonsil, Angiosarcoma. RA0258-C.5 0.5 ml Specificity: An -CD31 has shown to be highly specific and sensitive for vascular endothelial cells. Staining of nonvascular CD31 / PECAM-1 (Endothelial Cell Marker); Clone tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 C31.3 (Concentrate) reacts with normal, benign, and malignant endothelial cells Species: Mouse which make up blood vessel lining. Immunogen: Human recombinant CD31 protein Status: RUO Clone: C31.3 Catalog Number Volume Isotype: IgG1, kappa Species Reac vity: Human. Others not known. RA0262-C.1 0.1 ml Posi ve Control: Jurkat, CCRF-CEM or K-562 Cells. Tonsil, RA0262-C.5 0.5 ml Angiosarcoma. Specificity: An -CD31 has shown to be highly specific and sensitive for vascular endothelial cells. Staining of nonvascular tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 reacts with normal, benign, and malignant endothelial cells which make up blood vessel lining. Status: RUO Catalog Number Volume RA0257-C.1 0.1 ml RA0257-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
50 Antibodies
CD31 / PECAM-1 (Endothelial Cell Marker); Clone CD34 (Hematopoietic Stem Cell & Endothelial C31.7 (Concentrate) Marker); Clone HPCA1/763 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human recombinant CD31 protein Immunogen: Recombinant human HPCA1 protein Clone: C31.7 Clone: HPCA1/763 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Cynomolgus Monkey, and Rabbit. Species Reac vity: Human. Others not known. Others not known. Posi ve Control: KG-1 cells, Tonsil, or Angiosarcoma. Posi ve Control: Jurkat, CCRF-CEM or K-562 Cells. Tonsil, Specificity: This MAb recognizes a single chain, Angiosarcoma. transmembrane, heavily glycosylated protein of 90-120kDa, Specificity: An -CD31 has shown to be highly specific and which is identified as CD34. Anti-CD34 labels > 85% of sensitive for vascular endothelial cells. Staining of nonvascular angiosarcoma and Kaposi's sarcoma, but with a lower specificity. tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 Status: RUO reacts with normal, benign, and malignant endothelial cells Catalog Number Volume which make up blood vessel lining. Status: RUO RA0053-C.1 0.1 ml RA0053-C.5 0.5 ml Catalog Number Volume RA0256-C.1 0.1 ml CD34 (Hematopoietic Stem Cell & Endothelial RA0256-C.5 0.5 ml Marker); Clone QBEnd/10 & HPCA1/763 CD31 / PECAM-1 (Endothelial Cell Marker); Clone (Concentrate) JC/70A (Concentrate) Species: Mouse Immunogen: Detergent solubilized vesicular suspension Species: Mouse prepared from human term placenta (QBEnd/10); Recombinant Immunogen: Membrane prepara on of a spleen from a pa ent human HPCA1 protein (HPCA1/763) with hairy cell leukemia. Clone: QBEnd/10 & HPCA1/763 Clone: JC/70A Isotype: IgG1, kappa (QBEnd/10); IgG1, kappa (HPCA1/763) Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Cynomolgus Monkey, and Rabbit. Posi ve Control: KG-1 cells, Tonsil, or Angiosarcoma. Others not known. Specificity: This monoclonal an body recognizes a single chain, Posi ve Control: Tonsil, Angiosarcoma. transmembrane, heavily glycosylated protein of 90-120kDa, Specificity: An -CD31 has shown to be highly specific and which is identified as CD34. Anti-CD34 labels > 85% of sensitive for vascular endothelial cells. Staining of nonvascular angiosarcoma and Kaposi's sarcoma, but with a lower specificity. tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 Status: RUO reacts with normal, benign, and malignant endothelial cells which make up blood vessel lining. Catalog Number Volume Status: RUO RA0054-C.1 0.1 ml Catalog Number Volume RA0054-C.5 0.5 ml RA0259-C.1 0.1 ml CD34 (Hematopoietic Stem Cell & Endothelial RA0259-C.5 0.5 ml Marker); Clone QBEnd/10 (Concentrate) CD31 / PECAM-1 (Endothelial Cell Marker); Clone Species: Mouse PECA1/848 (Concentrate) Immunogen: Detergent solubilized vesicular suspension prepared from human term placenta Species: Mouse Clone: QBEnd/10 Immunogen: Recombinant human PECAM1 protein Isotype: IgG1, kappa Clone: PECA1/848 Species Reac vity: Human, Cynomolgus Monkey, Rhesus Isotype: IgG1, kappa Monkey. Does not react with rat, sheep, cow and dog. Others not Species Reac vity: Human. Others not known. known. Posi ve Control: Tonsil, Angiosarcoma. Posi ve Control: KG-1 cells, Tonsil, or Angiosarcoma Specificity: An -CD31 has shown to be highly specific and Specificity: This MAb recognizes a single chain, sensitive for vascular endothelial cells. Staining of nonvascular transmembrane, heavily glycosylated protein of 90-120kDa, tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 which is identified as CD34. On the basis of differential sensitivity reacts with normal, benign, and malignant endothelial cells to degradation by specific enzymes, epitopes of monoclonal which make up blood vessel lining. antibodies to CD34 are classified into three main categories, class Status: RUO I, class II and class III. It is a class II antibody whose epitope is Catalog Number Volume resistant to neuraminidase but sensitive to glycoprotease and chymopapain. Anti-CD34 labels > 85% of angiosarcoma and RA0261-C.1 0.1 ml Kaposi's sarcoma, but with a lower specificity. RA0261-C.5 0.5 ml Status: RUO Catalog Number Volume RA0052-C.1 0.1 ml RA0052-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
51 Antibodies
CD35 / CR1 (Follicular Dendritic Cell Marker); CD43 (T-Cell Marker); Clone DF-T1 (Concentrate) Clone CR1/802 (Concentrate) Species: Mouse Species: Mouse Immunogen: Myeloblas c KG1 cells Immunogen: Recombinant human CR1 protein Clone: DF-T1 Clone: CR1/802 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Baboon, and Monkey. Others not Posi ve Control: Paracortex in a tonsil or a reac ve lymph node. known. Specificity: This an body recognizes a cell surface glycoprotein Posi ve Control: Follicular dendri c cells (FDC) in tonsil. of 95/115/135kDa (depending upon the extent of glycosylation), Specificity: Recognizes a protein of 210-220kDa, which is identified as CD43 [Workshop IV]. identified as the complement receptor 1 (CR1)/CD35. This Status: RUO antibody is specific for a site in CR1 that is distal from the C3b- Catalog Number Volume binding site, so that it is unable to block CR1 activity. It is highly RA0297-C.1 0.1 ml specific to CR1 and shows no cross-reaction with CR2. This antibody labels follicular dendritic cells and follicular dendritic RA0297-C.5 0.5 ml cell sarcoma. CD43 (T-Cell Marker); Clone SPN/839 (Concentrate) Status: RUO Species: Mouse Catalog Number Volume Immunogen: Recombinant human SPN protein RA0103-C.1 0.1 ml Clone: SPN/839 RA0103-C.5 0.5 ml Isotype: IgG1, kappa Species Reac vity: Human. Others not known. CD35 / CR1 (Follicular Dendritic Cell Marker); Posi ve Control: Paracortex in a tonsil or a reac ve lymph node. Clone E11 (Concentrate) Specificity: This an body recognizes a cell surface glycoprotein Species: Mouse of 95/115/135kDa (depending upon the extent of glycosylation), Immunogen: Intact human monocytes identified as CD43 [Workshop IV]. Clone: E11 Status: RUO Isotype: IgG1, kappa Catalog Number Volume
Species Reac vity: Human, Baboon, Cynomolgus Monkey, RA0298-C.1 0.1 ml Rhesus Monkey. Others not known. RA0298-C.5 0.5 ml Posi ve Control: Follicular dendri c cells (FDC) in tonsil. Specificity: Recognizes a protein of 210-220kDa, which is CD44 / HCAM Std.; Clone 156-3C11 (Concentrate) identified as the complement receptor 1 (CR1)/CD35. This antibody is specific for a site in CR1 that is distal from the C3b- Species: Mouse binding site, so that it is unable to block CR1 activity. It is highly Immunogen: S mulated human leukocytes specific to CR1 and shows no cross-reaction with CR2. This Clone: 156-3C11 antibody labels follicular dendritic cells and follicular dendritic Isotype: IgG2a, kappa cell sarcoma. Species Reac vity: Human, Baboon, and Green Monkey. Others Status: RUO not tested. Posi ve Control: HeLa cells or paracortex in tonsil or lymph Catalog Number Volume node. RA0102-C.1 0.1 ml Specificity: Recognizes a cell surface glycoprotein of 80-95kDa RA0102-C.5 0.5 ml (CD44) on lymphocytes, monocytes, and granulocytes (Leukocyte Typing Workshop V). Its epitope is resistant to digestion by CD43 (T-Cell Marker); Clone 84-3C1 (Concentrate) trypsin and chymotrypsin. Species: Mouse Status: RUO Immunogen: S mulated human leukocytes Catalog Number Volume
Clone: 84-3C1 RA0055-C.1 0.1 ml Isotype: IgG1, kappa RA0055-C.5 0.5 ml Species Reac vity: Human. Others not known. RA0055-C1 1 ml Posi ve Control: Paracortex in a tonsil or a reac ve lymph node. Specificity: This an body recognizes a cell surface glycoprotein of 95/115/135kDa (depending upon the extent of glycosylation), identified as CD43 [Workshop IV]. Status: RUO Catalog Number Volume RA0299-C.1 0.1 ml RA0299-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
52 Antibodies
CD44 / HCAM Std.; Clone HCAM/918 (Concentrate) CD45 / LCA (Leukocyte Marker); Clone 2B11 & Species: Mouse PD7/26 (Concentrate) Immunogen: Recombinant human HCAM protein Species: Mouse Clone: HCAM/918 Immunogen: Isolated neoplas c cells from T-cell lymphoma Isotype: IgG2a, kappa (2B11); human peripheral blood lymphocytes maintained in T- Species Reac vity: Human and non-human Primates. Others cell growth factor (PD7/26). not tested. Clone: 2B11 & PD7/26 Posi ve Control: HeLa cells or paracortex in tonsil or lymph Isotype: IgG1, kappa (2B11); IgG1, kappa (PD7/26). node. Species Reac vity: Human. Others not known. Specificity: Recognizes a cell surface glycoprotein of 80-95kDa Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. (CD44) on lymphocytes, monocytes, and granulocytes (Leukocyte Specificity: This an body recognizes the CD45 leukocyte Typing Workshop V). Its epitope is resistant to digestion by common antigen (LCA) family. trypsin and chymotrypsin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0280-C.1 0.1 ml RA0056-C.1 0.1 ml RA0280-C.5 0.5 ml RA0056-C.5 0.5 ml CD45 / LCA (Leukocyte Marker); Clone 2B11 CD45 / LCA (Leukocyte Marker); Clone 135-4C5 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Isolated neoplas c cells from T-cell lymphoma Immunogen: S mulated human leukocytes Clone: 2B11 Clone: 135-4C5 Isotype: IgG1, kappa Isotype: IgG2b, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. Specificity: CD45R, also designated as CD45 and PTPRC, has Specificity: CD45R, also designated as CD45 and PTPRC, has been identified as a transmembrane glycoprotein broadly been identified as a transmembrane glycoprotein broadly expressed among hematopoietic cells. This antibody to CD45 is expressed among hematopoietic cells. This antibody to CD45 is useful in differential diagnosis of lymphoid tumors from non- useful in differential diagnosis of lymphoid tumors from non- hematopoietic undifferentiated neoplasms. hematopoietic undifferentiated neoplasms. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0277-C.1 0.1 ml RA0283-C.1 0.1 ml RA0277-C.5 0.5 ml RA0283-C.5 0.5 ml CD45RA (Leukocyte Marker); Clone 111-1C5 CD45 / LCA (Leukocyte Marker); Clone 136-4B5 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: S mulated human leukocytes Immunogen: S mulated human leukocytes Clone: 111-1C5 Clone: 136-4B5 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Daudi, Raji, IM9 and human lymphocytes. Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. Human lymph nodes and tonsils. Specificity: CD45R, also designated as CD45 and PTPRC, has Specificity: This an body recognizes a protein of 205kDa- been identified as a transmembrane glycoprotein broadly 220kDa, identified as CD45RA. This antibody reacts with ABC and expressed among hematopoietic cells. This antibody to CD45 is BC isoforms. CD45RA is expressed on 40-50% of peripheral CD4+ useful in differential diagnosis of lymphoid tumors from non- T-cells, 50% of peripheral CD8+ T-cells, B-cells, and leukemic B- hematopoietic undifferentiated neoplasms. cell lines. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0284-C.1 0.1 ml RA0282-C.1 0.1 ml RA0284-C.5 0.5 ml RA0282-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
53 Antibodies
CD45RA (Leukocyte Marker); Clone 158-4D3 CD45RO (T-Cell Marker); Clone UCHL-1 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: S mulated human leukocytes Immunogen: Cultured human T-cells from an IL-2-dependent T- Clone: 158-4D3 cell line (CA1) Isotype: IgG2a, kappa Clone: UCHL-1 Species Reac vity: Human. Others not known. Isotype: IgG2a, kappa Posi ve Control: Daudi, Raji, IM9 and human lymphocytes. Species Reac vity: Human, Chimpanzee, Common Marmoset. Human lymph nodes and tonsils. Others not known. Specificity: This an body recognizes a protein of 205kDa- Posi ve Control: CCRF-CEM, Jurkat or MOLT-4 cells. Paracortex 220kDa, identified as CD45RA. This antibody reacts with ABC and in a tonsil or a reactive lymph node. BC isoforms. CD45RA is expressed on 40-50% of peripheral CD4+ Specificity: This an body recognizes a 180-185kDa protein, T-cells, 50% of peripheral CD8+ T-cells, B-cells, and leukemic B- identified as an isoform of leukocyte common antigen (CD45RO) cell lines. (4th Leucocyte Typing Workshop: Code No. N31). The epitope Status: RUO recognized by this antibody is sensitive to neuraminidase Catalog Number Volume digestion. This antibody reacts with mature activated T-cells, most thymocytes, and a sub-population of resting T-cells within RA0275-C.1 0.1 ml both CD4 and CD8 subsets. It shows no reactivity with normal B- RA0275-C.5 0.5 ml cells or natural killer cells, but reacts with granulocytes and monocytes. CD45RB (Leukocyte Marker); Clone PD7/26 Status: RUO (Concentrate) Catalog Number Volume Species: Mouse RA0274-C.1 0.1 ml Immunogen: Human peripheral blood lymphocytes maintained RA0274-C.5 0.5 ml in T-cell growth factor Clone: PD7/26 CD5 (Mantle Cell Lymphoma Marker); Clone Isotype: IgG1, kappa Species Reac vity: Human. Others not known. C5/473 & CD5/54/F6 (Concentrate) Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. Species: Mouse Specificity: CD45R, also designated as CD45 and PTPRC, has Immunogen: Human CD5 recombinant protein (C5/473); A been identified as a transmembrane glycoprotein broadly synthetic peptide from the intracellular region of human CD5 expressed among hematopoietic cells. This antibody to CD45 is (CD5/54/F6) useful in differential diagnosis of lymphoid tumors from non- Clone: C5/473 & CD5/54/F6 hematopoietic undifferentiated neoplasms. Isotype: IgG1, kappa (C5/473) & IgG1, kappa (CD5/54/F6) Status: RUO Species Reac vity: Human. Others not known. Catalog Number Volume Posi ve Control: 293T, Ramos, or MOLT-4 Cells. Tonsil. Specificity: Recognizes a 67kDa transmembrane protein, which RA0279-C.1 0.1 ml is identified as CD5. Anti-CD5 does not react with granulocytes or RA0279-C.5 0.5 ml monocytes. Status: RUO CD45RO (T-Cell Marker); Clone T200/797 (Concentrate) Catalog Number Volume RA0037-C.1 0.1 ml Species: Mouse RA0037-C.5 0.5 ml Immunogen: Recombinant human CD45RO protein Clone: T200/797 CD5 (Mantle Cell Lymphoma Marker); Clone Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. C5/473 (Concentrate) Posi ve Control: CCRF-CEM, Jurkat or MOLT-4 cells. Paracortex Species: Mouse in a tonsil or a reactive lymph node. Immunogen: Human CD5 recombinant protein Specificity: This an body recognizes a 180-185kDa protein, Clone: C5/473 identified as an isoform of leukocyte common antigen (CD45RO). Isotype: IgG1, kappa This antibody reacts with mature activated T-cells, most Species Reac vity: Human. Others not known. thymocytes, and a sub-population of resting T-cells within both Posi ve Control: 293T, Ramos, or MOLT-4 Cells. Tonsil. CD4 and CD8 subsets. It shows no reactivity with normal B-cells Specificity: Recognizes a 67kDa transmembrane protein, which or natural killer cells, but reacts with granulocytes and is identified as CD5. Anti-CD5 does not react with granulocytes or monocytes. monocytes. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0281-C.1 0.1 ml RA0034-C.1 0.1 ml RA0281-C.5 0.5 ml RA0034-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
54 Antibodies
CD5 (Mantle Cell Lymphoma Marker); Clone CD56 / NCAM1 / NKH1 (Neuronal Cell Marker); CD5/54/F6 (Concentrate) Clone 123C3.D5 & 123A8 (Concentrate) Species: Mouse Species: Mouse Immunogen: A synthe c pep de from the intracellular region Immunogen: Membrane prepara on of a small cell lung of human CD5 carcinoma (123C3.D5 & 123A8) Clone: CD5/54/F6 Clone: 123C3.D5 & 123A8 Isotype: IgG1, kappa Isotype: IgG1, kappa (123C3.D5); IgG1, kappa (123A8) Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: 293T, Ramos, or MOLT-4 Cells. Tonsil. Posi ve Control: Cerebellum, Pancreas, Neuroblastoma. Specificity: Recognizes a 67kDa transmembrane protein, which Specificity: This an body reacts with an extracellular domain of is identified as CD5. Anti-CD5 does not react with granulocytes or CD56/NCAM. Anti-CD56 recognizes two proteins of the neural monocytes. cell adhesion molecule, the basic molecule expressed on most Status: RUO neuroectodermally derived tissues and neoplasms (e.g. Catalog Number Volume retinoblastoma, medulloblastomas, astrocytomas, neuroblastomas, and small cell carcinomas). It is also expressed RA0036-C.1 0.1 ml on some mesodermally derived tumors (rhabdomyosarcoma). RA0036-C.5 0.5 ml Anti-CD56 plays an important role in the diagnosis of nodal and nasal NK/T-cell lymphomas. CD50 / ICAM3; Clone ICAM3/1019 (Concentrate) Status: RUO Species: Mouse Catalog Number Volume Immunogen: Recombinant human ICAM3 protein Clone: ICAM3/1019 RA0239-C.1 0.1 ml Isotype: IgG2b, kappa RA0239-C.5 0.5 ml Species Reactivity: Human. Others not known. Positive Control: HL-60 or THP-1 cells. Lymph node and tonsil. CD56 / NCAM1 / NKH1 (Neuronal Cell Marker); Specificity: This antibody recognizes an N-glycosylated Clone 123C3.D5 (Concentrate) glycoprotein of 120kDa with intra-chain disulfide bonds, Species: Mouse identified as CD50 or ICAM-3. Immunogen: Membrane prepara on of a small cell lung Status: RUO carcinoma Catalog Number Volume Clone: 123C3.D5 Isotype: IgG1, kappa RA0440-C.1 0.1 ml Species Reac vity: Human, Rat, and Zebrafish. Others not RA0440-C.5 0.5 ml known. RA0440-C1 1 ml Posi ve Control: Cerebellum, Pancreas, Neuroblastoma. Specificity: This an body reacts with an extracellular domain of CD56 / NCAM1 / NKH1 (Neuronal Cell Marker); CD56/NCAM. Anti-CD56 recognizes two proteins of the neural Clone 123A8 (56C04) (Concentrate) cell adhesion molecule, the basic molecule expressed on most Species: Mouse neuroectodermally derived tissues and neoplasms (e.g. Immunogen: Membrane prepara on of a small cell lung retinoblastoma, medulloblastomas, astrocytomas, carcinoma neuroblastomas, and small cell carcinomas). It is also expressed Clone: 123A8 (same clone as 56C04) on some mesodermally derived tumors (rhabdomyosarcoma). Isotype: IgG1, kappa Anti-CD56 plays an important role in the diagnosis of nodal and Species Reac vity: Human. Others not known. nasal NK/T-cell lymphomas. Posi ve Control: Cerebellum, Pancreas, Neuroblastoma. Status: RUO Specificity: This an body reacts with an extracellular domain of Catalog Number Volume CD56/NCAM. Anti-CD56 recognizes two proteins of the neural RA0237-C.1 0.1 ml cell adhesion molecule, the basic molecule expressed on most neuroectodermally derived tissues and neoplasms (e.g. RA0237-C.5 0.5 ml retinoblastoma, medulloblastomas, astrocytomas, neuroblastomas, and small cell carcinomas). It is also expressed on some mesodermally derived tumors (rhabdomyosarcoma). Anti-CD56 plays an important role in the diagnosis of nodal and nasal NK/T-cell lymphomas. Status: RUO Catalog Number Volume RA0238-C.1 0.1 ml RA0238-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
55 Antibodies
CD56 / NCAM1 / NKH1 (Neuronal Cell Marker); CD57 / B3GAT1 (Natural Killer Cell Marker); Clone Clone NKH1/784 (Concentrate) HNK-1 or Leu-7 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human NCAM1 protein Immunogen: Human peripheral blood mononuclear cells Clone: NKH1/784 Clone: HNK-1 or Leu-7 Isotype: IgG1, kappa Isotype: IgM, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Does not react with Rat. Others not Posi ve Control: Cerebellum, Pancreas, Neuroblastoma. known. Specificity: This an body reacts with an extracellular domain of Posi ve Control: CCRF-CEM Cells. Lymph node or tonsil. CD56/NCAM. Anti-CD56 recognizes two proteins of the neural Specificity: An -CD57 marks a subset of lymphocytes known as cell adhesion molecule, the basic molecule expressed on most natural killer (NK) cells. Anti-CD57 also stains neuroendocrine neuroectodermally derived tissues and neoplasms (e.g. cells and their derived tumors, including carcinoid tumors and retinoblastoma, medulloblastomas, astrocytomas, medulloblastoma. neuroblastomas, and small cell carcinomas). It is also expressed Status: RUO on some mesodermally derived tumors (rhabdomyosarcoma). Catalog Number Volume Anti-CD56 plays an important role in the diagnosis of nodal and nasal NK/T-cell lymphomas. RA0355-C.1 0.1 ml Status: RUO RA0355-C.5 0.5 ml Catalog Number Volume CD57 / B3GAT1 (Natural Killer Cell Marker); Clone RA0240-C.1 0.1 ml NK/804 (Concentrate) RA0240-C.5 0.5 ml Species: Mouse CD56 / NCAM1 / NKH1 (Neuronal Cell Marker); Immunogen: Recombinant human B3GAT1 protein Clone: NK/804 Clone NKH1/795 (Concentrate) Isotype: IgM, kappa Species: Mouse Species Reac vity: Human. Does not react with Rat. Others not Immunogen: Recombinant human NCAM1 protein known. Clone: NKH1/795 Posi ve Control: Lymph node or tonsil. Isotype: IgG1, kappa Specificity: An -CD57 marks a subset of lymphocytes known as Species Reac vity: Human, Rat and Zebrafish. Others not natural killer (NK) cells. Anti-CD57 also stains neuroendocrine known. cells and their derived tumors, including carcinoid tumors and Posi ve Control: Cerebellum, Pancreas, Neuroblastoma. medulloblastoma. Specificity: This an body reacts with an extracellular domain of Status: RUO CD56/NCAM. Anti-CD56 recognizes two proteins of the neural Catalog Number Volume cell adhesion molecule, the basic molecule expressed on most neuroectodermally derived tissues and neoplasms (e.g. RA0358-C.1 0.1 ml retinoblastoma, medulloblastomas, astrocytomas, RA0358-C.5 0.5 ml neuroblastomas, and small cell carcinomas). It is also expressed on some mesodermally derived tumors (rhabdomyosarcoma). CD57 / B3GAT1 (Natural Killer Cell Marker); Clone Anti-CD56 plays an important role in the diagnosis of nodal and NK-1 (Concentrate) nasal NK/T-cell lymphomas. Species: Mouse Status: RUO Immunogen: Human peripheral blood mononuclear cells Catalog Number Volume Clone: NK-1 Isotype: IgM, kappa RA0241-C.1 0.1 ml Species Reac vity: Human. Does not react with Rat. Others not RA0241-C.5 0.5 ml known. CD57 / B3GAT1 (Natural Killer Cell Marker); Clone Posi ve Control: Lymph node or tonsil. Specificity: An -CD57 marks a subset of lymphocytes known as HNK-1 & NK-1 (Concentrate) natural killer (NK) cells. Anti-CD57 also stains neuroendocrine Species: Mouse cells and their derived tumors, including carcinoid tumors and Immunogen: Human peripheral blood mononuclear cells (HNK- medulloblastoma. 1 & NK-1) Status: RUO Clone: HNK-1 & NK-1 Catalog Number Volume Isotype: IgM, kappa (HNK-1 & NK-1) Species Reac vity: Human. Does not react with Rat. Others not RA0356-C.1 0.1 ml known. RA0356-C.5 0.5 ml Posi ve Control: Lymph node or tonsil. Specificity: An -CD57 marks a subset of lymphocytes known as natural killer (NK) cells. Anti-CD57 also stains neuroendocrine cells and their derived tumors, including carcinoid tumors and medulloblastoma. Status: RUO Catalog Number Volume RA0357-C.1 0.1 ml RA0357-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
56 Antibodies
CD6; Clone 3F7B5 (Concentrate) CD63 (Late Endosomes Marker); Clone LAMP3/803 Species: Mouse (Concentrate) Immunogen: Human rheumatoid synovial T-cell line ST-1 Species: Mouse Clone: 3F7B5 Immunogen: Recombinant human CD63 protein Isotype: IgG1 Clone: LAMP3/803 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: CCRF-CEM, Jurkat cells, Tonsil. Species Reac vity: Human and Mouse. Others not known. Specificity: Cell membrane posi vity as expressed by Posi ve Control: SK-MEL-28, HL60, THP-1 or NIH/3T3 cells. thymocytes, mature/activated T-cells, a subset of B-cells known Melanoma or lymphoma. as B-1 cells, and by some cells in the brain. Specificity: CD63 is expressed on ac vated platelets, monocytes Status: RUO and macrophages, and is weakly expressed on granulocytes, T- Catalog Number Volume cells and B-cells. It is located on the basophilic granule membranes and on the plasma membranes of lymphocytes and RA0038-C.1 0.1 ml granulocytes. RA0038-C.5 0.5 ml Status: RUO CD6; Clone C6/372 & 3F7B5 (Concentrate) Catalog Number Volume Species: Mouse RA0059-C.1 0.1 ml Immunogen: Human recombinant CD6 protein (C6/372); RA0059-C.5 0.5 ml Human rheumatoid synovial T-cell line ST-1 (3F7B5) Clone: C6/372 & 3F7B5 CD63 (Late Endosomes Marker); Clone MX- Isotype: IgG1 (C6/372); IgG1 (3F7B5) 49.129.5 (Concentrate) Species Reac vity: Human. Others not known. Species: Mouse Posi ve Control: CCRF-CEM, Jurkat cells, tonsil. Immunogen: Full length CD63 of human origin Specificity: Cell membrane posi vity as expressed by Clone: MX-49.129.5 thymocytes, mature/activated T-cells, a subset of B-cells known Isotype: IgG1, kappa as B-1 cells, and by some cells in the brain. Species Reac vity: Human and Mouse. Others not known. Status: RUO Posi ve Control: SK-MEL-28, HL60, THP-1 or NIH/3T3 cells. Catalog Number Volume Melanoma or lymphoma.
RA0040-C.1 0.1 ml Specificity: CD63 is expressed on ac vated platelets, monocytes and macrophages, and is weakly expressed on granulocytes, T- RA0040-C.5 0.5 ml cells and B-cells. It is located on the basophilic granule CD6; Clone C6/372 (Concentrate) membranes and on the plasma membranes of lymphocytes and granulocytes. Species: Mouse Status: RUO Immunogen: Human recombinant CD6 protein Catalog Number Volume Clone: C6/372 Isotype: IgG1 RA0058-C.1 0.1 ml Species Reac vity: Human. Others not known. RA0058-C.5 0.5 ml Posi ve Control: CCRF-CEM, Jurkat cells, Tonsil. Specificity: Cell membrane posi vity as expressed by CD63 (Late Endosomes Marker); Clone NKI/C3 thymocytes, mature/activated T-cells, a subset of B-cells known (Concentrate) as B-1 cells, and by some cells in the brain. Species: Mouse Status: RUO Immunogen: Smooth plasma membrane frac on of MeWo cells Catalog Number Volume Clone: NKI/C3 RA0039-C.1 0.1 ml Isotype: IgG1, kappa RA0039-C.5 0.5 ml Species Reac vity: Human and Mouse. Others not known. Posi ve Control: SK-MEL-28, HL60, THP-1 or NIH/3T3 cells. Melanoma or lymphoma. Specificity: CD63 is expressed on ac vated platelets, monocytes and macrophages, and is weakly expressed on granulocytes, T- cells and B-cells. It is located on the basophilic granule membranes and on the plasma membranes of lymphocytes and granulocytes. Status: RUO Catalog Number Volume RA0057-C.1 0.1 ml RA0057-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
57 Antibodies
CD68 (Macrophage Marker); Clone C68/684 CD68 (Macrophage Marker); Clone KP1 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Subcellular frac on of human alveolar Immunogen: Subcellular frac on of human alveolar macrophages macrophages Clone: C68/684 Clone: KP1 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Monkey, Mouse, Rat, and Cat. Posi ve Control: Tonsil, Lymph Node or Spleen Others not known. Cellular Localiza on: Cytoplasmic Posi ve Control: Tonsil, Lymph Node or Spleen. Specificity: This an body recognizes a glycoprotein of 110kDa, Specificity: This an body recognizes a glycoprotein of 110kDa, which is identified as CD68. which is identified as CD68. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0060-C.1 0.1 ml RA0061-C.1 0.1 ml RA0060-C.5 0.5 ml RA0061-C.5 0.5 ml CD68 (Macrophage Marker); Clone LAMP4/824 CD68 (Macrophage Marker); Clone CD68/G2 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human LAMP4 protein Immunogen: Recombinant human CD68 protein Clone: LAMP4/824 Clone: CD68/G2 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Tonsil, Lymph Node or Spleen. Posi ve Control: Tonsil, Lymph Node or Spleen Specificity: This an body recognizes a glycoprotein of 110kDa, Specificity: This an body recognizes a glycoprotein of 110kDa, which is identified as CD68. which is identified as CD68. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0063-C.1 0.1 ml RA0064-C.1 0.1 ml RA0063-C.5 0.5 ml RA0064-C.5 0.5 ml CD74 (B-Cell Marker); Clone CLIP/813 CD68 (Macrophage Marker); Clone KP1 & C68/684 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CD74 protein Immunogen: Subcellular frac on of human alveolar Clone: CLIP/813 macrophages (KP1); Subcellular fraction of human alveolar Isotype: IgG1, kappa macrophages (C68/684) Species Reac vity: Human. Others not known. Clone: KP1 & C68/684 Posi ve Control: Daudi or Raji Cells. Tonsil or Lymph Node. Isotype: IgG1, kappa (KP1); IgG1, kappa (C68/684) Specificity: This monoclonal an body recognizes a protein of Species Reac vity: Human, Monkey, Mouse, Rat and Cat. ~35kDa, identified as CD74. Others not known. Status: RUO
Posi ve Control: Tonsil, Lymph Node or Spleen. Catalog Number Volume Specificity: This an body recognizes a glycoprotein of 110kDa, which is identified as CD68. RA0066-C.1 0.1 ml Status: RUO RA0066-C.5 0.5 ml Catalog Number Volume CD74 (B-Cell Marker); Clone LN-2 (Concentrate) RA0062-C.1 0.1 ml Species: Mouse RA0062-C.5 0.5 ml Immunogen: SU-DHL-4 lymphoma cells Clone: LN-2 Isotype: IgG1, kappa Species Reac vity: Human, Baboon and Mouse. Does not react with Rat. Others not known. Posi ve Control: Daudi or Raji Cells. Tonsil or Lymph Node. Specificity: This monoclonal an body recognizes a protein of ~35kDa, identified as CD74 (Workshop IV). Status: RUO Catalog Number Volume RA0065-C.1 0.1 ml RA0065-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
58 Antibodies
CD79a (B-Cell Marker); Clone HM47/A9 CD79a (B-Cell Marker); Clone IGA/764 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: A synthe c pep de corresponding to aa 202-216 Immunogen: Recombinant human IGA protein (GTYQDVGSLNIADVQ) of human CD79a protein. Clone: IGA/764 Clone: HM47/A9 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Monkey, Pig, Cow, Mouse and Rat. Posi ve Control: Daudi or Ramos cells. Germinal center B-cells Others not known. in a lymph node or tonsil. Posi ve Control: Daudi or Ramos cells. Germinal center B-cells Specificity: An -CD79a is generally used to complement an - in a lymph node or tonsil. CD20 especially for mature B-cell lymphomas after treatment Specificity: An -CD79a is generally used to complement an - with Rituximab (anti-CD20). This antibody will stain many of the CD20 especially for mature B-cell lymphomas after treatment same lymphomas as anti-CD20, but also is more likely to stain B- with Rituximab (anti-CD20). This antibody will stain many of the lymphoblastic lymphoma/leukemia than is anti-CD20. Anti- same lymphomas as anti-CD20, but also is more likely to stain B- CD79a also stains more cases of plasma cell myeloma and lymphoblastic lymphoma/leukemia than is anti-CD20. Anti- occasionally some types of endothelial cells as well. CD79a also stains more cases of plasma cell myeloma and Status: RUO occasionally some types of endothelial cells as well. Catalog Number Volume Status: RUO RA0072-C.1 0.1 ml Catalog Number Volume RA0072-C.5 0.5 ml RA0069-C.1 0.1 ml RA0069-C.5 0.5 ml CD79a (B-Cell Marker); Clone JCB117 & HM47/A9 (Concentrate) CD79a (B-Cell Marker); Clone IGA/515 Species: Mouse (Concentrate) Immunogen: A synthe c pep de corresponding to aa 202-216 Species: Mouse (GTYQDVGSLNIADVQ) of human CD79a protein (JCB117 and Immunogen: Recombinant human IGA protein HM47/A9). Clone: IGA/515 Clone: JCB117 & HM47/A9 Isotype: IgG1, kappa Isotype: IgG1, kappa (JCB117); IgG1, kappa (HM47/A9) Species Reac vity: Human. Others not known. Species Reac vity: Human, Monkey, Pig, Cow, Mouse and Rat. Posi ve Control: Daudi or Ramos cells. Germinal center B-cells Others not known. in a lymph node or tonsil. Posi ve Control: Daudi or Ramos cells. Germinal center B-cells Specificity: An -CD79a is generally used to complement an - in a lymph node or tonsil. CD20 especially for mature B-cell lymphomas after treatment Specificity: An -CD79a is generally used to complement an - with Rituximab (anti-CD20). This antibody will stain many of the CD20 especially for mature B-cell lymphomas after treatment same lymphomas as anti-CD20, but also is more likely to stain B- with Rituximab (anti-CD20). This antibody will stain many of the lymphoblastic lymphoma/leukemia than is anti-CD20. Anti- same lymphomas as anti-CD20, but also is more likely to stain B- CD79a also stains more cases of plasma cell myeloma and lymphoblastic lymphoma/leukemia than is anti-CD20. Anti- occasionally some types of endothelial cells as well. CD79a also stains more cases of plasma cell myeloma and Status: RUO occasionally some types of endothelial cells as well. Catalog Number Volume Status: RUO RA0073-C.1 0.1 ml Catalog Number Volume RA0073-C.5 0.5 ml RA0071-C.1 0.1 ml RA0071-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
59 Antibodies
CD79a (B-Cell Marker); Clone JCB117 (Concentrate) CD8A (Cytotoxic & Suppressor T-Cell Marker); Species: Mouse Clone C8/468 (Concentrate) Immunogen: A synthe c pep de corresponding to aa 202-216 Species: Mouse (GTYQDVGSLNIADVQ) of human CD79a protein. Immunogen: Human CD8 recombinant protein Clone: JCB117 Clone: C8/468 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reactivity: Human. Others not known. Posi ve Control: Daudi or Ramos cells. Germinal center B-cells Positive Control: HuT78 or hPBL. Tonsil. in a lymph node or tonsil. Specificity: CD8 is a 68kDa transmembrane glycoprotein Specificity: An -CD79a is generally used to complement an - expressed as a heterodimer by a majority of thymocytes, and by CD20 especially for mature B-cell lymphomas after treatment major histocompatibility complex (MHC) class I restricted, with Rituximab (anti-CD20). This antibody will stain many of the mature, suppressor/cytotoxic T-cells. same lymphomas as anti-CD20, but also is more likely to stain B- Status: RUO lymphoblastic lymphoma/leukemia than is anti-CD20. Anti- Catalog Number Volume CD79a also stains more cases of plasma cell myeloma and occasionally some types of endothelial cells as well. RA0041-C.1 0.1 ml Status: RUO RA0041-C.5 0.5 ml Catalog Number Volume CD99 / MIC2 (Ewing's Sarcoma Marker); Clone RA0067-C.1 0.1 ml 12E7 & MIC2/877 (Concentrate) RA0067-C.5 0.5 ml Species: Mouse CD8A (Cytotoxic & Suppressor T-Cell Marker); Immunogen: Human acute lymphocy c leukemia T-cells Clone C8/144B (Concentrate) (12E7); Recombinant human MIC2 protein (MIC2/877) Clone: 12E7 & MIC2/877 Species: Mouse Isotype: IgG1, kappa (12E7); IgG1, kappa (MIC2/877) Immunogen: A 13 amino acid peptide from C-terminal Species Reac vity: Human. Others not tested. cytoplasmic domain of alpha chain of human CD8 molecule. Posi ve Control: MOLT-4 cells. Pancreas or Ewing's sarcoma. Clone: C8/144B Specificity: Recognizes a sialoglycoprotein of 27-32kDa, Isotype: IgG1, kappa identified as CD99, MIC2 gene product, or E2 antigen. Species Reactivity: Human. Others not known. Status: RUO Positive Control: HuT78 or hPBL. Tonsil. Catalog Number Volume Specificity: CD8 is a 68 kDa transmembrane glycoprotein expressed as a heterodimer by a majority of thymocytes, and by RA0206-C.1 0.1 ml major histocompatibility complex (MHC) class I restricted, RA0206-C.5 0.5 ml mature, suppressor/cytotoxic T-cells. Status: RUO CD99 / MIC2 (Ewing's Sarcoma Marker); Clone Catalog Number Volume 12E7 (Concentrate) RA0042-C.1 0.1 ml Species: Mouse
RA0042-C.5 0.5 ml Immunogen: Human acute lymphocy c leukemia T-cells Clone: 12E7 CD8A (Cytotoxic & Suppressor T-Cell Marker); Isotype: IgG1, kappa
Clone C8/468 & C8/144B (Concentrate) Species Reac vity: Human. Others not tested. Posi ve Control: MOLT-4 cells. Pancreas or Ewing's sarcoma. Species: Mouse Specificity: Recognizes a sialoglycoprotein of 27-32kDa, Immunogen: Human CD8 recombinant protein (C8/468); A 13 identified as CD99, MIC2 gene product, or E2 antigen. This amino acid synthetic peptide from the C-terminal cytoplasmic antibody shows a very similar reactivity to other CD99 antibodies domain of alpha chain of human CD8 molecule (C8/144B) (e.g. O13, 12E7, or HBA-71) and is excellent for Clone: C8/468 & C8/144B immunohistochemical staining of formalin-fixed, paraffin- Isotype: IgG1, kappa (C8/468); IgG1, kappa (C8/144B) embedded tissues. Species Reactivity: Human. Others not known. Status: RUO Positive Control: HuT78 or hPBL. Tonsil. Catalog Number Volume Specificity: CD8 is a 68 kDa transmembrane glycoprotein expressed as a heterodimer by a majority of thymocytes, and by RA0204-C.1 0.1 ml major histocompatibility complex (MHC) class I restricted, RA0204-C.5 0.5 ml mature, suppressor/cytotoxic T-cells. Status: RUO Catalog Number Volume RA0043-C.1 0.1 ml RA0043-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
60 Antibodies
CD99 / MIC2 (Ewing's Sarcoma Marker); Clone CDX2 (GI Epithelial Marker); Clone CDX2/1690 HO36-1.1 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified E-rose e forming cells from human Immunogen: Recombinant human CDX2 protein fragment peripheral blood lymphocytes (aa150-249) (exact sequence is proprietary) Clone: HO36-1.1 Clone: CDX2/1690 Isotype: IgM, kappa Isotype: IgG2a, kappa Species Reac vity: Human and Rat. Others not tested. Species Reactivity: Human. Others not known. Posi ve Control: Pancreas or Ewing's sarcoma. Positive Control: HT29 cells or Colon Carcinoma. Specificity: Recognizes a sialoglycoprotein of 27-32kDa, Specificity: An -CDX2 has been useful to establish GI origin of identified as CD99, MIC2 gene product, or E2 antigen. This metastatic adenocarcinomas and carcinoids and is especially antibody shows a very similar reactivity to other CD99 antibodies useful to distinguish metastatic colorectal adenocarcinoma from (e.g. O13, 12E7, or HBA-71) and is excellent for lung adenocarcinoma. However, mucinous carcinomas of the immunohistochemical staining of formalin-fixed, paraffin- ovary also express CDX2 protein. It limits the usefulness of this embedded tissues. marker in the distinction of metastatic colorectal Status: RUO adenocarcinoma from mucinous carcinoma of the ovary. Catalog Number Volume Status: RUO RA0203-C.1 0.1 ml Catalog Number Volume RA0203-C.5 0.5 ml RA0480-C.1 0.1 ml RA0480-C.5 0.5 ml CD99 / MIC2 (Ewing's Sarcoma Marker); Clone RA0480-C1 1 ml MIC2/877 (Concentrate) CFTR (Cystic Fibrosis Transmembrane Conductance Species: Mouse Immunogen: Recombinant human MIC2 protein Regulator); Clone CFTR/1341 (Concentrate) Clone: MIC2/877 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant human full-length CFTR. Species Reac vity: Human. Others not tested. Clone: CFTR/1341 Posi ve Control: MOLT-4 cells. Pancreas or Ewing's sarcoma. Isotype: IgG1 Specificity: Recognizes a sialoglycoprotein of 27-32kDa, Species Reactivity: Human. Others not known. identified as CD99, MIC2 gene product, or E2 antigen. Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. Status: RUO Specificity: Recognizes a protein of 165-170kDa, identified as Catalog Number Volume cystic fibrosis transmembrane conductance regulator (CFTR). Status: RUO RA0205-C.1 0.1 ml RA0205-C.5 0.5 ml Catalog Number Volume RA0497-C.1 0.1 ml CDw75 (B-Cell Marker); Clone LN-1 (Concentrate) RA0497-C.5 0.5 ml Species: Mouse RA0497-C1 1 ml Immunogen: Nuclei from pokeweed mitogen-s mulated peripheral blood lymphocytes. CFTR (Cystic Fibrosis Transmembrane Conductance Clone: LN-1 Regulator); Clone CFTR/1342 (Concentrate) Isotype: IgM, kappa Species: Mouse Species Reac vity: Human. Others not known. Immunogen: Recombinant human full-length CFTR Posi ve Control: HeLa or Daudi Cells. Germinal center B-cells in Clone: CFTR/1342 a lymph node or tonsil. Use LN1's ability to stain surface of Isotype: IgG1 erythrocytes as an internal positive control. Species Reactivity: Reacts with human. Others not known. Specificity: Recognizes a neuraminidase-sensi ve sialoprotein Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. (CDw75), present on cell membrane and cytoplasm of germinal Specificity: Recognizes a protein of 165-170kDa, identified as center B-cells and derived lymphomas. This antibody reacts with cystic fibrosis transmembrane conductance regulator (CFTR). RBC precursors of bone marrow, ductal, and ciliated epithelial Status: RUO cells of kidney, breast, prostate, pancreas, lung, and with glioblastomas, astrocytomas, and Reed Sternberg cells in Catalog Number Volume lymphocyte predominant Hodgkin's disease. RA0498-C.1 0.1 ml Status: RUO RA0498-C.5 0.5 ml Catalog Number Volume RA0498-C1 1 ml RA0291-C.1 0.1 ml RA0291-C.5 0.5 ml RA0291-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
61 Antibodies
CFTR (Cystic Fibrosis Transmembrane Conductance CFTR (Cystic Fibrosis Transmembrane Conductance Regulator); Clone CFTR/1643 (Concentrate) Regulator); Clone SPM176 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CFTR fragment (aa258-385) Immunogen: Recombinant human full-length CFTR. (exact sequence is proprietary). Clone: SPM176 Clone: CFTR/1643 Isotype: IgG2a Isotype: IgG2b Species Reactivity: Reacts with human and mouse. Others not Species Reactivity: Reacts with human. Others not known. known. Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. Specificity: Recognizes a protein of 165-170kDa, identified as Specificity: Recognizes a protein of 165-170kDa, identified as cystic fibrosis transmembrane conductance regulator (CFTR). cystic fibrosis transmembrane conductance regulator (CFTR). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0500-C.1 0.1 ml RA0499-C.1 0.1 ml RA0500-C.5 0.5 ml RA0499-C.5 0.5 ml RA0500-C1 1 ml RA0499-C1 1 ml CFTR (Cystic Fibrosis Transmembrane Conductance Chromogranin A / CHGA (Neuroendocrine Regulator); Clone CFTR/1775R (Concentrate) Marker); Clone CGA/413 (Concentrate) Species: Rabbit Species: Mouse. Immunogen: Recombinant human CFTR fragment (aa258-385) Immunogen: Recombinant human chromogranin A protein. (exact sequence is proprietary). Clone: CGA/413 Clone: CFTR/1775R Isotype: IgG2b, kappa. Isotype: IgG, kappa Species Reactivity: Reacts with Human. Does not react with rat. Species Reactivity: Reacts with human. Others not known. Others not known. Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Specificity: Recognizes a protein of 165-170kDa, identified as pancreas, or pheochromocytoma. cystic fibrosis transmembrane conductance regulator (CFTR). Specificity: Recognizes the Chromogranin A protein. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0503-C.1 0.1 ml RA0514-C.1 0.1 ml RA0503-C.5 0.5 ml RA0514-C.5 0.5 ml RA0503-C1 1 ml RA0514-C1 1 ml CFTR (Cystic Fibrosis Transmembrane Conductance Chromogranin A / CHGA (Neuroendocrine Regulator); Clone CFTR/1785 (Concentrate) Marker); Clone CGA/414 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CFTR fragment (aa258-385) Immunogen: Recombinant human chromogranin A protein (exact sequence is proprietary). Clone: CGA/414 Clone: CFTR/1785 Isotype: IgG1, kappa Isotype: IgG2b Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human. Others not known. Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, Positive Control: MOLT-4 cells. Pancreas, Kidney or Placenta. pancreas, or pheochromocytoma. Specificity: Recognizes a protein of 165-170kDa, identified as Specificity: Chromogranin A is present in neuroendocrine cells cystic fibrosis transmembrane conductance regulator (CFTR). throughout the body, including the neuroendocrine cells of the Status: RUO large and small intestine, adrenal medulla and pancreatic islets. It Catalog Number Volume is an excellent marker for carcinoid tumors, pheochromocytomas, paragangliomas, and other RA0502-C.1 0.1 ml neuroendocrine tumors. RA0502-C.5 0.5 ml Status: RUO RA0502-C1 1 ml Catalog Number Volume RA0090-C.1 0.1 ml RA0090-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
62 Antibodies
Chromogranin A / CHGA (Neuroendocrine Chromogranin A / CHGA (Neuroendocrine Marker); Clone CHGA/1731R (Concentrate) Marker); Clone CHGA/765 (Concentrate) Species: Rabbit. Species: Mouse Immunogen: Recombinant human full-length Chromogranin A Immunogen: Recombinant human CHGA protein protein. Clone: CHGA/765 Clone: CHGA/1731R Isotype: IgG1, kappa Isotype: IgG, kappa. Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human. Does not react with rat. Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, Others not known. pancreas, or pheochromocytoma. Positive Control: PC12 cells. Adrenal gland, bowel, parathyroid, Specificity: Chromogranin A is present in neuroendocrine cells pancreas, or pheochromocytoma. throughout the body, including the neuroendocrine cells of the Specificity: Recognizes the Chromogranin A protein. large and small intestine, adrenal medulla and pancreatic islets. It Status: RUO is an excellent marker for carcinoid tumors, Catalog Number Volume pheochromocytomas, paragangliomas, and other neuroendocrine tumors. RA0515-C.1 0.1 ml Status: RUO RA0515-C.5 0.5 ml Catalog Number Volume RA0515-C1 1 ml RA0096-C.1 0.1 ml Chromogranin A / CHGA (Neuroendocrine RA0096-C.5 0.5 ml Marker); Clone CHGA/1773R (Concentrate) Chromogranin A / CHGA (Neuroendocrine Species: Rabbit. Immunogen: Recombinant human full-length Chromogranin A Marker); Clone CHGA/777 (Concentrate) protein. Species: Mouse Clone: CHGA/1773R Immunogen: Recombinant human CHGA protein Isotype: Rabbit / IgG, kappa. Clone: CHGA/777 Species Reactivity: Reacts with human. Does not react with rat. Isotype: IgG1, kappa Others not known. Species Reac vity: Human. Others not known. Positive Control: PC12 cells. Adrenal gland, bowel, parathyroid, Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, pancreas, or pheochromocytoma. pancreas, or pheochromocytoma. Specificity: Recognizes the Chromogranin A protein. Specificity: Chromogranin A is present in neuroendocrine cells Status: RUO throughout the body, including the neuroendocrine cells of the large and small intestine, adrenal medulla and pancreatic islets. It Catalog Number Volume is an excellent marker for carcinoid tumors, RA0516-C.1 0.1 ml pheochromocytomas, paragangliomas, and other RA0516-C.5 0.5 ml neuroendocrine tumors. RA0516-C1 1 ml Status: RUO Chromogranin A / CHGA (Neuroendocrine Catalog Number Volume Marker); Clone CHGA/1815R (Concentrate) RA0097-C.1 0.1 ml RA0097-C.5 0.5 ml Species: Rabbit. Immunogen: Recombinant full-length human CHGA protein. Chromogranin A / CHGA (Neuroendocrine Clone: CHGA/1815R Marker); Clone CHGA/798 (Concentrate) Isotype: IgG, kappa. Species Reactivity: Reacts with human. Does not react with rat. Species: Mouse Others not known. Immunogen: Recombinant human CHGA protein Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Clone: CHGA/798 pancreas, or pheochromocytoma. Isotype: IgG1, kappa Specificity: Recognizes the Chromogranin A protein. Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, pancreas, or pheochromocytoma. Catalog Number Volume Specificity: Chromogranin A is present in neuroendocrine cells RA0517-C.1 0.1 ml throughout the body, including the neuroendocrine cells of the RA0517-C.5 0.5 ml large and small intestine, adrenal medulla and pancreatic islets. It RA0517-C1 1 ml is an excellent marker for carcinoid tumors, pheochromocytomas, paragangliomas, and other neuroendocrine tumors. Status: RUO Catalog Number Volume RA0098-C.1 0.1 ml RA0098-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
63 Antibodies
Chromogranin A / CHGA (Neuroendocrine Chromogranin A / CHGA (Neuroendocrine Marker); Clone LK2H10 & PHE5 (Concentrate) Marker); Clone LK2H10, PHE5 & CGA/414 Species: Mouse (Concentrate) Immunogen: Human pheochromocytoma (LK2H10 & PHE5) Species: Mouse Clone: LK2H10 & PHE5 Immunogen: Human pheochromocytoma (LK2H10 & PHE5) & Isotype: IgG1, kappa (LK2H10 & PHE5) recombinant human chromogranin A protein (CGA414). Species Reac vity: Human, Monkey, Pig, Mouse and Rat. Clone: LK2H10, PHE5 & CGA/414 Others not known. Isotype: IgG1, kappa (LK2H10, PHE5 & CGA/414) Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, Species Reac vity: Human, Monkey, Pig, Mouse and Rat. pancreas, or pheochromocytoma. Others not known. Specificity: Chromogranin A is present in neuroendocrine cells Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, throughout the body, including the neuroendocrine cells of the pancreas, or pheochromocytoma. large and small intestine, adrenal medulla and pancreatic islets. It Specificity: Chromogranin A is present in neuroendocrine cells is an excellent marker for carcinoid tumors, throughout the body, including the neuroendocrine cells of the pheochromocytomas, paragangliomas, and other large and small intestine, adrenal medulla and pancreatic islets. It neuroendocrine tumors. is an excellent marker for carcinoid tumors, Status: RUO pheochromocytomas, paragangliomas, and other Catalog Number Volume neuroendocrine tumors. Status: RUO RA0094-C.1 0.1 ml RA0094-C.5 0.5 ml Catalog Number Volume RA0095-C.1 0.1 ml Chromogranin A / CHGA (Neuroendocrine RA0095-C.5 0.5 ml Marker); Clone LK2H10 (Concentrate) Species: Mouse Chromogranin A / CHGA (Neuroendocrine Immunogen: Human pheochromocytoma Marker); Clone PHE5 (Concentrate) Clone: LK2H10 Species: Mouse Isotype: IgG1, kappa Immunogen: Human pheochromocytoma Species Reac vity: Human, Monkey, Pig, Mouse and Rat. Does Clone: PHE5 not react with Guinea Pig, Sheep & Rabbit. Others not known. Isotype: IgG1, kappa Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, Species Reac vity: Human, Monkey. Does not react with pancreas, or pheochromocytoma. Mouse and Rat. Others not known. Specificity: Chromogranin A is present in neuroendocrine cells Posi ve Control: PC12 cells. Adrenal gland, bowel, thyroid, throughout the body, including the neuroendocrine cells of the pancreas, or pheochromocytoma. large and small intestine, adrenal medulla and pancreatic islets. It Specificity: Chromogranin A is present in neuroendocrine cells is an excellent marker for carcinoid tumors, throughout the body, including the neuroendocrine cells of the pheochromocytomas, paragangliomas, and other large and small intestine, adrenal medulla and pancreatic islets. It neuroendocrine tumors. is an excellent marker for carcinoid tumors, Status: RUO pheochromocytomas, paragangliomas, and other Catalog Number Volume neuroendocrine tumors. Status: RUO RA0091-C.1 0.1 ml RA0091-C.5 0.5 ml Catalog Number Volume RA0093-C.1 0.1 ml RA0093-C.5 0.5 ml Chromogranin A / CHGA (Neuroendocrine Marker); Clone SPM339 (Concentrate) Species: Mouse Immunogen: Human pheochromocytoma Clone: SPM339 Isotype: IgG1, kappa Species Reactivity: Human, Monkey, Pig, Mouse and Rat. Does not react with guinea pig, sheep & rabbit. Others not known. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, pancreas, or pheochromocytoma. Specificity: Recognizes the Chromogranin A protein. Status: RUO Catalog Number Volume RA0512-C.1 0.1 ml RA0512-C.5 0.5 ml RA0512-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
64 Antibodies
Chromogranin A / CHGA (Neuroendocrine Clathrin, Light Chain; Clone CLC/1421 (Concentrate) Marker); Clone SPM553 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Purified recombinant N-terminal fragment of Immunogen: Recombinant human Chromogranin A protein human Clathrin Light Chain. Clone: SPM553 Clone: CLC/1421 Isotype: IgG1, kappa Isotype: IgG2b, kappa. Species Reactivity: Human. Others not known. Species Reactivity: Reacts with human. Others not known. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Positive Control: HeLa cells. Placenta or prostate carcinoma. pancreas, or pheochromocytoma. Specificity: Recognizes proteins of 31-44kDa, which are Specificity: Recognizes the Chromogranin A protein. identified as Clathrin Light Chains (both A & B). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0511-C.1 0.1 ml RA0524-C.1 0.1 ml RA0511-C.5 0.5 ml RA0524-C.5 0.5 ml RA0511-C1 1 ml RA0524-C1 1 ml Chromogranin A / CHGA (Neuroendocrine c-Myc Oncoprotein; Clone 9E10.3 (Concentrate) Marker); Clone SPM585 (Concentrate) Species: Mouse Species: Mouse. Immunogen: A synthe c pep de, corresponding to aa 408-439 Immunogen: Human pheochromocytoma. (AEEQKLISEEDLLRKRREQLKHKLEQLRNSCA) from the C-terminus Clone: SPM585 of human c-Myc, coupled to KLH. Isotype: IgG1, kappa. Clone: 9E10.3 Species Reactivity: Human & monkey. Does not react with Isotype: IgG1, kappa mouse & rat. Others not known. Species Reac vity: Human. Does not react with Mouse, Rat, or Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Chicken. Others not tested. pancreas, or pheochromocytoma. Posi ve Control: HL-60 cells or breast carcinoma. Specificity: Recognizes the Chromogranin A protein. Specificity: This an body recognizes a transcrip on factor of 64- Status: RUO 67kDa, identified as c-Myc. Its epitope spans between aa 410- 419 (EQKLISEEDL) which is a specific portion of an alpha helical Catalog Number Volume region of the human c-Myc protein. This antibody shows no cross- RA0513-C.1 0.1 ml reaction with v-Myc. RA0513-C.5 0.5 ml Status: RUO RA0513-C1 1 ml Catalog Number Volume Chromogranin A / CHGA (Neuroendocrine RA0226-C.1 0.1 ml Marker); Clones CGA/413 & CHGA/777 & RA0226-C.5 0.5 ml CHGA/798 (Concentrate) c-Myc Oncoprotein; Clone MYC909 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human chromogranin A protein. Immunogen: Recombinant human c-Myc protein Clone: CGA/413 & CHGA/777 & CHGA/798 Clone: MYC909 Isotype: IgG's Isotype: IgG1, kappa Species Reactivity: Human, monkey, pig, mouse, and rat. Others Species Reac vity: Human. Others not tested. not known. Posi ve Control: HL-60 cells or breast carcinoma. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Specificity: This an body recognizes a transcrip on factor of 64- pancreas, or pheochromocytoma. 67kDa, identified as c-Myc. Its epitope spans between aa 410- Specificity: Recognizes the Chromogranin A protein. 419 (EQKLISEEDL) which is a specific portion of an alpha helical Status: RUO region of the human c-Myc protein. This antibody shows no cross- Catalog Number Volume reaction with v-Myc. Status: RUO RA0510-C.1 0.1 ml RA0510-C.5 0.5 ml Catalog Number Volume RA0510-C1 1 ml RA0227-C.1 0.1 ml RA0227-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
65 Antibodies
Complement 4d (C4d) (Acute Humoral Rejection Creatine Kinase-BB (CK-BB); Clone 2ba6 Marker); Clone C4D204 (Concentrate) (Concentrate) Species: Mouse Species: Mouse. Immunogen: Recombinant human Complement 4d protein Immunogen: Human CKBB protein. Clone: C4D204 Clone: 2ba6 Isotype: IgG1, kappa Isotype: IgG1, kappa. Species Reactivity: Human. Others not known. Species Reactivity: Reacts with human. Predicted to react with Positive Control: Rejected Renal Transplant Tissue chimpanzee, rhesus monkey, dog, cow, mouse, rat, chicken, Specificity: This Mab is specific to Complement 4d (C4d) and it zebrafish, and frog. Others not tested. reacts with the secreted as well as cell-bound C4d. Positive Control: Cerebellum. Status: RUO Specificity: This monoclonal antibody recognizes the CKBB Catalog Number Volume isoenzyme and does not react with the B subunit in CKMB. It shows minimal reactivity with other human serum proteins. RA0025-C.1 0.1 ml Status: RUO RA0025-C.5 0.5 ml Catalog Number Volume CPS1 / Carbamoyl-Phosphate Synthetase (Hepatic RA0519-C.1 0.1 ml Mitochondrial Marker); Clone CPS1/1022 RA0519-C.5 0.5 ml (Concentrate) RA0519-C1 1 ml Species: Mouse Cyclin B1 (G2- & M-phase Cyclin); Clone Immunogen: Recombinant human CPS1 protein CCNB1/1098 (Concentrate) Clone: CPS1/1022 Isotype: IgG1 Species: Mouse Species Reactivity: Human and Dog. Others not known. Immunogen: Recombinant human CCNB1 protein Positive Control: HeLa cells. Liver or Hepatocellular Carcinoma Clone: CCNB1/1098 (HCC). Isotype: IgG1, kappa Specificity: This antibody recognizes a protein of 165kDa, Species Reac vity: Human and Mouse. Others not known. identified as carbamoyl phosphate synthetase 1 (CPS1). Posi ve Control: Any human cell line in logarithmic growth Status: RUO phase, tonsil, or testis. Specificity: This an body recognizes a protein of 55-62kDa, Catalog Number Volume identified as cyclin B1. RA0434-C.1 0.1 ml Status: RUO RA0434-C.5 0.5 ml Catalog Number Volume RA0434-C1 1 ml RA0429-C.5 0.5 ml CPS1 / Carbamoyl-Phosphate Synthetase Cyclin D1 (G1-Cyclin & Mantle Cell Lymphoma (Hepatocellular Marker); Clone SPM615 Marker); Clone CCND1/3370 (Concentrate) (Concentrate) Species: Rabbit Species: Mouse. Immunogen: Synthetic peptide corresponding to residues within Immunogen: Recombinant human CPS1 protein. aa200-295 of Cyclin D1. Clone: SPM615 Clone: CCND1/3370 Isotype: IgG1 Isotype: IgG Species Reactivity: Reacts with human and dog. Others not Species Reactivity: Human. known. Positive Control: Human mantle cell lymphoma, breast or Positive Control: HeLa cells, liver, or hepatocellular carcinoma bladder carcinomas. (HCC). Specificity: Recognizes a protein of 36kDa, identified as cyclin D1. Specificity: This monoclonal antibody recognizes a protein of Status: RUO 165kDa, identified as carbamoyl phosphate synthetase 1 (CPS1). Status: RUO Catalog Number Volume Catalog Number Volume RA0483-C.1 0.1 ml RA0483-C.5 0.5 ml RA0535-C.1 0.1 ml RA0483-C1 1 ml RA0535-C.5 0.5 ml RA0535-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
66 Antibodies
Cyclin D1 (G1-Cyclin & Mantle Cell Marker); Clone Cytokeratin 10 (Suprabasal Epithelial Marker); CCND1/809 (Concentrate) Clone AE20 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CCND1 protein Immunogen: Human cytokera n 10 Clone: CCND1/809 Clone: AE20 Isotype: IgG2a, kappa Isotype: IgG1, kappa Species Reactivity: Human. Others not known. Species Reac vity: Human and Mouse. Others not known. Positive Control: T47D, ZR75, BT474, SKBR3, MCF-7, MDA-MB- Posi ve Control: A431, HeLa, MCF7 cells or Esophagus. 453, HT29, Ramos, Jurkat or A431 cells. ~60% of mantle cell Specificity: This an body recognizes a protein of 56.5kDa, lymphomas and ~40% of breast carcinomas are positive. identified as cytokeratin 10 (CK10). Specificity: This antibody recognizes a protein of 36kDa, Status: RUO identified as cyclin D1. Catalog Number Volume Status: RUO RA0179-C.1 0.1 ml Catalog Number Volume RA0179-C.5 0.5 ml RA0426-C.1 0.1 ml RA0426-C.5 0.5 ml Cytokeratin 10 (Suprabasal Epithelial Marker); RA0426-C1 1 ml Clone DE-K10 (Concentrate) Cytochrome c (Mitochondrial Marker); Clone Species: Mouse Immunogen: Cytoskeletal preparation extracted from human 7H8.2C12 (Concentrate) ectocervical epithelium. Species: Mouse Clone: DE-K10 Immunogen: Synthe c pep des corresponding to amino acids Isotype: IgG1, kappa 1-80, 81-104 and 66-104 of pigeon cytochrome c. Species Reactivity: Human, Dog and Cat. Others not known. Clone: 7H8.2C12 Positive Control: Esophagus or Tonsil. A431, HeLa, MCF7 cells. Isotype: IgG2b, kappa Specificity: This antibody recognizes a protein of 56.5kDa Species Reac vity: Human, Mouse, Rat, Horse, Dog, Pigeon, identified as Cytokeratin 10. Frog, and Drosophila. Others not known. Status: RUO Posi ve Control: K-562, HL-60, Jurkat, NIH3T3, or PC-3 cells. Catalog Number Volume Cardiac muscle. Specificity: This an body recognizes an epitope within amino RA0460-C.1 0.1 ml acids 93-104 of pigeon cytochrome c. RA0460-C.5 0.5 ml Status: RUO RA0460-C1 1 ml Catalog Number Volume Cytokeratin 10 (Suprabasal Epithelial Marker); RA0359-C.1 0.1 ml Clone KRT10/844 (Concentrate) RA0359-C.5 0.5 ml Species: Mouse Cytochrome c (Mitochondrial Marker); Clone Immunogen: Recombinant human KRT10 protein Clone: KRT10/844 CTC05 (Concentrate) Isotype: IgG1, kappa Species: Mouse Species Reac vity: Human and Mouse. Others not known. Immunogen: Recombinant cytochrome c protein Posi ve Control: A431, HeLa, MCF7 cells or Esophagus. Clone: CTC05 Specificity: This an body recognizes a protein of 56.5kDa, Isotype: IgG2b, kappa identified as cytokeratin 10 (CK10). Species Reac vity: Human, Mouse, Rat, Horse, Dog, Pigeon, Status: RUO Frog, and Drosophila. Others not known. Catalog Number Volume Posi ve Control: K-562, HL-60, Jurkat, NIH3T3, or PC-3 cells. Cardiac muscle. RA0180-C.1 0.1 ml Specificity: Recognizes cytochrome c in a wide range of species, RA0180-C.5 0.5 ml from Drosophila to human. Status: RUO Catalog Number Volume RA0360-C.1 0.1 ml RA0360-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
67 Antibodies
Cytokeratin 14 (KRT14) (Squamous Cell Marker); Cytokeratin 17 (KRT17) (Basal Epithelial Marker); Clone LL002 (Concentrate) Clone KRT17/778 (Concentrate) Species: Mouse Species: Mouse Immunogen: A synthe c pep de of 15 amino acids from the C- Immunogen: The cytoskeletal frac on of rat colon epithelium terminus of human keratin 14. Clone: KRT17/778 Clone: LL002 Isotype: IgG2b, kappa Isotype: IgG3 Species Reac vity: Human, Rat, Cow, Goat and Pig. Others not Species Reac vity: Human, Mouse, and Rat. Others not known. known. Posi ve Control: A431 cells. Skin or Squamous cell carcinoma. Posi ve Control: T24 cells or skin. Specificity: An -CK14 is useful in differen a ng squamous cell Specificity: This an body to CK17 is an excellent tool to carcinomas from poorly differentiated epithelial tumors. Anti- distinguish myoepithelial cells from luminal epithelium of various CK14 is one of the specific basal markers for distinguishing glands such as mammary, sweat and salivary. CK17 is expressed between basal and non-basal subtypes of breast carcinomas. in epithelial cells of various origins, such as bronchial epithelial Anti-CK14 is also a good marker for differentiation of intraductal cells and skin appendages. It may be considered as an "epithelial from invasive salivary duct carcinoma by the positive staining of stem cell" marker because the CK17 antibody marks basal cell basal cells surrounding the in-situ neoplasm as well as for the differentiation. differentiation of benign prostate from prostate carcinoma. Status: RUO Furthermore, this antibody has been useful in separating Catalog Number Volume oncocytic tumors of the kidney from its renal mimics, and in identifying metaplastic carcinomas of the breast. RA0183-C.1 0.1 ml Status: RUO RA0183-C.5 0.5 ml Catalog Number Volume Cytokeratin 18 (KRT18); Clone DA7 (Concentrate) RA0181-C.1 0.1 ml Species: Mouse RA0181-C.5 0.5 ml Immunogen: Human breast cancer PMC 42 cells Clone: DA7 Cytokeratin 17 (KRT17) (Basal Epithelial Marker); Isotype: IgG1, kappa Clone E3 (Ks17.E3) (Concentrate) Species Reac vity: Human. Does not react with Mouse, Rat, Species: Mouse Sheep, Hamster, Cow, Dog and Pig. Others not known. Immunogen: The cytoskeletal frac on of rat colon epithelium Posi ve Control: MCF-7, HeLa cells, or Breast Cancer. Clone: E3 (Ks17.E3) Specificity: This an body reacts with a wide variety of simple Isotype: IgG2b, kappa epithelia. It does not react with stratified squamous epithelia. It Species Reac vity: Human, Rat, Cow, Goat and Pig. Others not reacts with epithelial tumors of the gastrointestinal tract, lung, known. breast, pancreas, ovary, and thyroid. Posi ve Control: T24 cells or skin. Status: RUO Specificity: This an body to CK17 is an excellent tool to Catalog Number Volume distinguish myoepithelial cells from luminal epithelium of various RA0185-C.1 0.1 ml glands such as mammary, sweat and salivary. CK17 is expressed in epithelial cells of various origins, such as bronchial epithelial RA0185-C.5 0.5 ml cells and skin appendages. It may be considered as an "epithelial Cytokeratin 18 (KRT18); Clone DC10 (Concentrate) stem cell" marker because the CK17 antibody marks basal cell differentiation. Species: Mouse Status: RUO Immunogen: Human breast cancer PMC 42 cells Clone: DC10 Catalog Number Volume Isotype: IgG1 RA0182-C.1 0.1 ml Species Reac vity: Human. Does not react with Mouse, Rat, RA0182-C.5 0.5 ml Sheep, Hamster, Cow, Dog and Pig. Others not known. Posi ve Control: MCF-7, HeLa, A431 cells or Breast Cancer. Specificity: This an body reacts with a wide variety of simple epithelia. It does not react with stratified squamous epithelia. It reacts with epithelial tumors of the gastrointestinal tract, lung, breast, pancreas, ovary, and thyroid. Status: RUO Catalog Number Volume RA0184-C.1 0.1 ml RA0184-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
68 Antibodies
Cytokeratin 18 (KRT18); Clone DE-K18 Cytokeratin 18 (KRT18); Clone KRT18/836 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Cytoskeletal prepara on extracted from the Immunogen: Recombinant human KRT18 protein human vulvar squamous carcinoma cell line A431 Clone: KRT18/836 Clone: DE-K18 Isotype: IgG1 Isotype: IgG1, kappa Species Reac vity: Human, Dog, and Cat. Others not known. Species Reac vity: Human, Dog and Cat. Others not known. Posi ve Control: MCF-7, HeLa, A431 cells, or Breast Cancer. Posi ve Control: MCF-7, HeLa cells, or Breast Cancer. Specificity: This an body reacts with a wide variety of simple Specificity: This an body reacts with a wide variety of simple epithelia. It does not react with stratified squamous epithelia. It epithelia. It does not react with stratified squamous epithelia. It reacts with epithelial tumors of the gastrointestinal tract, lung, reacts with epithelial tumors of the gastrointestinal tract, lung, breast, pancreas, ovary, and thyroid. breast, pancreas, ovary, and thyroid. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0189-C.1 0.1 ml RA0186-C.1 0.1 ml RA0189-C.5 0.5 ml RA0186-C.5 0.5 ml Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Cytokeratin 18 (KRT18); Clone KRT18/834 Marker); Clone A53-B/A2.26 & BA17 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Human breast cancer MCF-7 cells (A53-B/A2); Immunogen: Recombinant human KRT18 protein Human mammary epithelial organoids (BA17) Clone: KRT18/834 Clone: A53-B/A2.26 & BA17 Isotype: IgG1 Isotype: IgG2a, kappa (A53-B/A2); IgG1, kappa (BA17) Species Reac vity: Human. Does not react with Mouse, Rat, Species Reac vity: Human and Mouse. Others not known. Sheep, Hamster, Cow, Dog and Pig. Others not known. Posi ve Control: MCF-7, HeLa, Hep-G2 cells, breast cancer. Posi ve Control: MCF-7, HeLa, A431 cells, or Breast Cancer. Specificity: This an body reacts with the rod domain of human Specificity: This an body reacts with a wide variety of simple cytokeratin-19 (CK19), a polypeptide of 40kDa. epithelia. It does not react with stratified squamous epithelia. It Status: RUO reacts with epithelial tumors of the gastrointestinal tract, lung, Catalog Number Volume breast, pancreas, ovary, and thyroid. Status: RUO RA0192-C.1 0.1 ml RA0192-C.5 0.5 ml Catalog Number Volume RA0187-C.1 0.1 ml Cytokeratin 19 (KRT19) (Pancreatic Stem Cell RA0187-C.5 0.5 ml Marker); Clone A53-B/A2.26 (Ks19.1) (Concentrate) Cytokeratin 18 (KRT18); Clone KRT18/835 Species: Mouse Immunogen: Human breast cancer MCF-7 cells (Concentrate) Clone: A53-B/A2.26 (Ks19.1) Species: Mouse Isotype: IgG2a, kappa Immunogen: Recombinant human KRT18 protein Species Reac vity: Human. Others not known. Clone: KRT18/835 Posi ve Control: MCF-7, HeLa, Hep-G2 cells, breast cancer. Isotype: IgG1 Specificity: This an body reacts with the rod domain of human Species Reac vity: Human. Does not react with Mouse, Rat, cytokeratin-19 (CK19), a polypeptide of 40kDa. Its epitope maps Sheep, Hamster, Cow, Dog and Pig. Others not known. between amino acids 312-335. Posi ve Control: MCF-7, HeLa, A431 cells, or Breast Cancer. Status: RUO Specificity: This an body reacts with a wide variety of simple Catalog Number Volume epithelia. It does not react with stratified squamous epithelia. It reacts with epithelial tumors of the gastrointestinal tract, lung, RA0190-C.1 0.1 ml breast, pancreas, ovary, and thyroid. RA0190-C.5 0.5 ml Status: RUO Catalog Number Volume RA0188-C.1 0.1 ml RA0188-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
69 Antibodies
Cytokeratin 19 (KRT19) (Pancreatic Stem Cell Cytokeratin 7 (Glandular and Transitional Marker); Clone BA17 (Concentrate) Epithelial Marker); Clone KRT7/760 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human mammary epithelial organoids. Immunogen: Recombinant human KRT7 protein Clone: BA17 Clone: KRT7/760 Isotype: IgG1, kappa Isotype: IgG1 Species Reac vity: Human and Mouse. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: MCF-7, HeLa cells, breast cancer. Posi ve Control: HeLa cells. Carcinoma of ovary, lung, cervix, or Specificity: This an body reacts with the rod domain of human breast. cytokeratin-19 (CK19), a polypeptide of 40kDa. Specificity: This an body recognizes an intermediate filament Status: RUO protein (IFP) of 55kDa, which is identified as cytokeratin 7. This Catalog Number Volume antibody is highly specific to cytokeratin 7 and shows no cross- reaction with other IFPs. RA0191-C.1 0.1 ml Status: RUO RA0191-C.5 0.5 ml Catalog Number Volume Cytokeratin 19 (KRT19) (Pancreatic Stem Cell RA0171-C.1 0.1 ml Marker); Clone KRT19/799 (Concentrate) RA0171-C.5 0.5 ml Species: Mouse Cytokeratin 7 (Glandular and Transitional Immunogen: Recombinant human KRT19 protein Clone: KRT19/799 Epithelial Marker); Clone OV-TL12/30 & K72.7 Isotype: IgG2a, kappa (Concentrate) Species Reac vity: Human. Others not known. Species: Mouse Posi ve Control: MCF-7, HeLa, Hep-G2 cells, breast cancer. Immunogen: OTN 11, ovarian carcinoma cell line (OV-TL12/30); Specificity: This an body reacts with human cytokera n-19 Semi-purified cytokeratin preparation (K72.7) (CK19), a polypeptide of 40kDa. Clone: OV-TL12/30 & K72.7 Status: RUO Isotype: IgG1 (OV-TL12/30 & K72.7) Catalog Number Volume Species Reac vity: Human. Others not known. Posi ve Control: HeLa cells. Carcinoma of ovary, lung, cervix, or RA0193-C.1 0.1 ml breast. RA0193-C.5 0.5 ml Specificity: This an body recognizes an intermediate filament Cytokeratin 19 (KRT19) (Pancreatic Stem Cell protein (IFP) of 55kDa, which is identified as cytokeratin 7. This antibody is highly specific to cytokeratin 7 and shows no cross- Marker); Clone KRT19/800 (Concentrate) reaction with other IFPs. Species: Mouse Status: RUO
Immunogen: Recombinant human KRT19 protein Catalog Number Volume Clone: KRT19/800 Isotype: IgG1, kappa RA0172-C.1 0.1 ml Species Reac vity: Human and Mouse. Others not known. RA0172-C.5 0.5 ml Posi ve Control: MCF-7, HeLa cells, breast cancer. Specificity: This an body reacts with cytokera n-19 (CK19), a Cytokeratin 7 (Glandular and Transitional polypeptide of 40kDa. Epithelial Marker); Clone OV-TL12/30 Status: RUO (Concentrate) Catalog Number Volume Species: Mouse RA0194-C.1 0.1 ml Immunogen: OTN 11, ovarian carcinoma cell line RA0194-C.5 0.5 ml Clone: OV-TL12/30 Isotype: IgG1 Cytokeratin 7 (Glandular and Transitional Species Reac vity: Human. Others not known. Epithelial Marker); Clone K72.7 (Concentrate) Posi ve Control: HeLa cells. Carcinoma of ovary, lung, cervix, or breast. Species: Mouse Specificity: This an body recognizes an intermediate filament Immunogen: Semi-purified cytokera n prepara on. protein (IFP) of 55kDa, which is identified as cytokeratin 7. This Clone: K72.7 antibody is highly specific to cytokeratin 7 and shows no cross- Isotype: IgG1Species Reac vity: Human. Others not known. reaction with other IFPs. Posi ve Control: HeLa cells. Carcinoma of ovary, lung, cervix, or Status: RUO breast. Specificity: This an body recognizes an intermediate filament Catalog Number Volume protein (IFP) of 55kDa, which is identified as cytokeratin 7. This RA0169-C.1 0.1 ml antibody is highly specific to cytokeratin 7 and shows no cross- RA0169-C.5 0.5 ml reaction with other IFPs. Status: RUO Catalog Number Volume RA0170-C.1 0.1 ml RA0170-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
70 Antibodies
Cytokeratin 8 (KRT8); Clone 34BH11 (Concentrate) Cytokeratin 8 (KRT8); Clone K8/383 (Concentrate) Species: Mouse Species: Mouse Immunogen: Cytoskeletal extract of a human hepatocellular Immunogen: Recombinant human cytokera n 8 protein carcinoma cell line (Hep3B) Clone: K8/383 Clone: 34BH11 Isotype: IgG1 Isotype: IgM, kappa Species Reac vity: Human, Rat, Zebrafish. Others not known. Species Reac vity: Human, Monkey, and Rabbit. Others not Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or known. breast carcinoma. Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or Specificity: An -CK8 does not react with skeletal muscle or breast carcinoma. nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma Specificity: An -CK8 does not react with skeletal muscle or show strong positivity corresponding to that of simple epithelia nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma (with antibodies against CK8, CK18 and CK19). Reportedly, anti- show strong positivity corresponding to that of simple epithelia CK8 is useful for the differentiation of lobular ("ring-like, (with antibodies against CK8, CK18 and CK19). Reportedly, anti- perinuclear") from ductal ("peripheral-predominant") carcinoma CK8 is useful for the differentiation of lobular ("ring-like, of the breast. perinuclear") from ductal ("peripheral-predominant") carcinoma Status: RUO of the breast. Catalog Number Volume Status: RUO RA0174-C.1 0.1 ml Catalog Number Volume RA0174-C.5 0.5 ml RA0178-C.1 0.1 ml RA0178-C.5 0.5 ml Cytokeratin 8 (KRT8); Clone KRT8/818 (Concentrate) Cytokeratin 8 (KRT8); Clone H1 & TS1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human KRT8 protein Immunogen: Cytoskeleton prepara on containing cytokera n 8 Clone: KRT8/818 (H1); Keratin preparation from a human carcinoma (TS1). Isotype: IgG1, kappa Clone: H1 & TS1 Species Reac vity: Human. Others not known. Isotype: IgG1 (H1); IgG1 (TS1). Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or Species Reac vity: Human, Rat and Zebrafish. Others not breast carcinoma. known. Specificity: An -CK8 does not react with skeletal muscle or Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma breast carcinoma. show strong positivity corresponding to that of simple epithelia Specificity: An -CK8 does not react with skeletal muscle or (with antibodies against CK8, CK18 and CK19). Reportedly, anti- nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma CK8 is useful for the differentiation of lobular ("ring-like, show strong positivity corresponding to that of simple epithelia perinuclear") from ductal ("peripheral-predominant") carcinoma (with antibodies against CK8, CK18 and CK19). Reportedly, anti- of the breast. CK8 is useful for the differentiation of lobular ("ring-like, Status: RUO perinuclear") from ductal ("peripheral-predominant") carcinoma Catalog Number Volume of the breast. Status: RUO RA0177-C.1 0.1 ml RA0177-C.5 0.5 ml Catalog Number Volume RA0176-C.1 0.1 ml Cytokeratin 8 (KRT8); Clone TS1 (Concentrate) RA0176-C.5 0.5 ml Species: Mouse Cytokeratin 8 (KRT8); Clone H1 (Concentrate) Immunogen: Kera n prepara on from a human carcinoma Clone: TS1 Species: Mouse Isotype: IgG1, kappa Immunogen: Cytoskeleton prepara on containing cytokera n 8 Species Reac vity: Human. Does not react with Rat. Others not Clone: H1 known. Isotype: IgG1 Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or Species Reac vity: Human, Rat, Zebrafish. Others not known. breast carcinoma. Posi ve Control: MCF-7 or A431 cells. Skin, colon, lung, or Specificity: The epitope of this an body is located between aa breast carcinoma. 343-357. Anti-CK8 does not react with skeletal muscle or nerve Specificity: An -CK8 does not react with skeletal muscle or cells. Epithelioid sarcoma, chordoma, and adamantinoma show nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma strong positivity corresponding to that of simple epithelia (with show strong positivity corresponding to that of simple epithelia antibodies against CK8, CK18 and CK19). Reportedly, anti-CK8 is (with antibodies against CK8, CK18 and CK19). Reportedly, anti- useful for the differentiation of lobular ("ring-like, perinuclear") CK8 is useful for the differentiation of lobular ("ring-like, from ductal ("peripheral-predominant") carcinoma of the breast. perinuclear") from ductal ("peripheral-predominant") carcinoma Status: RUO of the breast. Catalog Number Volume Status: RUO RA0175-C.1 0.1 ml Catalog Number Volume RA0175-C.5 0.5 ml RA0173-C.1 0.1 ml RA0173-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
71 Antibodies
Cytokeratin 8/18 (Epithelial Marker); Clone C-43 & Cytokeratin, Acidic (Type I or LMW) (Epithelial DC10 (Concentrate) Marker); Clone AE-1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Cytoskeletal prepara on from HeLa epitheliod Immunogen: Human epidermal kera n carcinoma cells (C-43) and PMC-42 breast carcinoma cells of Clone: AE-1 human origin (DC10) Isotype: IgG1, kappa Clone: C-43 & DC10 Species Reac vity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Isotype: IgG1, kappa (C-43); IgG1, kappa (DC10) Rat, Chicken, Turtle. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Skin, Squamous cell carcinoma (SCC). Posi ve Control: MCF-7, HeLa, PMC-42, or A431 cells. Skin, Specificity: This an body recognizes the 56.5kDa (CK10); 50kDa colon, lung, or breast carcinoma. (CK14); 50kDa (CK15); 48kDa (CK16); 40kDa (CK19) keratins of Specificity: This an body cocktail recognizes all simple epithelia the acidic (Type I or LMW) subfamily. including glandular epithelium, for example, thyroid, female Status: RUO breast, gastrointestinal tract, respiratory tract, and urogenital Catalog Number Volume tract including transitional epithelium. All adenocarcinomas and most squamous carcinomas are positive, but keratinizing RA0385-C.1 0.1 ml squamous carcinomas are usually negative. RA0385-C.5 0.5 ml Status: RUO Cytokeratin, Acidic (Type I or LMW) (Epithelial Catalog Number Volume Marker); Clone KRTL (Concentrate) RA0388-C.1 0.1 ml Species: Mouse RA0388-C.5 0.5 ml Immunogen: Kera n prepara on from a human carcinoma Cytokeratin 8/18 (Epithelial Marker); Clone K8.8 & Clone: KRTL Isotype: IgG1, kappa DC10 (Concentrate) Species Reac vity: Human. Shows broad species reac vity. Species: Mouse Posi ve Control: Skin, Squamous cell carcinoma (SCC). Immunogen: Kera n prepara on from a human carcinoma Specificity: This an body recognizes the 56.5kDa (CK10); 50kDa (K8.8); PMC-42 human breast carcinoma cells (DC10) (CK14); 50kDa (CK15); 48kDa (CK16); 40kDa (CK19) keratins of Clone: K8.8 & DC10 the acidic (Type I or LMW) subfamily. Isotype: IgG1, kappa (K8.8); IgG1, kappa (DC10) Status: RUO Species Reac vity: Human. Others not known. Catalog Number Volume Posi ve Control: MCF-7 or A431 cells. Skin, Colon, lung or breast carcinoma. RA0389-C.1 0.1 ml Specificity: This an body cocktail recognizes all simple epithelia RA0389-C.5 0.5 ml including glandular epithelium, for example, thyroid, female breast, gastrointestinal tract, respiratory tract, and urogenital Cytokeratin, Basic (Type II or HMW) (Epithelial tract including transitional epithelium. All adenocarcinomas and Marker); Clone 34BE12 (Concentrate) most squamous carcinomas are positive, but keratinizing Species: Mouse squamous carcinomas are usually negative. Immunogen: Solubilized kera n extract from human stratum Status: RUO corneum Catalog Number Volume Clone: 34BE12 Isotype: IgG1, kappa RA0387-C.1 0.1 ml Species Reac vity: Human, Mouse, and Rat. Others not known. RA0387-C.5 0.5 ml Posi ve Control: PC12 cells, skin, prostate carcinoma. Cytokeratin 8; Clone KRT8/899 (Concentrate) Specificity: This an body recognizes CK1, CK5, CK10, and CK14. In normal epithelia, it stains stratified epithelia, myoepithelial Species: Mouse cells, and basal cells in the prostate gland and bronchi. This Immunogen: Cytoskeletal extract of Hep3B hepatocellular antibody shows no reactivity with hepatocytes, pancreatic acinar carcinoma cell line of human origin cells, proximal renal tubules, or endometrial glands; there is no Clone: KRT8/899 reactivity with cells derived from simple epithelia. Mesenchymal Isotype: IgM, kappa tumors, lymphomas, melanomas, neural tumors, and Species Reactivity: Human, Monkey and Rabbit. Others not neuroendocrine tumors are negative with this antibody. known. Status: RUO Positive Control: MCF-7 or A431 cells. Skin, Colon, lung or breast Catalog Number Volume carcinoma. Specificity: This antibody recognizes a 52.5kDa protein known as RA0383-C.1 0.1 ml Cytokeratin 8. Anti-CK8 does not react with skeletal muscle or RA0383-C.5 0.5 ml nerve cells. Epithelioid sarcoma, chordoma, and adamantinoma show strong positivity corresponding to that of simple epithelia (with antibodies against CK8, CK18 and CK19). Status: RUO Catalog Number Volume RA0441-C.1 0.1 ml RA0441-C.5 0.5 ml RA0441-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
72 Antibodies
Cytokeratin, Basic (Type II or HMW) (Epithelial Cytokeratin, Pan (Epithelial Marker); Clone AE-1 & Marker); Clone AE-3 (Concentrate) AE-3 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human epidermal kera n Immunogen: Human epidermal kera n Clone: AE-3 Clone: AE-1 & AE-3 Isotype: IgG1, kappa Isotype: IgG1, kappa (AE-1); IgG1, kappa (AE-3) Species Reac vity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Species Reac vity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Rat, Chicken. Others not known. Rat, Chicken. Others not known. Posi ve Control: Epithelial cells, skin or adenocarcinomas. Posi ve Control: Skin, Adeno- or Squamous carcinomas. Specificity: This an body recognizes basic (Type II or HMW) Specificity: This an body cocktail recognizes acidic (Type I or cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa LMW) and basic (Type II or HMW) cytokeratins, which include (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8). 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa Status: RUO (CK6); 52kDa (CK8); 56.5kDa (CK10); 50kDa (CK14); 50kDa Catalog Number Volume (CK15); 48kDa (CK16); 40kDa (CK19). This antibody stains cytokeratins present in normal and abnormal human tissues and RA0386-C.1 0.1 ml has shown high sensitivity in the recognition of epithelial cells RA0386-C.5 0.5 ml and carcinomas. Status: RUO Cytokeratin, Basic (Type II or HMW) (Epithelial Marker); Clone KRTH (Concentrate) Catalog Number Volume RA0382-C.1 0.1 ml Species: Mouse RA0382-C.5 0.5 ml Immunogen: Kera n prepara on from a human carcinoma Clone: KRTH Cytokeratin, Pan (Epithelial Marker); Clone KRTL & Isotype: IgG1, kappa Species Reac vity: Human. Shows broad species reac vity. KRTH (Concentrate) Posi ve Control: Skin, Adenocarcinomas. Species: Mouse Specificity: This an body recognizes basic (Type II or HMW) Immunogen: Kera n prepara on from a human carcinoma cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa Clone: KRTL & KRTH (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8). Isotype: IgG1, kappa (KRTL); IgG1, kappa (KRTH) Status: RUO Species Reac vity: Human. Shows broad species reac vity. Catalog Number Volume Posi ve Control: Skin, Adeno- or Squamous carcinomas. Specificity: This an body cocktail recognizes acidic (Type I or RA0390-C.1 0.1 ml LMW) and basic (Type II or HMW) cytokeratins, which include RA0390-C.5 0.5 ml CK1, CK3, CK4, CK5, CK6, CK8, CK10, CK14, CK15, CK16, and CK19. This antibody stains cytokeratins present in normal and Cytokeratin, Multi (Epithelial Marker); Clone C11 abnormal human tissues and has shown high sensitivity in the (Concentrate) recognition of epithelial cells and carcinomas. Species: Mouse Status: RUO Immunogen: Kera n-enriched prepara on from cultured Catalog Number Volume human A431 RA0391-C.1 0.1 ml Clone: C11 RA0391-C.5 0.5 ml Isotype: IgG1 Species Reac vity: Human, Cow, Rat, Mouse, Guinea pig, Frog, RA0391-C1 1 ml Goat, Marmoset, and Pig. Others not known. Cytokeratin, pan (Epithelial Marker); Clone PAN-CK Posi ve Control: A431 cells, skin, colon carcinoma. Specificity: This an body recognizes cytokera ns 4, 5, 6, 8, 10, (Concentrate) 13, and 18. Species: Mouse Status: RUO Immunogen: Human epidermal kera n Catalog Number Volume Clone: PAN-CK Isotype: IgG's, kappa RA0381-C.1 0.1 ml Species Reac vity: Human, Monkey, Cow, Dog, Rabbit, Mouse, RA0381-C.5 0.5 ml Rat, Chicken. Others not known. Posi ve Control: Skin, Adeno- or Squamous carcinomas Specificity: This an body cocktail recognizes acidic (Type I or LMW) and basic (Type II or HMW) cytokeratins, with 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa (CK6); 55kDa (CK7); 52kDa (CK8); 56.5kDa (CK10); 53kDa (CK13); 50kDa (CK14); 50kDa (CK15); 48kDa (CK16); 46kDa (CK17); 45kDa (CK18) and 40kDa (CK19). This antibody stains cytokeratins present in normal and abnormal human tissues and shows high sensitivity in the recognition of epithelial cells and carcinomas. Status: RUO Catalog Number Volume RA0430-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
73 Antibodies
Desmin (Muscle Cell Marker); Clone D33 Desmoglein-1 (DSG1); Clone DSG1/1733 (Concentrate) (Concentrate) Species: Mouse Species: Mouse. Immunogen: Proteins from human Leiomyoma. Immunogen: Recombinant human desmoglein-1 protein Clone: D33 fragment corresponding to intracellular domain (exact sequence Isotype: IgG1, kappa is proprietary). Species Reactivity: Human, Rat, Mouse, Hamster, Chicken. Clone: DSG1/1733. Others not known. Isotype: IgG1, kappa. Positive Control: Muscle, Uterus, Leiomyosarcoma or SJRH30 Species Reactivity: Reacts with human. Others not known. cells. Positive Control: A431 or A-375 cells. Skin. Specificity: Desmin, Clone D33 detects cells of normal smooth, Specificity: Recognizes a protein of ~150kDa, identified as skeletal, and cardiac muscles. This antibody reacts with Desmoglein-1 (DSG1). leiomyomas, leiomyosarcoma, rhabdomyomas, Status: RUO rhabdomyosarcoma, and perivascular cells of glomus tumors of Catalog Number Volume the skin. Status: RUO RA0565-C.1 0.1 ml RA0565-C.5 0.5 ml Catalog Number Volume RA0565-C1 1 ml RA0459-C.1 0.1 ml RA0459-C.5 0.5 ml Desmoglein-3 (Squamous Cell Marker); Clone 5G11 RA0459-C1 1 ml (Concentrate) Desmin (Muscle Cell Marker); Clone DES/1711 Species: Mouse. Immunogen: Recombinant human DSG3 extracellular protein (Concentrate) fragment (exact sequence is proprietary). Species: Mouse Clone: 5G11. Immunogen: Recombinant human full-length desmin protein. Isotype: IgG1, kappa. Clone: DES/1711 Species Reactivity: Reacts with human. Others not known. Isotype: IgG1, kappa Positive Control: A431 cells. Lung squamous cell carcinoma. Species Reactivity: Reacts with human, mouse, rat, hamster, and Specificity: Recognizes a protein of 130kDa, identified as chicken. Others not known. Desmoglein-3 (DSG3). This monoclonal antibody is highly specific Positive Control: SJRH30 Cells. Uterus or Leiomyosarcoma. to Desmoglein-3 and does not cross-react with other members of Specificity: Recognizes a 52kDa protein known as Desmin. the desmoglein-family. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0554-C.1 0.1 ml RA0571-C.1 0.1 ml RA0554-C.5 0.5 ml RA0571-C.5 0.5 ml RA0554-C1 1 ml RA0571-C1 1 ml Desmocollin-2/3; Clone 7G6 (Concentrate) Desmoglein-3 (Squamous Cell Marker); Clone Species: Mouse. DSG3/1535 (Concentrate) Immunogen: Human desmocollin-2 extracellular domain (exact Species: Mouse. sequence is proprietary). Immunogen: Recombinant human DSG3 extracellular protein Clone: 7G6. fragment (exact sequence is proprietary). Isotype: IgG1, kappa. Clone: DSG3/1535. Species Reactivity: Reacts with human, mouse, and rat. Others Isotype: IgG1, kappa. not known. Species Reactivity: Reacts with human. Others not known. Positive Control: HeLa cells. Skin. Positive Control: A431 cells. Skin or Lung squamous cell Specificity: Recognizes DSC2 and DSC3 proteins. carcinoma. Status: RUO Specificity: Recognizes a protein of 130kDa, identified as Catalog Number Volume Desmoglein-3 (DSG3). This monoclonal antibody is highly specific to Desmoglein-3 and does not cross-react with other members of RA0562-C.1 0.1 ml the Desmoglein-family. RA0562-C.5 0.5 ml Status: RUO RA0562-C1 1 ml Catalog Number Volume RA0572-C.1 0.1 ml RA0572-C.5 0.5 ml RA0572-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
74 Antibodies
DOG-1 / TMEM16A (Marker for Gastrointestinal Double Stranded DNA (dsDNA) (Nuclear Marker); Stromal Tumors); Clone DG1/447 & DOG-1.1 Clone 121-3 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Nuclei of Raji Burki 's cells Immunogen: Recombinant human DOG-1 protein (DG1/447); A Clone: 121-3 synthetic peptide from human DOG-1 protein Isotype: IgG3, kappa (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEK Species Reac vity: Human. Others not known. ERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a Posi ve Control: Tonsil carrier protein (DOG-1.1). cificity: This an body recognizes the double stranded DNA in Clone: DG1/447 & DOG-1.1 human cells. It can be used to stain the nuclei in cell or tissue Isotype: IgG1, kappa (DG1/447 & DOG-1.1) preparations and can be used as a nuclear marker in human cells. Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: Gastrointes nal Stromal Tumor (GIST) or Catalog Number Volume testicular germ cell tumor. Melanocytes in the basal layer of the RA0417-C.1 0.1 ml epidermis and mast cells in the dermis of normal skin. RA0417-C.5 0.5 ml Specificity: This monoclonal an body recognizes Human DOG1. It is a sensitive and specific immunohistochemical marker for Double Stranded DNA (dsDNA) (Nuclear Marker); GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. It is also a sensitive marker for Clone AE-2 (Concentrate) unusual GIST subgroups lacking c-Kit or PDGFRA mutations. Species: Mouse Status: RUO Immunogen: Nuclei of Raji Burki 's cells
Catalog Number Volume Clone: AE-2 Isotype: IgG3, kappa RA0364-C.1 0.1 ml Species Reac vity: Human. Others not known. RA0364-C.5 0.5 ml Posi ve Control: Tonsil Specificity: This an body recognizes the double stranded DNA DOG-1 / TMEM16A (Marker for Gastrointestinal in human cells. It can be used to stain the nuclei in cell or tissue Stromal Tumors); Clone DG1/447 (Concentrate) preparations and can be used as a nuclear marker in human cells. Species: Mouse Status: RUO Immunogen: Recombinant human DOG-1 protein Catalog Number Volume Clone: DG1/447 RA0418-C.1 0.1 ml Isotype: IgG1, kappa RA0418-C.5 0.5 ml Species Reac vity: Human. Others not known. Posi ve Control: Gastrointes nal Stromal Tumor (GIST) or EGFR (Epidermal Growth Factor Receptor); Clone testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin. 31G7 (Concentrate) Specificity: This monoclonal an body recognizes Human DOG1. Species: Mouse. Status: RUO Immunogen: Human EGFR purified from A431 cells. Catalog Number Volume Clone: 31G7. Isotype: IgG2a, kappa. RA0362-C.1 0.1 ml Species Reactivity: Reacts with human. Others not known. RA0362-C.5 0.5 ml Positive Control: A431 cells. Placenta, breast, colon, or bladder cancer. DOG-1 / TMEM16A (Marker for Gastrointestinal Specificity: This monoclonal antibody recognizes a protein of Stromal Tumors); Clone DOG-1.1 (Concentrate) 170kDa, identified as EGFR. EGFR is type I receptor tyrosine Species: Mouse kinase with sequence homology to erbB-1, -2, -3 -4 or HER-1, -2, - Immunogen: A synthe c pep de from human DOG-1 protein 3 -4. (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEK Status: RUO ERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a Catalog Number Volume carrier protein. RA0579-C.1 0.1 ml Clone: DOG-1.1 RA0579-C.5 0.5 Isotype: IgG1, kappa Species Reac vity: Human. Others not known. RA0579-C1 1 ml Posi ve Control: Gastrointes nal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin. Specificity: DOG1.1 is a sensi ve and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. DOG1.1 is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations. Status: RUO Catalog Number Volume RA0363-C.1 0.1 ml RA0363-C.5 0.5 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
75 Antibodies
EGFR (Epidermal Growth Factor Receptor); Clone EGFR (Epidermal Growth Factor Receptor); Clone 31G7 + GFR1195 (Concentrate) GFR450 (Concentrate) Species: Mouse. Species: Mouse Immunogen: Human EGFR purified from A431 cells (31G7); Immunogen: Recombinant human EGFR protein Recombinant human EGFR protein (GFR1195). Clone: GFR450 Clone: 31G7 & GFR1195. Isotype: IgG2a, kappa Isotype: IgG2a, kappa. Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human. Others not known. Posi ve Control: A431 cells. Breast or bladder cancer. Positive Control: A431 cells. Placenta, breast, colon, or bladder Specificity: This an body recognizes a protein of 170kDa, cancer. identified as EGFR. Specificity: This antibody recognizes a protein of 170kDa, Status: RUO identified as EGFR. Catalog Number Volume Status: RUO RA0107-C.1 0.1 ml Catalog Number Volume RA0107-C.5 0.5 ml RA0582-C.1 0.1 ml RA0582-C.5 0.5 ml EGFR (Epidermal Growth Factor Receptor); Clone RA0582-C1 1 ml SPM622 (Concentrate) EGFR (Epidermal Growth Factor Receptor); Clone Species: Mouse. Immunogen: Human EGFR purified from A431 cells. GFR/1667 (Concentrate) Clone: SPM622. Species: Mouse. Isotype: IgG2a, kappa. Immunogen: Recombinant human full-length EGFR protein. Species Reactivity: Reacts with human. Others not known. Clone: GFR/1667. Positive Control: A431 cells. Placenta, breast, colon, or bladder Isotype: IgG1. cancer. Species Reactivity: Reacts with human. Others not known. Specificity: This monoclonal antibody recognizes a protein of Positive Control: A431 cells. Placenta, breast, colon, or bladder 170kDa, identified as EGFR. EGFR is type I receptor tyrosine cancer. kinase with sequence homology to erbB-1, -2, -3 -4 or HER-1, -2, - Specificity: This monoclonal antibody recognizes a protein of 3 -4. 170kDa, identified as EGFR. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0580-C.1 0.1 ml RA0583-C.1 0.1 ml RA0580-C.5 0.5 ml RA0583-C.5 0.5 ml RA0580-C1 1 ml RA0583-C1 1 ml Ep-CAM / CD326 (Epithelial Marker); Clone EGFR (Epidermal Growth Factor Receptor); Clone EGP40/826 (Concentrate) GFR1195 (Concentrate) Species: Mouse Species: Mouse. Immunogen: Recombinant human TACSTD1 protein Immunogen: Recombinant extracellular domain of human EGFR; Clone: EGP40/826 aa25-645 (exact sequence is proprietary). Isotype: IgG1, kappa Clone: GFR1195. Species Reac vity: Human. Others not known. Isotype: IgG2a, kappa. Posi ve Control: HT29 cells or breast tumor. Species Reactivity: Reacts with human. Others not known. Specificity: Recognizes a 40-43kDa transmembrane epithelial Positive Control: A431 cells. Placenta, breast, colon, or bladder glycoprotein, identified as epithelial specific antigen (ESA), or cancer. epithelial cellular adhesion molecule (Ep-CAM). Specificity: This monoclonal antibody recognizes a protein of Status: RUO 170kDa, identified as EGFR. Catalog Number Volume Status: RUO RA0199-C.1 0.1 ml Catalog Number Volume RA0199-C.5 0.5 ml RA0581-C.1 0.1 ml RA0581-C.5 0.5 ml RA0581-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
76 Antibodies
Ep-CAM / CD326 (Epithelial Marker); Clone Ep-CAM / CD326 (Epithelial Marker); Clone VU-1D9 EGP40/837 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human TACSTD1 protein Immunogen: Small cell lung carcinoma cells Clone: EGP40/837 Clone: VU-1D9 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Does not react with Rat. Others not Posi ve Control: HT29 cells or breast tumor. known. Specificity: This an body has been used to dis nguish Posi ve Control: HT29 cells or breast tumor. adenocarcinoma from pleural mesothelioma and hepatocellular Specificity: This an body has been used to dis nguish carcinoma. This antibody is also useful in distinguishing serous adenocarcinoma from pleural mesothelioma and hepatocellular carcinomas of the ovary from mesothelioma. carcinoma. This antibody is also useful in distinguishing serous Status: RUO carcinomas of the ovary from mesothelioma. Catalog Number Volume Status: RUO RA0200-C.1 0.1 ml Catalog Number Volume RA0200-C.5 0.5 ml RA0195-C.1 0.1 ml RA0195-C.5 0.5 ml Ep-CAM / CD326 (Epithelial Marker); Clone HEA125 (Concentrate) ER beta-1 (Estrogen Receptor beta-1); Clone Species: Mouse ERb455 (Concentrate) Immunogen: Human colon cancer HT29 cells Species: Mouse Clone: HEA125 Immunogen: C-terminus fragment of recombinant human Isotype: IgG1, kappa estrogen receptor beta protein Species Reac vity: Human. Others not known. Clone: ERb455 Posi ve Control: HT29 cells or breast tumor. Isotype: IgG2a Specificity: Recognizes a 40-43kDa transmembrane epithelial Species Reac vity: Human, Monkey, Mouse, Rat, Pig, Horse glycoprotein, identified as epithelial specific antigen (ESA), or and Sheep. Others not known. epithelial cellular adhesion molecule (Ep-CAM). In Posi ve Control: Ovarian, breast or prostate carcinoma. immunoprecipitation experiments, the Ber-EP4 antibody blocks Specificity: Nuclear posi vity in estrogen receptor beta posi ve the reaction of the HEA125 antibody with MCF-7 cell lysate and tumors. vice versa, showing that the two antibodies react with the same Status: RUO antigen. The two antibodies also produce identical staining Catalog Number Volume results in cells and tissues. Of the 37 cell lines tested, the antibody homogeneously labels all (10/10) carcinoma cell lines, RA0111-C.1 0.1 ml whereas all non-epithelial cell lines (26/27) are negative except RA0111-C.5 0.5 ml for the erythromyeloid cell line K562. Status: RUO Erythropoietin (EPO); Clone EPO/1367 Catalog Number Volume (Concentrate) Species: Mouse RA0198-C.1 0.1 ml Immunogen: Recombinant fragment of human EPO protein RA0198-C.5 0.5 ml (aa28-162) (exact sequence is proprietary). Ep-CAM / CD326 (Epithelial Marker); Clone MOC- Clone: EPO/1367 Isotype: IgG 31 (Concentrate) Species Reactivity: Reacts with human. Others not known. Species: Mouse Positive Control: HepG2 Cells. Heart or Kidney. Immunogen: Neuraminidase treated GLS-1 human small cell Specificity: Recognizes a protein of about 37kDa, which is lung carcinoma cells identified as Erythropoietin (EPO). Clone: MOC-31 Status: RUO Isotype: IgG1, kappa Catalog Number Volume Species Reac vity: Human. Does not react with Rat. Others not known. RA0436-C.1 0.1 ml Posi ve Control: HT29 cells or breast tumor. RA0436-C.5 0.5 ml Specificity: The epitope of this an body is located in the first RA0436-C1 1 ml EGF-like repeat domain (EGF1) between amino acids 27-59 of Ep- CAM. This antibody has been used to distinguish adenocarcinoma from pleural mesothelioma and hepatocellular carcinoma. This antibody is also useful in distinguishing serous carcinomas of the ovary from mesothelioma. Status: RUO Catalog Number Volume RA0196-C.1 0.1 ml RA0196-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
77 Antibodies
Erythropoietin (EPO); Clone EPO/1368 Fascin-1; Clone FSCN1/417 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human fascin protein Immunogen: Recombinant fragment of human EPO protein Clone: FSCN1/417 (aa28-162) (exact sequence is proprietary). Isotype: IgG2a, kappa Clone: EPO/1368 Species Reac vity: Human. Others not known. Isotype: IgG Posi ve Control: HeLa cells. Thymus, spleen or Hodgkin's Species Reactivity: Reacts with human. Others not known. lymphoma. Positive Control: HepG2 Cells. Heart or Kidney. Specificity: Recognizes a protein of 55kDa, which is iden fied as Specificity: Recognizes a protein of about 37kDa, which is fascin-1. This antibody to fascin-1 is a very sensitive marker for identified as Erythropoietin (EPO). Reed-Sternberg cells and variants in nodular sclerosis, mixed Status: RUO cellularity, and lymphocyte depletion Hodgkin disease. It is uniformly negative in lymphoid cells, plasma cells, and myeloid Catalog Number Volume cells. RA0445-C.1 0.1 ml Status: RUO RA0445-C.5 0.5 ml Catalog Number Volume RA0445-C1 1 ml RA0296-C.1 0.1 ml Estrogen Receptor (Marker of Estrogen RA0296-C.5 0.5 ml Dependence); Clone ER505 (Concentrate) FSH-beta (Follicle Stimulating Hormone-beta); Species: Mouse Clone FSHb/1062 (Concentrate) Immunogen: Recombinant human Estrogen Receptor alpha protein (aa 2-185) Species: Mouse Clone: ER505 Immunogen: Recombinant hFSH beta subunit Isotype: IgG1, kappa Clone: FSHb/1062 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: MCF-7 cells or breast cancers. Species Reactivity: Human. Others not known. Specificity: This an body is specific to ER alpha and shows Positive Control: Anterior Pituitary minimal cross-reaction with other members of the family. Specificity: This antibody reacts with a protein of 22kDa, Status: RUO identified as the beta subunit of Follicle Stimulating Hormone (FSH). It does not cross react with the alpha subunit. Catalog Number Volume Status: RUO RA0110-C.1 0.1 ml Catalog Number Volume RA0110-C.5 0.5 ml RA0435-C.1 0.1 ml Fascin-1 (Reed-Sternberg Cell Marker); Clone RA0435-C.5 0.5 ml FSCN1/417 (Concentrate) RA0435-C1 1 ml Species: Mouse GFAP (Astrocyte & Neural Stem Cell Marker); Immunogen: Full length recombinant human FSCN1 protein Clone ASTRO/789 (Concentrate) Clone: FSCN1/417 Isotype: IgG2a, kappa Species: Mouse Species Reactivity: Human. Others not known. Immunogen: Recombinant GFAP protein Positive Control: HeLa, MCF-7, PC-3 or BEWO cells. Hodgkin's Clone: ASTRO/789 lymphoma, Ovarian, or Testicular Carcinoma. Isotype: IgG1 Specificity: This antibody recognizes a protein of 55kDa, which is Species Reac vity: Human, Mouse, Rat, Cow, Pig, Rabbit, and identified as fascin-1. Chicken. Others not known. Status: RUO Posi ve Control: Brain or Astrocytoma. Specificity: This an body recognizes a protein of ~50kDa which Catalog Number Volume is identified as Glial Fibrillary Acidic Protein (GFAP). It shows no RA0450-C.1 0.1 ml cross-reaction with other intermediate filament proteins. RA0450-C.5 0.5 ml Status: RUO RA0450-C1 1 ml Catalog Number Volume RA0122-C.1 0.1 ml RA0122-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
78 Antibodies
GFAP (Astrocyte & Neural Stem Cell Marker); Glypican-3 (GPC3) (Marker of Hepatocellular Clone GA-5 & ASTRO/789 (Concentrate) Carcinoma); Clone 1G12 & GPC3/863 (Concentrate) Species: Mouse Species: Mouse Immunogen: GFAP isolated from pig spinal cord (GA-5); Immunogen: Recombinant fragment containing amino acids Recombinant GFAP protein (ASTRO/789) 511-580 of human glypican-3 (1G12); Recombinant human GPC3 Clone: GA-5 & ASTRO/789 protein (GPC3/863). Isotype: IgG1 (GA-5); IgG1 (ASTRO/789) Clone: 1G12 & GPC3/863 Species Reac vity: Human, Mouse, Rat, Cow, Pig, Rabbit, Isotype: IgG1, kappa Chicken. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Brain or Astrocytoma. Posi ve Control: 293T cells or Hepatocellular carcinoma. Specificity: This an body recognizes a protein of ~50kDa which Specificity: An -GPC3 has been iden fied as a useful tumor is identified as Glial Fibrillary Acidic Protein (GFAP). It shows no marker for the diagnosis of hepatocellular carcinoma (HCC), cross-reaction with other intermediate filament proteins. hepatoblastoma, melanoma, testicular germ cell tumors, and Status: RUO Wilm's tumor. Catalog Number Volume Catalog Number Volume RA0123-C.1 0.1 ml RA0126-C.1 0.1 ml RA0123-C.5 0.5 ml RA0126-C.5 0.5 ml GFAP (Astrocyte & Neural Stem Cell Marker); Glypican-3 (GPC3) (Marker of Hepatocellular Clone GA-5 (Concentrate) Carcinoma); Clone 1G12 (Concentrate) Species: Mouse Species: Mouse Immunogen: GFAP isolated from pig spinal cord Immunogen: A recombinant fragment containing amino acids Clone: GA-5 511-580 of human glypican-3 Isotype: IgG1 Clone: 1G12 Species Reac vity: Human, Mouse, Rat, Cow, Pig, Rabbit, Isotype: IgG1, kappa Chicken. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Brain or Astrocytoma. Posi ve Control: 293T cells or Hepatocellular carcinoma. Specificity: This an body recognizes a protein of ~50kDa which Specificity: An -GPC3 has been iden fied as a useful tumor is identified as Glial Fibrillary Acidic Protein (GFAP). It shows no marker for the diagnosis of hepatocellular carcinoma (HCC), cross-reaction with other intermediate filament proteins. hepatoblastoma, melanoma, testicular germ cell tumors, and Status: RUO Wilm's tumor. Catalog Number Volume Status: RUO RA0121-C.1 0.1 ml Catalog Number Volume RA0121-C.5 0.5 ml RA0124-C.1 0.1 ml RA0124-C.5 0.5 ml Glycophorin A / CD235a (Erythrocyte Marker); Clone GYPA/280 (Concentrate) Glypican-3 (GPC3) (Marker of Hepatocellular Species: Mouse Carcinoma); Clone GPC3/863 (Concentrate) Immunogen: Recombinant human glycophorin A protein Species: Mouse Clone: GYPA/280 Immunogen: Recombinant human GPC3 protein Isotype: IgG1, kappa Clone: GPC3/863 Species Reactivity: Human. Others not tested. Isotype: IgG1, kappa Positive Control: Erythrocytes Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: 293T cells or Hepatocellular carcinoma. Catalog Number Volume Specificity: An -GPC3 has been iden fied as a useful tumor marker for the diagnosis of hepatocellular carcinoma (HCC), RA0438-C.1 0.1 ml hepatoblastoma, melanoma, testicular germ cell tumors, and RA0438-C.5 0.5 ml Wilm's tumor. RA0438-C1 1 ml Status: RUO Catalog Number Volume RA0125-C.1 0.1 ml RA0125-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
79 Antibodies
GM-CSF (Granulocyte/Macrophage - Colony GnRH-Receptor / LH-RH Receptor; Clone HH7/768 Stimulating Factor); Clone BVD2-21C11 (Concentrate) (Concentrate) Species: Mouse Species: Rat. Immunogen: Recombinant human GNRHR protein Immunogen: Recombinant human GM-CSF protein. Clone: HH7/768 Clone: BVD2-21C11 Isotype: IgG1, kappa Isotype: IgG2a, kappa. Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human, cynomolgus, and rhesus Posi ve Control: T47D cells. Pituitary gland, ovarian or breast monkey. Others not known. cancers. Positive Control: Lymph node and tonsil. Specificity: Recognizes an epitope on the extracellular domain Specificity: Recognizes a protein of 22kDA identified as of gonadotropin releasing hormone (GnRH) receptor or Granulocyte/macrophage - Colony-stimulating factor (GM-CSF). luteinizing hormone receptor (LHCGR). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0538-C.1 0.1 ml RA0128-C.1 0.1 ml RA0538-C.5 0.5 ml RA0128-C.5 0.5 ml RA0538-C1 1 ml gp100 / Melanosome / PMEL17 / SILV (Melanoma GnRH-Receptor / LH-RH Receptor; Clone A9E4 Marker); Clone HMB45 & PMEL/783 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Extract of pigmented melanoma metastases from Immunogen: A synthe c pep de of aa 1-29 lymph nodes (HMB45); Recombinant human SILV protein (MANSASPEQNQHCSAINNSIPLMQGNLPY) from the N-terminus of (PMEL/783) human GnRH receptor. Clone: HMB45 & PMEL/783 Clone: A9E4 Isotype: IgG1, kappa (HMB45); IgG1, kappa (PMEL/783) Isotype: IgG1, kappa Species Reac vity: Human. Others not tested. Species Reac vity: Human. Predicted to react with Pig and Posi ve Control: SK-MEL-28 cells or Melanoma. Rabbit. Others not known. Specificity: By immunohistochemistry, this an body specifically Posi ve Control: T47D cells. Pituitary gland, ovarian or breast recognizes a protein in melanocytes and melanomas. This cancers. antibody reacts with junctional and blue nevus cells and variably Specificity: Recognizes an epitope on the extracellular domain with fetal and neonatal melanocytes. Intradermal nevi, normal of gonadotropin releasing hormone (GnRH) receptor or adult melanocytes, and non-melanocytic cells are negative. It luteinizing hormone receptor (LHCGR). does not stain tumor cells of epithelial, lymphoid, glial, or Status: RUO mesenchymal origin. This antibody also stains Angiomyolipoma (PEComa). Catalog Number Volume Status: RUO RA0127-C.1 0.1 ml Catalog Number Volume RA0127-C.5 0.5 ml RA0294-C.1 0.1 ml GnRH-Receptor / LH-RH Receptor; Clone F1G4 RA0294-C.5 0.5 ml (Concentrate) gp100 / Melanosome / PMEL17 / SILV (Melanoma Species: Mouse Marker); Clone HMB45 (Concentrate) Immunogen: A synthetic peptide consisting of amino acids 1-29 (MANSASPEQNQHCSAINNSI PLMQGNLPY) from the N-terminus Species: Mouse of the human GnRH receptor. Immunogen: Extract of pigmented melanoma metastases from Clone: F1G4; same as GNRH03 lymph nodes Isotype: IgG1, kappa Clone: HMB45 Species Reactivity: Human and Rat. Predicted to react with Pig Isotype: IgG1, kappa and Rabbit. Others not known. Species Reac vity: Human. Does not react with Dog and Rat. Positive Control: T47D cells. Pituitary gland, ovarian or breast Others not tested. cancers. Posi ve Control: SK-MEL-28 cells or Melanoma. Specificity: This antibody recognizes an epitope on the Specificity: By immunohistochemistry, this an body specifically extracellular domain of the gonadotropin releasing hormone recognizes a protein in melanocytes and melanomas. This (GnRH) receptor or luteinizing hormone receptor (LHCGR). antibody reacts with junctional and blue nevus cells and variably Status: RUO with fetal and neonatal melanocytes. Intradermal nevi, normal adult melanocytes, and non-melanocytic cells are negative. It Catalog Number Volume does not stain tumor cells of epithelial, lymphoid, glial, or RA0437-C.1 0.1 ml mesenchymal origin. This antibody also stains Angiomyolipoma RA0437-C.5 0.5 ml (PEComa). RA0437-C1 1 ml Status: RUO Catalog Number Volume RA0292-C.1 0.1 ml RA0292-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
80 Antibodies gp100 / Melanosome / PMEL17 / SILV (Melanoma hCG Holo (Pregnancy & Choriocarcinoma Marker); Marker); Clone PMEL/783 (Concentrate) Clone HCGab/52 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human SILV protein Immunogen: Purified hCG protein Clone: PMEL/783 Clone: HCGab/52 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not tested. Species Reac vity: Human. Others not known. Posi ve Control: SK-MEL-28 cells or Melanoma. Posi ve Control: JAR or TT Cells. Placenta. Specificity: gp100, also designated ME20-M, ME20-S and PMEL Specificity: This an body is very specific because it reacts ONLY 17, is classified as a melanocyte differentiation antigen and is with intact hCG and not with either the free alpha- or free beta- expressed at low levels in normal cell lines and tissues, but is chain of hCG. upregulated in melanocytes. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0399-C.1 0.1 ml RA0293-C.1 0.1 ml RA0399-C.5 0.5 ml RA0293-C.5 0.5 ml HCG-alpha (Pregnancy & Choriocarcinoma Granulocyte-Colony Stimulating Factor (G-CSF); Marker); Clone SPM552 (Concentrate) Clone CSF3/900 (Concentrate) Species: Mouse Species: Mouse. Immunogen: Recombinant hCG alpha protein. Immunogen: Human recombinant full-length CSF3 protein. Clone: SPM552 Clone: CSF3/900 Isotype: IgG1, kappa Isotype: IgG1 Species Reactivity: Human. Others not known. Species Reactivity: Reacts with human and macaque monkey. Positive Control: Placenta. Others not known. Specificity: This monoclonal antibody reacts with a protein of Positive Control: HL60 cells, tonsil, or lymph node. ~13kDa, identified as HCG-alpha, a sub-unit of HCG. Specificity: This monoclonal antibody recognizes granulocyte- Status: RUO colony stimulating factor (G-CSF) in the cytoplasm of mature Catalog Number Volume granulocytes. It shows no reactivity with any other cell types. It reacts with early precursor and mature forms of myeloid cells. RA0504-C.1 0.1 ml Status: RUO RA0504-C.5 0.5 ml RA0504-C1 1 ml Catalog Number Volume RA0540-C.1 0.1 ml hCG-alpha; Clone HCGa/53 (Concentrate) RA0540-C.5 0.5 ml Species: Mouse RA0540-C1 1 ml Immunogen: Recombinant hCG alpha protein Clone: HCGa/53 Granulocyte-Colony Stimulating Factor (G-CSF); Isotype: IgG1, kappa Clone SPM468 (Concentrate) Species Reac vity: Human. Others not known. Species: Mouse. Posi ve Control: JAR or TT Cells. Placenta. Immunogen: Nuclei from pokeweed mitogen stimulated human Specificity: This monoclonal an body reacts with a protein of peripheral blood lymphocytes. ~13kDa, identified as the alpha subunit of hCG. Clone: SPM468 Status: RUO Isotype: IgG1 Catalog Number Volume Species Reactivity: Reacts with human and macaque monkey. RA0086-C.1 0.1 ml Others not known. Positive Control: HL60 cells, tonsil, or lymph node. RA0086-C.5 0.5 ml Specificity: This monoclonal antibody recognizes granulocyte- HCG-beta (Pregnancy & Choriocarcinoma Marker); colony stimulating factor (G-CSF) in the cytoplasm of mature granulocytes. It shows no reactivity with any other cell types. It Clone HCGb/211 (Concentrate) reacts with early precursor and mature forms of myeloid cells. Species: Mouse Status: RUO Immunogen: Purified human HCG-beta. Catalog Number Volume Clone: HCGb/211 Isotype: IgG1 RA0541-C.1 0.1 ml Species Reactivity: Reacts with human. Others not known. RA0541-C.5 0.5 ml Positive Control: Placenta. RA0541-C1 1 ml Specificity: This monoclonal antibody reacts with a protein of 22kDa, identified as HCG-beta, a sub-unit of HCG. It does not cross react with the alpha sub-unit. Status: RUO Catalog Number Volume RA0508-C.1 0.1 ml RA0508-C.5 0.5 ml RA0508-C1 1 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
81 Antibodies hCG-beta (Pregnancy & Choriocarcinoma Marker); HCG-beta (Pregnancy & Choriocarcinoma Marker); Clone HCGb/459 (Concentrate) Clone SPM105 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant hCG beta protein Immunogen: Recombinant hCG beta protein. Clone: HCGb/459 Clone: SPM105 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human. Others not known. Posi ve Control: JAR or TT Cells. Placenta. Positive Control: Placenta. Specificity: This monoclonal an body reacts with a protein of Specificity: This monoclonal antibody reacts with a protein of 22kDa, identified as the beta subunit of hCG. It does not cross 22kDa, identified as HCG-beta, a sub-unit of HCG. It does not react with the alpha subunit. This hCG detects cells and tumors cross react with the HCG-alpha sub-unit. of trophoblastic origin such as choriocarcinoma. Large cell Status: RUO carcinoma and adenocarcinoma of the lung demonstrate anti- Catalog Number Volume hCG positivity in 90% and 60% of cases, respectively. 20% of lung squamous cell carcinomas are positive. hCG expression by non- RA0506-C.1 0.1 ml trophoblastic tumors may indicate aggressive behavior. RA0506-C.5 0.5 ml Status: RUO RA0506-C1 1 ml Catalog Number Volume HCG-beta (Pregnancy & Choriocarcinoma Marker); RA0088-C.1 0.1 ml Clone SPM529 (Concentrate) RA0088-C.5 0.5 ml Species: Mouse hCG-beta (Pregnancy & Choriocarcinoma Marker); Immunogen: Recombinant hCG beta protein. Clone: SPM529 Clone HCGb/54 & HCGb/459 (Concentrate) Isotype: IgG1 Species: Mouse Species Reactivity: Reacts with human. Others not known. Immunogen: Recombinant hCG beta protein (HCGb/54 and Positive Control: Placenta. HCGb/459) Specificity: This monoclonal antibody reacts with a protein of Clone: HCGb/54 & HCGb/459 22kDa, identified as HCG-beta, a sub-unit of HCG. It does not Isotype: IgG1, kappa (HCGb/54 and HCGb/459) cross react with the alpha sub-unit. Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: JAR or TT Cells. Placenta. Catalog Number Volume Specificity: This monoclonal an body reacts with a protein of 22kDa, identified as the beta subunit of hCG. It does not cross RA0507-C.1 0.1 ml react with the alpha subunit. hCG antibody detects cells and RA0507-C.5 0.5 ml tumors of trophoblastic origin such as choriocarcinoma. Large RA0507-C1 1 ml cell carcinoma and adenocarcinoma of the lung demonstrate anti- hCG positivity in 90% and 60% of cases, respectively. 20% of lung Hepatocyte Specific Antigen (Hep Par 1) squamous cell carcinomas are positive. hCG expression by non- (Hepatocellular Marker); Clone OCH1E5 (Hep Par trophoblastic tumors may indicate aggressive behavior. 1) (Concentrate) Status: RUO Species: Mouse Catalog Number Volume Immunogen: Extract of a formalin-fixed, rejected allogra of a RA0089-C.1 0.1 ml human liver RA0089-C.5 0.5 ml Clone: OCH1E5; same as Hep Par 1 Isotype: IgG1 hCG-beta (Pregnancy & Choriocarcinoma Marker); Species Reac vity: Human and Dog. Others not known. Clone HCGb/54 (Concentrate) Posi ve Control: Liver or Hepatocellular Carcinoma (HCC). Specificity: Hepatocyte Specific An gen, also called Hepatocyte
Species: Mouse Paraffin 1 or Hep Par 1, localizes to the mitochondria of
Immunogen: Recombinant hCG beta protein hepatocytes. It is a sensitive marker for distinguishing
Clone: HCGb/54 hepatocellular carcinomas (HCC) from other metastatic
Isotype: IgG1, kappa carcinomas as well as cholangio-carcinomas.
Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: JAR or TT Cells. Placenta. Specificity: This monoclonal an body reacts with a protein of Catalog Number Volume 22kDa, identified as the beta subunit of hCG. It does not cross RA0409-C.1 0.1 ml react with the alpha subunit. This hCG antibody detects cells and RA0409-C.5 0.5 ml tumors of trophoblastic origin such as choriocarcinoma. Large cell carcinoma and adenocarcinoma of the lung demonstrate anti- hCG positivity in 90% and 60% of cases, respectively. 20% of lung squamous cell carcinomas are positive. hCG expression by non- trophoblastic tumors may indicate aggressive behavior. Status: RUO Catalog Number Volume RA0087-C.1 0.1 ml RA0087-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
82 Antibodies
Hepatocyte Specific Antigen (Hepatocellular HSP27 (Heat Shock Protein 27); Clone 24K/774 Marker); Clone HSA98 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: HEP-3B human hepatocellular carcinoma cells Immunogen: Recombinant human HSPB1 protein. Clone: HSA98 Clone: 24K/774 Isotype: IgG2b, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Chimpanzee, Monkey, Sheep, Rat, Posi ve Control: Liver or Hepatocellular Carcinoma (HCC). Mouse, and Chicken. Others not known. Specificity: Clone HSA98 binds to human hepatocytes and the Posi ve Control: ~50% of breast carcinomas are posi ve for majority of human hepatocellular carcinomas (HCC's). In frozen HSP27, especially those that are also positive for estrogen and/or sections, it stains hepatic cells and may be used as a marker of progesterone receptor. the liver. Cell preparations of hepatocellular carcinoma biopsies Specificity: This an body recognizes a 24-27kDa estrogen- or cell lines are found to bind HSA98 on the cell surface. This regulated protein, identified as heat shock protein 27 (HSP27). antibody stains liver hepatocytes in frozen human liver sections Status: RUO and is positive on the cell surface of human liver carcinomas. Catalog Number Volume Status: RUO RA0132-C.1 0.1 ml Catalog Number Volume RA0132-C.5 0.5 ml RA0410-C.1 0.1 ml RA0410-C.5 0.5 ml HSP27 (Heat Shock Protein 27); Clone G3.1 (Concentrate) HER-2 / c-erbB-2 / neu / CD340; Clone HRB2/451 Species: Mouse (Concentrate) Immunogen: Par ally purified HSP27 (earlier called 24K) Species: Mouse protein from breast cancer MCF-7 cells. Immunogen: Recombinant human HER-2 protein Clone: G3.1 Clone: HRB2/451 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Chimpanzee, Monkey, Sheep, Rat, Species Reac vity: Human. Others not known. Mouse, and Chicken. Others not known. Posi ve Control: SKBR-3 cells or breast cancers. Posi ve Control: ~50% of Breast Carcinomas are posi ve for Specificity: This an body is specific to HER-2/c-erbB-2 and HSP27, especially those that are also positive for estrogen and/or shows minimal cross-reaction with other members of the family. progesterone receptor. Status: RUO Specificity: This an body recognizes a 24-27kDa estrogen- Catalog Number Volume regulated protein, identified as heat shock protein 27 (HSP27). Status: RUO RA0108-C.1 0.1 ml RA0108-C.5 0.5 ml Catalog Number Volume RA0131-C.1 0.1 ml HPV-16 (Human Papilloma Virus 16); Clone RA0131-C.5 0.5 ml CAMVIR-1 (Concentrate) HSP60 (Heat Shock Protein 60); Clone HLD4/780 Species: Mouse Immunogen: Human papilloma virus type 16, major capsid (Concentrate) protein L1 Species: Mouse Clone: CAMVIR-1 Immunogen: Recombinant human HSPD1 protein Isotype: IgG2a, kappa Clone: HLD4/780 Species Reac vity: Type 16 of human Papilloma Virus (HPV-16). Isotype: IgG1, kappa Posi ve Control: HPV-16 infected cells or cervical ssue. Species Reac vity: Human, Mouse, Rat, Hamster, Sheep, Specificity: Reacts with a protein of 57kDa, iden fied as the L1 Rabbit, Cow, Dog, Pig, Monkey, Chicken, Xenopus laevis, and protein of human papilloma virus type 16 (HPV-16). The antibody Drosophila. Does not react with Bacteria, Helminths, and reacts very strongly with formalin-fixed, paraffin-embedded Spinach. Others not known. tissues containing HPV-16 or -33; very weak reactions were Posi ve Control: HeLa or HepG2 cells. Breast carcinoma. occasionally observed with biopsy specimens or smears Synovial biopsies from patients with juvenile chronic arthritis. containing HPV-6 or HPV-11. It cross-reacts with HPV37. Synovial lining layer is strongly positive for HSP60. Status: RUO Specificity: Recognizes a 60kDa protein, iden fied as the heat Catalog Number Volume shock protein 60 (HSP60). Status: RUO RA0380-C.1 0.1 ml RA0380-C.5 0.5 ml Catalog Number Volume RA0380-C1 1 ml RA0134-C.1 0.1 ml RA0134-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
83 Antibodies
HSP60 (Heat Shock Protein 60); Clone LK1 IgA (Immunoglobulin Alpha Heavy Chain) (B-Cell (Concentrate) Marker); Clone GA01 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human HSP60 protein Immunogen: Purified human alpha heavy chain Clone: LK1 Clone: GA01 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat, Hamster, Sheep, Species Reac vity: Human. Others not known. Rabbit, Cow, Dog, Pig, Monkey, Chicken, Xenopus laevis, and Posi ve Control: Daudi, 293T, Raji or hPBL cells. Tonsil or Drosophila. Does not react with Bacteria, Helminths, and spleen. Spinach. Others not known. Specificity: This monoclonal an body is specific to the heavy Posi ve Control: HeLa or HepG2 cells. Breast carcinoma. chain of IgA and shows minimal cross-reaction with heavy chains Synovial biopsies from patients with juvenile chronic arthritis. of other immunoglobulins. It is reactive with all subclasses of Synovial lining layer is strongly positive for HSP60. Alpha heavy chain. Specificity: This an body recognizes a 60kDa protein, iden fied Status: RUO as the heat shock protein 60 (HSP60). Its epitope is localized Catalog Number Volume between aa 383-447 of human HSP60. Clone LK1, unlike LK2, recognizes only the mammalian (not bacterial) HSP60 and is RA0137-C.1 0.1 ml useful in distinguishing HSP60 from mammals and bacteria. RA0137-C.5 0.5 ml Status: RUO IgA (Immunoglobulin Alpha Heavy Chain) (B-Cell Catalog Number Volume Marker); Clone HISA3 & GA01 (Concentrate) RA0133-C.1 0.1 ml Species: Mouse RA0133-C.5 0.5 ml Immunogen: Purified human IgA IDH1 R132H; Clone H09 (Concentrate) Clone: HISA3 & GA01 Isotype: IgG1, kappa (HISA3 & GA01) Species: Mouse Species Reac vity: Human. Others not known. Immunogen: Synthetic peptide, amino acid sequence Posi ve Control: Daudi, 293T, Raji or hPBL cells. Tonsil or CKPIIIGHHAYGD spleen. Clone: H09 Specificity: This monoclonal an body is specific to the heavy Isotype: IgG2a chain of IgA and shows minimal cross-reaction with heavy chains Species Reactivity: Human of other immunoglobulins. It is reactive with all subclasses of Positive Control: Oligodendroglioma, diffuse astrocytoma Alpha heavy chain. Specificity: Human IDH1 R132H point mutation Status: RUO Status: RUO Catalog Number Volume Manufactured By: Dianova GmbH RA0138-C.1 0.1 ml Catalog Number Volume RA0138-C.5 0.5 ml DIA-H09-M 0.1 ml DIA-H09 0.5 ml IgA (Immunoglobulin Alpha Heavy Chain) (B-Cell Marker); Clone HISA3 (Concentrate) IDH1-pan (wt & mutated); Clone W09
(Concentrate) Species: Mouse Immunogen: Purified human IgA Species: Rat Clone: HISA3 Immunogen: Peptide sequence 4-120 of human IDH1. Isotype: IgG1, kappa Clone: W09 Species Reac vity: Human. Others not known. Isotype: IgG2a Posi ve Control: Daudi, 293T, Raji or hPBL cells. Tonsil or Species Reactivity: Human spleen. Positive Control: Oligodendroglioma, diffuse astrocytoma. Specificity: This monoclonal an body is specific to the heavy Specificity: Human IDH1, wild type & point mutation. chain of IgA and shows minimal cross-reaction with heavy chains Status: RUO of other immunoglobulins. It is reactive with all subclasses of Manufactured By: Dianova GmbH Alpha heavy chain. Catalog Number Volume Status: RUO DIA-W09 0.5 ml Catalog Number Volume RA0136-C.1 0.1 ml RA0136-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
84 Antibodies
IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker); Clone B33/20 (Concentrate) Marker); Clone IG266 (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified human Ig Gamma Chain Immunogen: Purified human Ig Gamma Chain Clone: B33/20 Clone: IG266 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or Spleen. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Specificity: Recognizes a protein of 75kDa, iden fied as gamma Specificity: Recognizes a protein of 75kDa, iden fied as the heavy chain of human immunoglobulins. Its epitope maps in the gamma heavy chain of human immunoglobulins. It reacts with all CH2 domain of the Fc region of IgG. It reacts with all sub-classes sub-classes of gamma chains of human immunoglobulins. It does of gamma chain of human immunoglobulins. It does not cross- not cross-react with alpha (IgA), mu (IgM), epsilon (IgE), or delta react with alpha (IgA), mu (IgM), epsilon (IgE), or delta (IgD), (IgD), heavy chains, T-cells, monocytes, granulocytes, or heavy chains, T-cells, monocytes, granulocytes, or erythrocytes. erythrocytes. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0142-C.1 0.1 ml RA0140-C.1 0.1 ml RA0142-C.5 0.5 ml RA0140-C.5 0.5 ml IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker); Clone IG217 & IG266 (Concentrate) Marker); Clone DA4-4 (SA-DA4 or HB57) Species: Mouse (Concentrate) Immunogen: Purified human Ig Gamma Chain Species: Mouse Clone: IG217 & IG266 Immunogen: Heavy chain of human IgM Isotype: IgG1, kappa (IG217); IgG2a, kappa (IG266) Clone: DA4-4 (SA-DA4 or HB57) Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Species Reac vity: Human. Others not known. Specificity: This an body is specific to heavy chain of IgG and Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. shows minimal cross-reaction with heavy chains of other Specificity: Recognizes a protein of 75kDa, iden fied as mu immunoglobulins. It is reactive with all subclasses of Gamma heavy chain of human immunoglobulins. It does not cross-react heavy chain (IgG1, IgG2a, IgG2b, IgG3). with alpha (IgA), gamma (IgG), epsilon (IgE), or delta (IgD), heavy Status: RUO chains, T-cells, monocytes, granulocytes, or erythrocytes. Catalog Number Volume Status: RUO RA0141-C.1 0.1 ml Catalog Number Volume RA0141-C.5 0.5 ml RA0144-C.1 0.1 ml RA0144-C.5 0.5 ml IgG (Immunoglobulin Gamma Heavy Chain) (B-Cell Marker); Clone IG217 (Concentrate) IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Species: Mouse Marker); Clone ICO-30 (Concentrate) Immunogen: Purified human Ig Gamma Chain Species: Mouse Clone: IG217 Immunogen: Heavy chain of human IgM Isotype: IgG1, kappa Clone: ICO-30 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Species Reac vity: Human. Others not known. Specificity: Recognizes a protein of 75kDa, iden fied as the Posi ve Control: 293T, Raji or hPBL cells. Tonsil or Spleen. gamma heavy chain of human immunoglobulins. It reacts with all Specificity: Recognizes a protein of 75kDa, iden fied as mu sub-classes of gamma chains of human immunoglobulins. It does heavy chain of human immunoglobulins. It does not cross-react not cross-react with alpha (IgA), mu (IgM), epsilon (IgE), or delta with alpha (IgA), gamma (IgG), epsilon (IgE), or delta (IgD), heavy (IgD), heavy chains, T-cells, monocytes, granulocytes, or chains, T-cells, monocytes, granulocytes, or erythrocytes. erythrocytes. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0143-C.1 0.1 ml RA0139-C.1 0.1 ml RA0143-C.5 0.5 ml RA0139-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
85 Antibodies
IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Insulin / IRDN (Beta Cell & Insulinoma Marker); Marker); Clone IM260 & ICO-30 (Concentrate) Clone 2D11-H5 (INS05) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant heavy chain of human IgM (IM260); Immunogen: Purified pig insulin, conjugated to KLH Heavy chain of human IgM (ICO-30) Clone: 2D11-H5 (INS05) Clone: IM260 & ICO-30 Isotype: IgG1, kappa Isotype: IgG1, kappa (IM260 & ICO-30) Species Reac vity: Human, Cow and Pig. Does not react with Species Reac vity: Human. Others not known. Mouse and Rat. Others not known. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Posi ve Control: MIA PaCa-2 cells or Pancreas. Specificity: Recognizes a protein of 75kDa, iden fied as the mu Specificity: Recognizes a polypep de which is iden fied as heavy chain of human immunoglobulins. It does not cross-react insulin, a 51-amino acid polypeptide composed of A and B chains with alpha (IgA), gamma (IgG), epsilon (IgE), or delta (IgD) heavy connected through disulfide bonds. chains, T-cells, monocytes, granulocytes, or erythrocytes. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0161-C.1 0.1 ml RA0147-C.1 0.1 ml RA0161-C.5 0.5 ml RA0147-C.5 0.5 ml Insulin / IRDN (Beta Cell & Insulinoma Marker); IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Clone E2-E3 & 2D11-H5 (INS04 & INS05) Marker); Clone IM260 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant heavy chain of human IgM Immunogen: Purified pig insulin, conjugated to KLH Clone: IM260 Clone: E2-E3 & 2D11-H5 (INS04 & INS05) Isotype: IgG1, kappa Isotype: IgG1, kappa (E2-E3); IgG1, kappa (2D11-H5) Species Reac vity: Human. Others not known. Species Reac vity: Human, Cow Pig, Rabbit, and Rat. Others Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. not known. Specificity: Recognizes a protein of 75kDa, iden fied as mu Posi ve Control: MIA PaCa-2 cells or Pancreas. heavy chain of human immunoglobulins. It does not cross-react Specificity: Recognizes a polypep de which is iden fied as with alpha (IgA), gamma (IgG), epsilon (IgE), or delta (IgD), heavy insulin, a 51-amino acid polypeptide composed of A and B chains chains, T-cells, monocytes, granulocytes, or erythrocytes. connected through disulfide bonds. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0145-C.1 0.1 ml RA0163-C.1 0.1 ml RA0145-C.5 0.5 ml RA0163-C.5 0.5 ml IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Insulin / IRDN (Beta Cell & Insulinoma Marker); Marker); Clone IM373 (Concentrate) Clone E2-E3 (INS04) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant heavy chain of human IgM Immunogen: Purified pig insulin, conjugated to KLH Clone: IM373 Clone: E2-E3 (INS04) Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Cow Pig, Rabbit, and Rat. Others Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. not known. Specificity: Recognizes a protein of 75kDa, iden fied as mu Posi ve Control: MIA PaCa-2 cells or Pancreas. heavy chain of human immunoglobulins. It does not cross-react Specificity: Recognizes a polypep de which is iden fied as with alpha (IgA), gamma (IgG), epsilon (IgE), or delta (IgD), heavy insulin, a 51-amino acid polypeptide composed of A and B chains chains, T-cells, monocytes, granulocytes, or erythrocytes. connected through disulfide bonds. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0146-C.1 0.1 ml RA0162-C.1 0.1 ml RA0146-C.5 0.5 ml RA0162-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
86 Antibodies
Insulin / IRDN (Beta Cell & Insulinoma Marker); Involucrin (Squamous Cell Terminal Differentiation Clone IRDN/794 (Concentrate) Marker); Clone SY5 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant INS protein Immunogen: Purified involucrin from human kera nocytes Clone: IRDN/794 Clone: SY5 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Cow and Pig. Does not react with Species Reac vity: Human, Gorilla, Owl monkey, Pig, and Dog. Mouse and Rat. Others not known. Does not react with Mouse. Others not known. Posi ve Control: MIA PaCa-2 cells or Pancreas. Posi ve Control: MCF-7 cells. Localized to upper spinous and Specificity: Recognizes a polypep de which is iden fied as granular layers in normal skin. insulin, a 51-amino acid polypeptide composed of A and B chains Specificity: This an body recognizes a protein of 66kDa- connected through disulfide bonds. 170kDa, identified as involucrin. In Western blotting of cultured Status: RUO human keratinocytes, this antibody reacts with a 120kDa protein. Catalog Number Volume It stains the involucrin in a variety of sizes: 170kDa in MCF-7 cells, a doublet of ~115kDa and 150kDa in gorilla and owl monkey, RA0164-C.1 0.1 ml 66kDa in dog, and a doublet of 105kDa in pig. Its epitope maps RA0164-C.5 0.5 ml between codon 421-568 of human involucrin. Status: RUO Insulin / IRDN (Beta Cell & Insulinoma Marker); Clone IRDN/805 (Concentrate) Catalog Number Volume RA0166-C.1 0.1 ml Species: Mouse RA0166-C.5 0.5 ml Immunogen: Recombinant INS protein Clone: IRDN/805 Kappa Light Chain (B-Cell marker); Clone HP6053 & Isotype: IgG1, kappa Species Reac vity: Human, Cow, Pig, Rabbit and Rat. Others L1C1 (Concentrate) not known. Others not known. Species: Mouse Posi ve Control: MIA PaCa-2 cells or Pancreas. Immunogen: Purified human Ig kappa chain (HP6053); Human Specificity: Recognizes a polypep de which is iden fied as B-Lymphoma Cells (L1C1) insulin, a 51-amino acid polypeptide composed of A and B chains Clone: HP6053 & L1C1 connected through disulfide bonds. Isotype: IgG1, kappa (HP6053); IgG1, kappa (L1C1) Status: RUO Species Reac vity: Human. Others not known. Catalog Number Volume Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Specificity: This monoclonal an body is specific to the kappa RA0165-C.1 0.1 ml light chain of immunoglobulins and shows no cross-reaction with RA0165-C.5 0.5 ml the lambda light chain or any of the five heavy chains. Status: RUO Involucrin (Squamous Cell Terminal Differentiation Marker); Clone IVRN/827 (Concentrate) Catalog Number Volume RA0152-C.1 0.1 ml Species: Mouse RA0152-C.5 0.5 ml Immunogen: Purified involucrin from human kera nocytes Clone: IVRN/827 Kappa Light Chain (B-Cell marker); Clone HP6053 Isotype: IgG1, kappa dysplasias of the larynx and cervix. (Concentrate) Species Reac vity: Human. Others not known. Species: Mouse Posi ve Control: MCF-7 cells. Localized to upper spinous and Immunogen: Purified human Ig kappa chain granular layers in normal skin. Clone: HP6053 Specificity: This an body recognizes a protein of 66kDa- Isotype: IgG1, kappa 170kDa, identified as involucrin. In Western blotting of cultured Species Reac vity: Human. Others not known. human keratinocytes, this antibody reacts with a 120kDa protein. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. It stains the involucrin in a variety of sizes: 170kDa in MCF-7 cells, Specificity: This monoclonal an body is specific to the kappa a doublet of ~115kDa and 150kDa in gorilla and owl monkey, light chain of immunoglobulins and shows no cross-reaction with 66kDa in dog, and a doublet of 105kDa in pig. Its epitope maps the lambda light chain or any of the five heavy chains. between codon 421-568 of human involucrin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0151-C.1 0.1 ml RA0167-C.1 0.1 ml RA0151-C.5 0.5 ml RA0167-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
87 Antibodies
Kappa Light Chain (B-Cell marker); Clone Kap-56 Kappa Light Chain (B-Cell marker); Clone L1C1 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Human lymphocytes s mulated Immunogen: Human B-Lymphoma Cells Clone: Kap-56 Clone: L1C1 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Does not react with Rat. Others not Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. known. Specificity: This monoclonal an body is specific to the kappa Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. light chain of immunoglobulins and shows no cross-reaction with Specificity: This monoclonal an body is specific to the kappa the lambda light chain or any of the five heavy chains. light chain of immunoglobulins and shows no cross-reaction with Status: RUO the lambda light chain or any of the five heavy chains. Catalog Number Volume Status: RUO RA0154-C.1 0.1 ml Catalog Number Volume RA0154-C.5 0.5 ml RA0148-C.1 0.1 ml RA0148-C.5 0.5 ml Kappa Light Chain (B-Cell marker); Clone KLC264 (Concentrate) Kappa Light Chain (B-Cell marker); Clone TB28-2 Species: Mouse (Concentrate) Immunogen: Recombinant human Ig kappa chain Species: Mouse Clone: KLC264 Immunogen: Human IgG-kappa myeloma protein Isotype: IgG1, kappa Clone: TB28-2 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: 293T, Raji or hPBL cells. Tonsil or Spleen. Species Reac vity: Human. Others not known. Specificity: This monoclonal an body is specific to the kappa Posi ve Control: 293T, Raji or hPBL cells. Tonsil or Spleen. light chain of immunoglobulins and shows no cross-reaction with Specificity: This monoclonal an body is specific to the kappa the lambda light chain or any of the five heavy chains. light chain of immunoglobulins and shows no cross-reaction with Status: RUO the lambda light chain or any of the five heavy chains. Catalog Number Volume Status: RUO RA0149-C.1 0.1 ml Catalog Number Volume RA0149-C.5 0.5 ml RA0150-C.1 0.1 ml RA0150-C.5 0.5 ml Kappa Light Chain (B-Cell marker); Clone KLC709 (Concentrate) KBA.62 (Melanoma Associated Antigen); Clone Species: Mouse KBA.62 (Concentrate) Immunogen: Recombinant human Ig kappa chain Species: Mouse Clone: KLC709 Immunogen: Human KAL cells derived from lymph node Isotype: IgG1, kappa metastasis of malignant melanoma Species Reac vity: Human. Others not known. Clone: KBA.62 Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Isotype: IgG1, kappa Specificity: This monoclonal an body is specific to the kappa Species Reac vity: Human. Others not known. light chain of immunoglobulins and shows no cross-reaction with Posi ve Control: Melanoma the lambda light chain or any of the five heavy chains. Specificity: KBA.62 is a novel an -melanoma an body. It reacts Status: RUO positively against melanocytic tumors but not against other Catalog Number Volume tumors, thus demonstrating specificity and sensitivity. Moreover, it reacts positively against junctional nevus cells but not RA0153-C.1 0.1 ml intradermal nevi, and against fetal melanocytes but not normal RA0153-C.5 0.5 ml adult melanocytes. Status: RUO Catalog Number Volume RA0416-C.1 0.1 ml RA0416-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
88 Antibodies
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16; Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16; Clone CDH16/1071 (Concentrate) Clone SPM594 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human CDH16 protein Immunogen: Recombinant human CDH16 protein Clone: CDH16/1071 Clone: SPM594 Isotype: IgG1, kappa Isotype: Mouse / IgG1, kappa Species Reactivity: Human, Mouse, Rat, Rabbit and Dog. Others Species Reactivity: Human, Mouse, Rat, Rabbit and Dog. Others not known. not known. Positive Control: Normal kidney or renal cell carcinoma. Positive Control: Normal kidney or renal cell carcinoma. Specificity: This an body recognizes a protein of 130kDa, Specificity: This an body recognizes a protein of 130kDa, identified as Ksp-cadherin. identified as Ksp-cadherin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0431-C.1 0.1 ml RA0469-C.1 0.1 ml RA0431-C.5 0.5 ml RA0469-C.5 0.5 ml RA0431-C1 1 ml RA0469-C1 1 ml Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16; Lambda Light Chain (B-Cell Marker); Clone HP6054 Clone CDH16/1532R (Concentrate) (Concentrate) Species: Rabbit Species: Mouse Immunogen: Recombinant human full-length CDH16 protein Immunogen: Purified human IgG myeloma proteins coupled to Clone: CDH16/1532R polyaminostyrene microbeads. Isotype: Rabbit / IgG, kappa Clone: HP6054 Species Reactivity: Human, Mouse and Rat. Others not known. Isotype: IgG2a, kappa Positive Control: Normal kidney or renal cell carcinoma. Species Reac vity: Human. Others not known. Specificity: This monoclonal Ab recognizes a protein of 130kDa, Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. identified as Ksp-cadherin. Specificity: This monoclonal an body is specific to the lambda Status: RUO light chain of immunoglobulins and shows no cross-reaction with Catalog Number Volume the kappa light chain or any of the five heavy chains. Status: RUO RA0470-C.1 0.1 ml RA0470-C.5 0.5 ml Catalog Number Volume RA0470-C1 1 ml RA0156-C.1 0.1 ml RA0156-C.5 0.5 ml Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16; Clone rCDH16/1071 (Concentrate) Lambda Light Chain (B-Cell Marker); Clone ICO-106 Species: Mouse (Concentrate) Immunogen: Recombinant full-length human CDH16 protein Species: Mouse Clone: rCDH16/1071 Immunogen: Purified human IgG Isotype: Mouse / IgG1, kappa Clone: ICO-106 Species Reactivity: Human, Mouse, Rabbit and Dog. Others not Isotype: IgG1, kappa known. Species Reac vity: Human. Others not known. Positive Control: Normal kidney or renal cell carcinoma. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Specificity: This MAb recognizes a protein of 130kDa, identified Specificity: This monoclonal an body is specific to the lambda as Ksp-cadherin. light chain of immunoglobulins and shows no cross-reaction with Status: RUO the kappa light chain or any of the five heavy chains. Status: RUO Catalog Number Volume RA0468-C.1 0.1 ml Catalog Number Volume RA0468-C.5 0.5 ml RA0155-C.1 0.1 ml RA0468-C1 1 ml RA0155-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
89 Antibodies
Lambda Light Chain (B-Cell Marker); Clone LAM03 Lambda Light Chain (B-Cell Marker); Clone LcN-2 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified human lambda light chain Immunogen: Purified human IgG Clone: LAM03 Clone: LcN-2 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Specificity: This monoclonal an body is specific to the lambda Specificity: This monoclonal an body is specific to the lambda light chain of immunoglobulins and shows no cross-reaction with light chain of immunoglobulins and shows no cross-reaction with the kappa light chain or any of the five heavy chains. the kappa light chain or any of the five heavy chains. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0158-C.1 0.1 ml RA0157-C.1 0.1 ml RA0158-C.5 0.5 ml RA0157-C.5 0.5 ml Lambda Light Chain (B-Cell Marker); Clone Lamb14 LH, alpha (Luteinizing Hormone, alpha); Clone (Concentrate) LHa/756 (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified human lambda light chain Immunogen: Recombinant full-length hLH alpha protein. Clone: Lamb14 Clone: LHa/756 Isotype: IgG2a, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reactivity: Reacts with human. Others not known. Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Positive Control: Anterior Pituitary. Specificity: This monoclonal an body is specific to the lambda Specificity: This MAb reacts with a protein of ~13kDa, identified light chain of immunoglobulins and shows no cross-reaction with as alpha sub-unit of Luteinizing Hormone (LH). the kappa light chain or any of the five heavy chains. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0505-C.1 0.1 ml RA0160-C.1 0.1 ml RA0505-C.5 0.5 ml RA0160-C.5 0.5 ml RA0505-C1 1 ml Lambda Light Chain (B-Cell Marker); Clone LcN-2 & Macrophage Marker (Macrophage L1 Protein) ICO-106 (Concentrate) (Calprotectin); Clone MAC387 (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified human IgG (LcN-2 & ICO-106) Immunogen: Affinity purified monocyte membrane prepara on Clone: LcN-2 & ICO-106 Clone: MAC387 Isotype: IgG2a, kappa (LcN-2); IgG1, kappa (ICO-106) Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Baboon, Monkey, Cow, Pig, Goat, Posi ve Control: 293T, Raji or hPBL cells. Tonsil or spleen. Horse, Cat, Dog, Rabbit, Guinea pig, Rat, and Mouse. Others not Specificity: This monoclonal an body is specific to the lambda known. light chain of immunoglobulins and shows no cross-reaction with Posi ve Control: Tonsil, lymph node, or spleen. the kappa light chain or any of the five heavy chains. Specificity: This an body recognizes the L1 or Calprotec n Status: RUO molecule, an intra-cytoplasmic antigen comprised of 12-14kDa Catalog Number Volume subunits expressed by granulocytes, monocytes, and tissue macrophages. This antibody reacts with neutrophils, monocytes, RA0159-C.1 0.1 ml macrophages, and squamous mucosal epithelia and has been RA0159-C.5 0.5 ml shown to be an important marker for identifying macrophages in tissue sections. Status: RUO Catalog Number Volume RA0287-C.1 0.1 ml RA0287-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
90 Antibodies
Macrophage Marker (Myeloid-Related Proteins MAGE-1 (Target for Cancer Immunotherapy); 8/14) (MRP-8/MRP-14); Clone MRP/840 Clone MZ2E/838 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human MAGEA1 protein Immunogen: Recombinant human MRP protein Clone: MZ2E/838 Clone: MRP/840 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Baboon, Monkey, Cow, Pig, Goat, Posi ve Control: Melanoma cell lines. Melanomas, gliomas, Horse, Cat, Dog, Rabbit, Guinea pig, Rat, and Mouse. Others not neuroblastoma, non-small cell lung cancer, breast, gastric, known. colorectal, ovarian, and renal cell carcinomas. Posi ve Control: Tonsil, lymph node, or spleen. Specificity: Recognizes a protein of 42-46kDa, iden fied as Specificity: Recognizes a 12-14kDa subunit of MRP-8/14 (also MAGE-1. This antibody does not cross-react with MAGE-2, -3, - known as Calgranulin A/B or S100A8/A9); expressed by 4, -6 -9, -10, -or -12 proteins. granulocytes, monocytes, and tissue macrophages. This antibody Status: RUO reacts with neutrophils, monocytes, macrophages, and Catalog Number Volume squamous mucosal epithelia and has been shown to be an RA0202-C.1 0.1 ml important marker for identifying macrophages in tissue sections. RA0202-C.5 0.5 ml Status: RUO Catalog Number Volume MAGE-1 (Target for Cancer Immunotherapy); RA0290-C.1 0.1 ml Clone SPM282 (Concentrate) RA0290-C.5 0.5 ml Species: Mouse. Immunogen: Human MAGE-A1 full length recombinant protein. Macrophage Marker (S100A8/A9); Clone S100/722 Clone: SPM282. (Concentrate) Isotype: IgG1, kappa. Species: Mouse Species Reactivity: Reacts with human, rat, and dog. Others not Immunogen: Recombinant human S100 protein known. Clone: S100/722 Positive Control: Melanoma cell lines. Melanomas, gliomas, Isotype: IgG1, kappa neuroblastoma, non-small cell lung cancer, breast, gastric, Species Reac vity: Human, Baboon, Monkey, Cow, Pig, Goat, colorectal, ovarian, and renal cell carcinomas. Horse, Cat, Dog, Rabbit, Guinea pig, Rat, and Mouse. Others not Specificity: Recognizes a protein of 42-46kDa, identified as known. MAGE-1. This monoclonal antibody does not cross-react with Posi ve Control: Tonsil, lymph node, or spleen. MAGE-2, -3, -4, -6 -9, -10, -or -12 protein. Specificity: Recognizes a 12-14kDa subunit of S100A8/A9 (also Status: RUO known as Calgranulin A/B or MRP-8/14); expressed by Catalog Number Volume granulocytes, monocytes, and tissue macrophages. This antibody RA0576-C.1 0.1 ml reacts with neutrophils, monocytes, macrophages, and RA0576-C.5 0.5 ml squamous mucosal epithelia, and has been shown to be an important marker for identifying macrophages in tissue sections. RA0576-C1 1 ml Status: RUO Major Vault Protein (MVP); Clone 1014 Catalog Number Volume (Concentrate) RA0289-C.1 0.1 ml Species: Mouse RA0289-C.5 0.5 ml Immunogen: Proteins precipitated from human breast cancer MCF-7 cells MAGE-1 (Target for Cancer Immunotherapy); Clone: 1014 Clone MA454 (Concentrate) Isotype: IgG1, kappa Species: Mouse Species Reac vity: Human. Others not tested. Immunogen: Human MAGE-A1 full length recombinant protein Posi ve Control: MCF-7/HeLa cells, breast tumors. Clone: MA454 Specificity: Recognizes a protein of 104kDa-110kDa, Isotype: IgG1, kappa characterized as major vault protein (MVP). Species Reac vity: Human, Rat and Dog. Others not known. Status: RUO Posi ve Control: Melanoma cell lines. Melanomas, gliomas, Catalog Number Volume neuroblastoma, non-small cell lung cancer, breast, gastric, RA0349-C.1 0.1 ml colorectal, ovarian, and renal cell carcinomas. Specificity: Recognizes a protein of 42-46kDa, iden fied as RA0349-C.5 0.5 ml MAGE-1. This antibody does not cross-react with MAGE-2, -3, - 4, -6 -9, -10, -or -12 proteins. Status: RUO Catalog Number Volume RA0201-C.1 0.1 ml RA0201-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
91 Antibodies
Major Vault Protein (MVP); Clone 1032 MART-1 / Melan-A / MLANA (Melanoma Marker); (Concentrate) Clone A103 (Concentrate) Species: Mouse Species: Mouse Immunogen: Proteins precipitated from human breast cancer Immunogen: Recombinant hMART-1 protein MCF-7 cells Clone: A103 Clone: 1032 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat and Dog. Others not Species Reac vity: Human. Others not tested. tested. Posi ve Control: MCF-7/HeLa cells, breast tumors. Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Specificity: Recognizes a protein of 104kDa-110kDa, lines, Melanomas. characterized as major vault protein (MVP). Specificity: This monoclonal an body recognizes a protein Status: RUO doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen Catalog Number Volume Recognized by T-cells 1) or Melan-A. This antibody labels melanomas and other tumors showing melanocytic RA0350-C.1 0.1 ml differentiation. It is also a useful positive-marker for RA0350-C.5 0.5 ml angiomyolipomas. It does not stain tumor cells of epithelial, lymphoid, glial, or mesenchymal origin. MALT1 (MALT-Lymphoma Marker); Clone Status: RUO MT1/410 (Concentrate) Catalog Number Volume Species: Mouse RA0114-C.1 0.1 ml Immunogen: Human MALT1 recombinant fragment (aa 701- RA0114-C.5 0.5 ml 808) Clone: MT1/410 RA0114-C1 1 ml
Isotype: IgG1, kappa MART-1 / Melan-A / MLANA (Melanoma Marker); Species Reac vity: Human. Others not known. Posi ve Control: Jurkat, Daudi, or HeLa cells. Tonsil or Clone A103, M2-7C10 & M2-9E3 (Concentrate) lymphoma. Species: Mouse Specificity: Highly expressed in peripheral blood mononuclear Immunogen: Recombinant hMART-1 protein (A103; M2-7C10; cells. Detected at lower levels in bone marrow, thymus and M2-9E3) lymph node, and at very low levels in colon and lung. Clone: A103, M2-7C10 & M2-9E3 Status: RUO Isotype: IgG1 (A103); IgG2b (M2-7C10 & M2-9E3) Catalog Number Volume Species Reac vity: Human, Mouse, Rat and Dog. Others not tested. RA0352-C.1 0.1 ml Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell RA0352-C.5 0.5 ml lines, Melanomas. Specificity: This monoclonal an body recognizes a protein MALT1 (MALT-Lymphoma Marker); Clone SPM578 doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen (Concentrate) Recognized by T-cells 1) or Melan-A. This antibody labels Species: Mouse melanomas and other tumors showing melanocytic Immunogen: Human MALT1 recombinant fragment (aa701-808). differentiation. It is also a useful positive-marker for Clone: SPM578 angiomyolipomas. It does not stain tumor cells of epithelial, Isotype: IgG1, kappa lymphoid, glial, or mesenchymal origin. Species Reactivity: Reacts with human. Others not known. Status: RUO Positive Control: Jurkat, Daudi, or HeLa cells. Lymphoma. Catalog Number Volume Specificity: Recognizes the 93kDa protein, MALT1 (aa701-808). RA0115-C.1 0.1 ml Status: RUO RA0115-C.5 0.5 ml Catalog Number Volume RA0509-C.1 0.1 ml RA0509-C.5 0.5 ml RA0509-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
92 Antibodies
MART-1 / Melan-A / MLANA (Melanoma Marker); MART-1 / Melan-A / MLANA (Melanoma Marker); Clone DT101 & BC199 (Concentrate) Clone M2-7C10 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant hMART-1 protein (DT101 & BC199) Immunogen: Recombinant hMART-1 protein Clone: DT101 & BC199 Clone: M2-7C10 Isotype: IgG2b, kappa (DT101 & BC199) Isotype: IgG2b, kappa Species Reac vity: Human. Others not tested. Species Reac vity: Human. Does not react with Mouse and Rat. Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Others not tested. lines, Melanomas. Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Specificity: This monoclonal an body recognizes a protein lines, Melanomas. doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen Specificity: This monoclonal an body recognizes a protein Recognized by T-cells 1) or Melan-A. This antibody labels doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen melanomas and other tumors showing melanocytic Recognized by T-cells 1) or Melan-A. This antibody labels differentiation. It is also a useful positive-marker for melanomas and other tumors showing melanocytic angiomyolipomas. It does not stain tumor cells of epithelial, differentiation. It is also a useful positive-marker for lymphoid, glial, or mesenchymal origin. angiomyolipomas. It does not stain tumor cells of epithelial, Status: RUO lymphoid, glial, or mesenchymal origin. Catalog Number Volume Status: RUO RA0117-C.1 0.1 ml Catalog Number Volume RA0117-C.5 0.5 ml RA0112-C.1 0.1 ml RA0112-C.5 0.5 ml MART-1 / Melan-A / MLANA (Melanoma Marker); Clone M2-7C10 & M2-9E3 (Concentrate) MART-1 / Melan-A / MLANA (Melanoma Marker); Species: Mouse Clone M2-9E3 (Concentrate) Immunogen: Recombinant hMART-1 protein (M2-7C10; M2- Species: Mouse 9E3) Immunogen: Recombinant hMART-1 protein Clone: M2-7C10 & M2-9E3 Clone: M2-9E3 Isotype: IgG2b, kappa (M2-7C10 & M2-9E3) Isotype: IgG2b, kappa Species Reac vity: Human, Mouse and Rat. Others not tested. Species Reac vity: Human, Mouse and Rat. Others not tested. Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell lines, Melanomas. lines, Melanomas. Specificity: This monoclonal an body recognizes a protein Specificity: This monoclonal an body recognizes a protein doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen Recognized by T-cells 1) or Melan-A. This antibody labels Recognized by T-cells 1) or Melan-A. This antibody labels melanomas and other tumors showing melanocytic melanomas and other tumors showing melanocytic differentiation. It is also a useful positive-marker for differentiation. It is also a useful positive-marker for angiomyolipomas. It does not stain tumor cells of epithelial, angiomyolipomas. It does not stain tumor cells of epithelial, lymphoid, glial, or mesenchymal origin. lymphoid, glial, or mesenchymal origin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0116-C.1 0.1 ml RA0113-C.1 0.1 ml RA0116-C.5 0.5 ml RA0113-C.5 0.5 ml RA0116-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
93 Antibodies
MART-1 / Melan-A / MLANA (Melanoma Marker); MCAM (Melanoma Cell Adhesion) / MUC18 / Clone MLANA/788 (Concentrate) CD146; Clone C146/634 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human MLANA protein Immunogen: Recombinant human MCAM protein Clone: MLANA/788 Clone: C146/634 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat and Dog. Others not Species Reactivity: Human. Others not known. tested. Positive Control: A-375, HUVEC, or HeLa Cells. Tonsil or Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Melanoma. lines, Melanomas. Specificity: This antibody recognizes a 130kDa protein known as Specificity: This monoclonal an body recognizes a protein the Melanoma Cell Adhesion Molecule. doublet of 20-22kDa, identified as MART-1 (Melanoma Antigen Status: RUO Recognized by T-cells 1) or Melan-A. This antibody labels Catalog Number Volume melanomas and other tumors showing melanocytic differentiation. It is also a useful positive-marker for RA0443-C.1 0.1 ml angiomyolipomas. It does not stain tumor cells of epithelial, RA0443-C.5 0.5 ml lymphoid, glial, or mesenchymal origin. RA0443-C1 1 ml Status: RUO Melanoma Marker (MART-1 & gp100); Clone Catalog Number Volume DT101, BC199, & HMB45 (Concentrate) RA0118-C.1 0.1 ml Species: Mouse RA0118-C.5 0.5 ml Immunogen: Recombinant hMART-1 protein (DT101 & BC199); MCAM (Melanoma Cell Adhesion Molecule) / Extract of pigmented melanoma metastases from lymph nodes (HMB45). MUC18 / CD146; Clone MCAM/1101 (Concentrate) Clone: DT101, BC199, & HMB45 Species: Mouse Isotype: IgG2b (DT101 & BC199); IgG1 (HMB45). Immunogen: Recombinant human MCAM protein Species Reac vity: Human. Others not tested. Clone: MCAM/1101 Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Isotype: IgG1, kappa lines. Melanomas. Species Reactivity: Human. Others not known. Specificity: This an body cocktail recognizes two melanoma- Positive Control: A-375, HUVEC, or HeLa Cells. Tonsil or specific proteins which include MART-1 and gp100. Melanoma. Status: RUO Specificity: This an body recognizes a 130kDa protein known as Catalog Number Volume the Melanoma Cell Adhesion Molecule. Status: RUO RA0413-C.1 0.1 ml RA0413-C.5 0.5 ml Catalog Number Volume RA0442-C.1 0.1 ml Melanoma Marker (MART-1, Tyrosinase, & gp100); RA0442-C.5 0.5 ml Clone A103, T311, & HMB45 (Concentrate) RA0442-C1 1 ml Species: Mouse MCAM (Melanoma Cell Adhesion Molecule) / Immunogen: Recombinant hMART-1 protein (A103); Recombinant tyrosinase protein (T311); Extract of pigmented MUC18 / CD146; Clone MUC18/1130 (Concentrate) melanoma metastases from lymph nodes (HMB45). Species: Mouse Clone: A103, T311, & HMB45 Immunogen: Recombinant human MCAM protein Isotype: IgG1 (A103); IgG2a (T311); IgG1 (HMB45). Clone: MUC18/1130 Species Reac vity: Human. Others not tested. Isotype: IgG1, kappa Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Species Reactivity: Human. Others not known. lines. Melanomas. Positive Control: A-375, HUVEC, or HeLa Cells. Tonsil or Specificity: This an body cocktail recognizes three melanoma- Melanoma. specific proteins which include MART-1, Tyrosinase, and gp100. Specificity: This antibody recognizes a 130kDa protein known as Status: RUO the Melanoma Cell Adhesion Molecule. Catalog Number Volume Status: RUO RA0412-C.1 0.1 ml Catalog Number Volume RA0412-C.5 0.5 ml RA0444-C.1 0.1 ml RA0444-C.5 0.5 ml RA0444-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
94 Antibodies
Melanoma Marker (MART-1, Tyrosinase, & gp100); Microphthalmia Transcription Factor (MITF); Clone Clone DT101, BC199, T311, & HMB45 (Concentrate) D5 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant hMART-1 protein (DT101 & BC199); Immunogen: N-terminal fragment of human MITF protein Extract of pigmented melanoma metastases from lymph nodes Clone: D5 (HMB45); Recombinant tyrosinase protein (T311). Isotype: IgG1, kappa Clone: DT101, BC199, T311, & HMB45 Species Reac vity: Human. Does not react with Mouse and Isotype: IgG2b (DT101 & BC199); IgG1 (HMB45); IgG2a (T311). Rat. Others not tested. Species Reac vity: Human. Others not tested. Posi ve Control: Jurkat, A-431, HeLa or 501 Mel human Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell melanoma cells or Melanoma. lines. Melanomas. Specificity: An -MITF recognizes a nuclear protein, which is Specificity: This an body cocktail recognizes three melanoma- expressed in the majority of primary and metastatic epithelioid specific proteins which include MART-1, Tyrosinase, and gp100. malignant melanomas as well as in normal melanocytes, benign Status: RUO nevi, and dysplastic nevi. Catalog Number Volume Status: RUO RA0414-C.1 0.1 ml Catalog Number Volume RA0414-C.5 0.5 ml RA0207-C.1 0.1 ml RA0207-C.5 0.5 ml Melanoma Marker (MART-1, Tyrosinase, & gp100); Clone M2-7C10, M2-9E3, T311, & HMB45 Microphthalmia Transcription Factor (MITF); Clone (Concentrate) MITF/915 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant hMART-1 protein (M2-7C10; M2- Immunogen: Recombinant human MITF protein 9E3); Recombinant tyrosinase protein (T311); Extract of Clone: MITF/915 pigmented melanoma metastases from lymph nodes (HMB45). Isotype: IgG1, kappa Clone: M2-7C10, M2-9E3, T311, & HMB45 Species Reac vity: Human and Dog. Does not react with Mouse Isotype: IgG2b (M2-7C10 & M2-9E3); IgG2a (T311); IgG1 and Rat. Others not tested. (HMB45). Posi ve Control: Jurkat, A-431, HeLa or 501 Mel human Species Reac vity: Human. Others not tested. melanoma cells or Melanoma. Posi ve Control: SK-MEL-13 and SK-MEL-19 Melanoma cell Specificity: An -MITF recognizes a nuclear protein, which is lines. Melanomas. expressed in the majority of primary and metastatic epithelioid Specificity: This an body cocktail recognizes three melanoma- malignant melanomas as well as in normal melanocytes, benign specific proteins which include MART-1, Tyrosinase, and gp100. nevi, and dysplastic nevi. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0411-C.1 0.1 ml RA0208-C.1 0.1 ml RA0411-C.5 0.5 ml RA0208-C.5 0.5 ml Microphthalmia Transcription Factor (MITF); Clone Mitochondria (Marker for Human Cells); Clone AE- D5 & MITF/915 (Concentrate) 1 (Concentrate) Species: Mouse Species: Mouse Immunogen: N-terminal fragment of human MITF protein (D5); Immunogen: Semi-purified mitochondrial prepara on Recombinant human MITF protein (MITF/915) Clone: AE-1 Clone: D5 & MITF/915 Isotype: IgG1, kappa Isotype: IgG1, kappa (D5); IgG1, kappa (MITF/915) Species Reac vity: Human. Does not react with Mouse and Rat. Species Reac vity: Human. Does not react with Mouse and Rat. Others not known. Others not tested. Posi ve Control: HeLa or HepG2 cells. Hepa c carcinoma. Posi ve Control: Jurkat, A-431, HeLa or 501 Mel human Specificity: This an body recognizes a 60kDa an gen associated melanoma cells or Melanoma. with the mitochondria in human cells. Specificity: An -MITF recognizes a nuclear protein, which is Status: RUO expressed in the majority of primary and metastatic epithelioid Catalog Number Volume malignant melanomas as well as in normal melanocytes, benign RA0396-C.1 0.1 ml nevi, and dysplastic nevi. RA0396-C.5 0.5 ml Status: RUO Catalog Number Volume RA0210-C.1 0.1 ml RA0210-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
95 Antibodies
Mitochondria (Marker for Human Cells); Clone Mitochondrial Marker; Clone MTC754 MTC02 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Semi-purified mitochondrial prepara on Immunogen: Mitochondrial frac on of HeLa cells Clone: MTC02 Clone: MTC754 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Does not react with Mouse and Rat. Species Reac vity: Human. Shows broad species reac vity Others not known. including insects and bacteria. Posi ve Control: HeLa or HepG2 cells. Hepa c carcinoma. Posi ve Control: HeLa or HepG2 cells. Hepa c carcinomas. Specificity: This an body recognizes a 60kDa an gen associated Specificity: This an body recognizes a 60kDa an gen associated with the mitochondria in human cells. with the mitochondria in cells. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0393-C.1 0.1 ml RA0395-C.1 0.1 ml RA0393-C.5 0.5 ml RA0395-C.5 0.5 ml Mitochondria (Marker for Human Cells, Granular Moesin; Clone MSN491 (Concentrate) RCC's & Salivary Tumors); Clone 113-1 Species: Mouse (Concentrate) Immunogen: Recombinant human moesin protein
Species: Mouse Clone: MSN491
Immunogen: Semi-purified mitochondrial prepara on Isotype: IgG1, kappa
Clone: 113-1 Species Reac vity: Human. Others not known.
Isotype: IgG1, kappa Posi ve Control: HT-29, CH3LC, or HUVEC cells. Uterus, Species Reac vity: Human. Does not react with Mouse and Rat. placenta, tonsil (both B- and T-lymphocytes), skeletal muscle, Others not known. thyroid, or kidney.
Posi ve Control: HeLa or HepG2 cells. Hepa c carcinoma. Specificity: This an body recognizes the 78kDa moesin protein. Specificity: This an body recognizes a 60kDa an gen associated Status: RUO with the mitochondria in human cells. It can be used to stain Catalog Number Volume mitochondria in cell or tissue preparations and can be used as a RA0211-C.1 0.1 ml mitochondrial marker in subcellular fractions. RA0211-C.5 0.5 ml Status: RUO Catalog Number Volume MUC1 / EMA / CD227 (Epithelial Marker); Clone RA0392-C.1 0.1 ml 139H2 (Concentrate) RA0392-C.5 0.5 ml Species: Mouse Immunogen: Human milk-fat globule membranes Mitochondrial Marker; Clone MTC719 Clone: 139H2 (Concentrate) Isotype: IgG1, kappa
Species: Mouse Species Reac vity: Human and Mouse. Others not known.
Immunogen: Mitochondrial frac on of HeLa cells Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon Clone: MTC719 carcinoma.
Isotype: IgG1, kappa Specificity: 139H2 reacts with MUC1, a large transmembrane Species Reac vity: Human. Shows broad species reac vity. glycoprotein expressed on the ductal surface of normal glandular Does not react with insects or bacteria. epithelia. The dominant epitope of 139H2 has not yet been Posi ve Control: HeLa or HepG2 cells. Hepa c carcinomas. determined. In immunohistochemical assays, it superbly stains Specificity: This an body recognizes a 60kDa an gen associated routine formalin/paraffin carcinoma tissues. An antibody to with the mitochondria in cells. MUC1 is useful as a pan-epithelial marker for detecting early Status: RUO metastatic loci of carcinoma in bone marrow or liver. Status: RUO Catalog Number Volume Catalog Number Volume RA0394-C.1 0.1 ml RA0217-C.1 0.1 ml RA0394-C.5 0.5 ml RA0217-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
96 Antibodies
MUC1 / EMA / CD227 (Epithelial Marker); Clone MUC1 / EMA / CD227 (Epithelial Marker); Clone E29 (Concentrate) GP1.4 (Concentrate) Species: Mouse Species: Mouse Immunogen: Delipidated extract of human milk fat globule Immunogen: Human milk fat globule membranes membranes Clone: GP1.4 Clone: E29 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Reacts moderately with Pig and Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon Dog. Others not known. carcinoma. Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon Specificity: In Western blo ng, this an body recognizes carcinoma. proteins in a MW range of 265-400kDa, identified as different Specificity: In Western blo ng, this an body recognizes glycoforms of MUC1. This antibody reacts with the DTRP epitope proteins in a MW range of 265-400kDa, identified as different within the tandem repeats. In immunohistochemical assays, it glycoforms of MUC1. This antibody reacts with the DTRP epitope superbly stains routine formalin/paraffin carcinoma tissues. An within the tandem repeats. In immunohistochemical assays, it antibody to MUC1 is useful as a pan-epithelial marker for superbly stains routine formalin/paraffin carcinoma tissues. An detecting early metastatic loci of carcinoma in bone marrow or antibody to MUC1 is useful as a pan-epithelial marker for liver. detecting early metastatic loci of carcinoma in bone marrow or Status: RUO liver. Catalog Number Volume Status: RUO RA0212-C.1 0.1 ml Catalog Number Volume RA0212-C.5 0.5 ml RA0214-C.1 0.1 ml RA0214-C.5 0.5 ml MUC1 / EMA / CD227 (Epithelial Marker); Clone HMPV (Concentrate) MUC1 / EMA / CD227 (Epithelial Marker); Clone Species: Mouse GP1.4 & E29 (Concentrate) Immunogen: Human breast cancer cell line ZR-75 cells Species: Mouse Clone: HMPV Immunogen: Human milk fat globule membranes (GP1.4); Isotype: IgM, kappa Delipidated extract of human milk fat globule membranes (E29). Species Reac vity: Human. Others not known. Clone: GP1.4 & E29 Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon Isotype: IgG1, kappa (GP1.4); IgG2a, kappa (E29) carcinoma. Species Reac vity: Human. Reacts moderately with Pig and Specificity: HMPV recognizes full-length MUC1 in a Dog. Others not known. glycosylation-independent manner and can bind to the fully Posi ve Control: Breast or colon carcinoma. glycosylated protein. The dominant epitope of HMPV is APDTR in Specificity: In Western blo ng, this an body recognizes the VNTR region. It reacts with the core peptide of the MUC1 proteins in a MW range of 265-400kDa, identified as different protein. This antibody has been shown to react with both normal glycoforms of MUC1. This antibody reacts with the DTRP epitope and malignant epithelia of various tissues including breast and within the tandem repeats. In immunohistochemical assays, it colon. superbly stains routine formalin/paraffin carcinoma tissues. An Status: RUO antibody to MUC1 is useful as a pan-epithelial marker for Catalog Number Volume detecting early metastatic loci of carcinoma in bone marrow or liver. RA0218-C.1 0.1 ml Status: RUO RA0218-C.5 0.5 ml Catalog Number Volume RA0215-C.1 0.1 ml RA0215-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
97 Antibodies
MUC1 / EMA / CD227 (Epithelial Marker); Clone MUC5AC (Mucin 5AC / Gastric Mucin); Clone 45M1 PEM/845 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human MUC1 protein Immunogen: M1 mucin prepara on from the fluid of an Clone: PEM/845 ovarian mucinous cyst belonging to an O Le(a-b) patient. Isotype: IgG1, kappa Clone: 45M1 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon Posi ve Control:Stomach carcinoma. Cellular Localiza on:Cytoplasmic Specificity: In Western blo ng, this an body recognizes Specificity: This an body recognizes the pep de core of gastric proteins in a MW range of 265-400kDa, identified as different mucin M1 (>1,000kDa) (recently identified as Mucin 5AC). Its glycoforms of MUC1. This antibody reacts with the DTRP epitope epitope is destroyed by beta-mercaptoethanol and proteases, within the tandem repeats. In immunohistochemical assays, it but not by periodate treatment. This antibody to gastric mucin superbly stains routine formalin/paraffin carcinoma tissues. An M1 reacts with the gastric epithelium of normal human antibody to MUC1 is useful as a pan-epithelial marker for gastrointestinal tract as well as with the precancerous and detecting early metastatic loci of carcinoma in bone marrow or cancerous colon, but it does not react with normal adult colon. It liver. also reacts with fetal colonic mucosa. Resurgence of gastric Status: RUO mucin reactivity during colonic carcinogenesis is due to re- Catalog Number Volume expression of the peptide core of gastric (or fetal colonic) mucins. Status: RUO RA0216-C.1 0.1 ml RA0216-C.5 0.5 ml Catalog Number Volume RA0221-C.1 0.1 ml MUC2 (Mucin 2); Clone CCP58 (Concentrate) RA0221-C.5 0.5 ml Species: Mouse Immunogen: A synthe c pep de of 29 amino acids, MUC5AC (Mucin 5AC / Gastric Mucin); Clone CLH2 KYPTTTPISTTTMVTPTPTPTGTQTPTTT from MUC2 protein, (Concentrate) coupled to KLH. Species: Mouse Clone: CCP58 Immunogen: A synthe c pep de of human MUC5AC tandem Isotype: IgG1, kappa repeat. Species Reac vity: Human. Others not known. Clone: CLH2 Posi ve Control: LS174T cells or small intes ne. Isotype: IgG1, kappa Specificity: Recognizes a single glycoprotein of 520kDa, Species Reac vity: Human. Others not known. identified as mucin 2 (MUC2). This antibody shows no cross- Posi ve Control: Stomach reaction with human milk fat globule membranes, MUC1, or Specificity: Together with a panel of an bodies, an -MUC5AC MUC3. may be useful for differential identification of primary mucinous Status: RUO ovarian tumors from colon adenocarcinoma metastatic to the Catalog Number Volume ovary. MUC5AC antibodies may also be useful for identification of intestinal metaplasia as well as in the identification of RA0219-C.1 0.1 ml pancreatic carcinoma and pre-cancerous changes vs. normal RA0219-C.5 0.5 ml pancreas. MUC2 (Mucin 2); Clone MLP/842 (Concentrate) Status: RUO Catalog Number Volume Species: Mouse Immunogen: Recombinant human MUC2 protein RA0222-C.1 0.1 ml Clone: MLP/842 RA0222-C.5 0.5 ml Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Posi ve Control: LS174T cells or small intes ne. Specificity: Recognizes a single glycoprotein of 520kDa, identified as mucin 2 (MUC2). This antibody shows no cross- reaction with human milk fat globule membranes, MUC1, or MUC3. Status: RUO Catalog Number Volume RA0220-C.1 0.1 ml RA0220-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
98 Antibodies
MUC5AC (Mucin 5AC / Gastric Mucin); Clone Myeloid Cell Marker (Macrophage / Granulocyte MUC5AC/917 (Concentrate) Marker); Clone BM-1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human MUC5AC protein Immunogen: Human peripheral blood mononuclear cells Clone: MUC5AC/917 Clone: BM-1 Isotype: IgG1, kappa Isotype: IgG1 Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Stomach Posi ve Control: HL60 cells. Bone marrow, lymph node or Specificity: Together with a panel of an bodies, an -MUC5AC tonsil. may be useful for differential identification of primary mucinous Specificity: Recognizes a 183kDa protein with DNA-binding ovarian tumors from colon adenocarcinoma metastatic to the characteristics, which is identified as a myeloid specific antigen. ovary. MUC5AC antibodies may also be useful for identification Clone BM-1 reacts with myeloid precursor cells and granulocytes of intestinal metaplasia as well as in the identification of in bone marrow. Its antigen appears to be restricted to M2 and pancreatic carcinoma and pre-cancerous changes vs. normal M3 acute myelogenous leukemia (AML) subtypes. pancreas. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0400-C.1 0.1 ml RA0223-C.1 0.1 ml RA0400-C.5 0.5 ml RA0223-C.5 0.5 ml Myeloid-Associated Differentiation Marker MUC6 (Mucin 6 / Gastric Mucin); Clone CLH5 (MYADM); Clone BM-2 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Nuclei from pokeweed mitogen s mulated Immunogen: A synthe c pep de of the Gastric Mucin 6 human peripheral blood lymphocytes tandem repeat sequence Clone: BM-2 Clone: CLH5 Isotype: IgG1 Isotype: IgG1, kappa Species Reac vity: Human and Macaque Monkey. Others not Species Reac vity: Human. Others not known. known. Posi ve Control: Stomach Posi ve Control: HL60 cells. Tonsil or lymph node. Specificity: Mucin 6 expression is highest in the stomach and Specificity: Recognizes a myeloid associated differen a on gall bladder, with lower expression in the terminal ileum and antigen in the cytoplasm of mature granulocytes. It shows no right colon. In gastric cancer, Mucin 6 has an altered expression. reactivity with any other cell type in human tissues. In normal stomach, Mucin 6 is associated with Lewis type 2 Status: RUO antigens; Mucin 6 is also expressed in gastric metaplasia, Catalog Number Volume duodenum, and pancreas. Mucin 6 is a secretory mucin, located in the deeper mucosal folds of human gall bladder, and its RA0366-C.1 0.1 ml expression is altered with increasing degrees of inflammation. RA0366-C.5 0.5 ml Status: RUO Myeloid-Associated Differentiation Marker Catalog Number Volume (MYADM); Clone MYADM/971 (Concentrate) RA0224-C.1 0.1 ml Species: Mouse RA0224-C.5 0.5 ml Immunogen: Recombinant human MYADM protein MUC6 (Mucin 6 / Gastric Mucin); Clone MUC6/916 Clone: MYADM/971 Isotype: IgG1 (Concentrate) Species Reactivity: Human and Macaque Monkey. Others not Species: Mouse known. Immunogen: Recombinant human MUC6 protein Positive Control: HL60 cells. Tonsil or lymph node. Clone: MUC6/916 Specificity: This antibody recognizes a myeloid associated Isotype: IgG1, kappa differentiation antigen in the cytoplasm of mature granulocytes. Species Reac vity: Human. Others not known. It shows no reactivity with any other cell type in human tissues. Posi ve Control: Stomach Status: RUO Specificity: Mucin 6 expression is highest in the stomach and Catalog Number Volume gall bladder, with lower expression in the terminal ileum and right colon. In gastric cancer, Mucin 6 has an altered expression. RA0455-C.1 0.1 ml In normal stomach, Mucin 6 is associated with Lewis type 2 RA0455-C.5 0.5 ml antigens; Mucin 6 is also expressed in gastric metaplasia, RA0455-C1 1 ml duodenum, and pancreas. Mucin 6 is a secretory mucin, located in the deeper mucosal folds of human gall bladder, and its expression is altered with increasing degrees of inflammation. Status: RUO Catalog Number Volume RA0225-C.1 0.1 ml RA0225-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
99 Antibodies
Myeloid-Associated Differentiation Marker MyoD1 (Rhabdomyosarcoma Marker); Clone (MYADM); Clone MYADM/972 (Concentrate) MYD712 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human MYADM protein Immunogen: Recombinant human MyoD1 protein Clone: MYADM/972 Clone: MYD712 Isotype: IgG1 Isotype: IgG1, kappa Species Reactivity: Human and Macaque Monkey. Others not Species Reac vity: Human. Others not known. known. Posi ve Control: Rhabdomyosarcoma Positive Control: HL60 cells. Tonsil or lymph node. Specificity: Recognizes a phosphor-protein of 45kDa, iden fied Specificity: This antibody recognizes a myeloid associated as MyoD1. It does not cross react with myogenin, Myf5, or Myf6. differentiation antigen in the cytoplasm of mature granulocytes. This antibody to MyoD1 labels the nuclei of myoblasts in It shows no reactivity with any other cell type in human tissues. developing muscle tissues. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0456-C.1 0.1 ml RA0232-C.1 0.1 ml RA0456-C.5 0.5 ml RA0232-C.5 0.5 ml RA0456-C1 1 ml Myogenin (Skeletal Muscle Marker); Clone F5D MyoD1 (Rhabdomyosarcoma Marker); Clone 5.8A (Concentrate) & MYD712 (Concentrate) Species: Mouse Species: Mouse Immunogen: Rat myogenin pep de (aa 73-94) followed by rat Immunogen: Recombinant mouse MyoD1 protein (5.8A); myogenin recombinant fragment (aa 30-224) (Epitope aa 138- Recombinant human MyoD1 protein (MYD712) 158) Clone: 5.8A & MYD712 Clone: F5D Isotype: IgG1, kappa (5.8A); IgG1, kappa (MYD712) Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat, and Chicken. Others Species Reac vity: Human, Mouse, Rat, Dog, Cat, and Pig. not known. Others not known. Posi ve Control: Rhabdomyosarcoma Posi ve Control: Rh-30 cells. Skeletal muscle or Specificity: Recognizes a phosphor-protein of 45kDa, iden fied rhabdomyosarcoma. as MyoD1. It does not cross react with myogenin, Myf5, or Myf6. Specificity: An -myogenin labels the nuclei of myoblasts in This antibody to MyoD1 labels the nuclei of myoblasts in developing muscle tissue, and is expressed in tumor cell nuclei of developing muscle tissues. rhabdomyosarcoma and some leiomyosarcomas. Positive Status: RUO nuclear staining may occur in Wilms' tumor. Status: RUO Catalog Number Volume RA0233-C.1 0.1 ml Catalog Number Volume RA0233-C.5 0.5 ml RA0235-C.1 0.1 ml RA0235-C.5 0.5 ml MyoD1 (Rhabdomyosarcoma Marker); Clone 5.8A (Concentrate) Myogenin (Skeletal Muscle Marker); Clone Species: Mouse MGN185 & F5D (Concentrate) Immunogen: Recombinant mouse MyoD1 protein Species: Mouse Clone: 5.8A Immunogen: Human myogenin recombinant protein Isotype: IgG1, kappa (MGN185); Rat myogenin recombinant fragment containing Species Reac vity: Human, Mouse, Rat, and Chicken. Others amino acid 30-224 (F5D) not known. Clone: MGN185 & F5D Posi ve Control: Rhabdomyosarcoma Isotype: IgG1, kappa Specificity: Recognizes a phosphor-protein of 45kDa, iden fied Species Reac vity: Human, Mouse, Rat, Cat, and Pig. Others as MyoD1. The epitope of this antibody maps between amino not known. acids 180-189 in the C-terminal region of the mouse MyoD1 Posi ve Control: Rh-30 cells. Skeletal muscle or protein. It does not cross react with myogenin, Myf5, or Myf6. rhabdomyosarcoma. This antibody to MyoD1 labels the nuclei of myoblasts in Specificity: An -myogenin labels the nuclei of myoblasts in developing muscle tissues. developing muscle tissue, and is expressed in tumor cell nuclei of Status: RUO rhabdomyosarcoma and some leiomyosarcomas. Positive nuclear staining may occur in Wilms' tumor. Catalog Number Volume Status: RUO RA0231-C.1 0.1 ml Catalog Number Volume RA0231-C.5 0.5 ml RA0236-C.1 0.1 ml RA0236-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
100 Antibodies
Myogenin (Skeletal Muscle Marker); Clone N-Cadherin / Cadherin-2 / CD325 (NCAD); Clone MGN185 (Concentrate) 8C11 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human myogenin recombinant protein Immunogen: Recombinant human N-cadherin cytoplasmic Clone: MGN185 domain (exact sequence is proprietary) Isotype: IgG1, kappa Clone: 8C11 Species Reac vity: Human, Mouse, Rat, Cat and Pig. Others not Isotype: Mouse / IgG1, kappa known. Species Reactivity: Human and Mouse. Others not known. Posi ve Control: Rh-30 cells. Skeletal muscle or Positive Control: HeLa or HUVEC cells. Heart, Pancreas or rhabdomyosarcoma. Cerebral Cortex Specificity: An -myogenin labels the nuclei of myoblasts in Specificity: Recognizes a protein of ~140kDa, identified as N- developing muscle tissue, and is expressed in tumor cell nuclei of Cadherin (NCAD), also known as CD325. rhabdomyosarcoma and some leiomyosarcomas. Positive Status: RUO nuclear staining may occur in Wilms' tumor. Catalog Number Volume Status: RUO RA0464-C.1 0.1 ml Catalog Number Volume RA0464-C.5 0.5 ml RA0234-C.1 0.1 ml RA0464-C1 1 ml RA0234-C.5 0.5 ml N-Cadherin / Cadherin-2 / CD325 (NCAD); Clone Napsin A (Lung Adenocarcinoma Marker); Clones CDH2/1573 (Concentrate) NAPSA/1238 & NAPSA/1239 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human N-cadherin cytoplasmic Immunogen: Recombinant human Napsin-A protein fragment domain (exact sequence is proprietary) (aa 189-299). Exact sequence is proprietary. Clone: CDH2/1573 Clones: NAPSA/1238 & NAPSA/1239 Isotype: Mouse / IgG1, kappa Isotype: IgG1, Kappa Species Reactivity: Human and Mouse. Others not known. Species Reactivity: Human. Others not tested. Positive Control: HeLa or HUVEC cells. Heart, Pancreas or Positive Control: Lung adenocarcinoma. Cerebral Cortex Specificity: This antibody is specific for a pepsin-like aspartic Specificity: Recognizes a protein of ~140kDa, identified as N- proteinase identified as Napsin A. Cadherin (NCAD), also known as CD325. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0479-C.1 0.1 ml RA0465-C.1 0.1 ml RA0479-C.5 0.5 ml RA0465-C.5 0.5 ml RA0479-C1 1 ml RA0465-C1 1 ml N-Cadherin / Cadherin-2 / CD325 (NCAD); Clone Neurofilament (H & L) (Neuronal Marker); Clone 13A9 (Concentrate) NF421 & NFL/736 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human N-cadherin cytoplasmic Immunogen: Recombinant human neurofilament heavy domain (exact sequence is proprietary) subunit (NF421) & light subunit (NFL/736). Clone: 13A9 Clone: NF421 & NFL/736 Isotype: IgG1, kappa Isotype: IgG1 NF421; IgG1 NFL/736 Species Reactivity: Human and Mouse. Others not known. Species Reac vity: Human, Mouse, Rat, Chicken, and Pig. Positive Control: HeLa or HUVEC cells. Heart, Pancreas or Others not known. Cerebral Cortex. Posi ve Control: Brain and Neuroblastoma. Status: RUO Specificity: This an body reacts with a 200kDa and 68kDa Catalog Number Volume protein, identified as heavy and light subunits of neurofilaments (NF-H & NF-L). RA0463-C.1 0.1 ml Status: RUO RA0463-C.5 0.5 ml RA0463-C1 1 ml Catalog Number Volume RA0408-C.1 0.1 ml RA0408-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
101 Antibodies
Neurofilament (H & L) (Neuronal Marker); Clone Neurofilament (NF-H) (Neuronal Marker); Clone RT97 & NR-4 (Concentrate) RT97 (Concentrate) Species: Mouse Species: Mouse Immunogen: Triton-X 100 insoluble protein frac on of rat brain Immunogen: Triton-X 100 insoluble protein frac on of rat brain (RT-97); Pig neurofilament light sub-unit (NR-4). Clone: RT97 Clone: RT97 & NR-4 Isotype: IgG1 Isotype: IgG1 (RT97); IgG1 (NR-4) Species Reac vity: Human, Mouse, Rat, Pig and Chicken. Species Reac vity: Human, Mouse, Rat, Chicken, and Pig. Others not known. Others not known. Posi ve Control: Brain, Neuroblastoma. Posi ve Control: Brain and Neuroblastoma. Specificity: This an body reacts with a 200kDa protein, Specificity: This an body reacts with a 200kDa and 68kDa identified as the heavy subunit of neurofilaments (NF-H). Anti- protein, identified as heavy and light subunits of neurofilaments neurofilament stains a number of neural, neuroendocrine, and (NF-H & NF-L). endocrine tumors. Neuromas, ganglioneuromas, gangliogliomas, Status: RUO ganglioneuroblastomas, and neuroblastomas stain positively for Catalog Number Volume anti-neurofilament. Neurofilaments are also present in paragangliomas as well as adrenal and extra-adrenal RA0407-C.1 0.1 ml pheochromocytomas. Carcinoids, neuroendocrine carcinomas of RA0407-C.5 0.5 ml the skin, and oat cell carcinomas of the lung also express neurofilament. Neurofilament (NF-H) (Neuronal Marker); Clone Status: RUO NF421 (Concentrate) Catalog Number Volume Species: Mouse RA0244-C.1 0.1 ml Immunogen: Recombinant human neurofilament protein RA0244-C.5 0.5 ml Clone: NF421 Isotype: IgG1 Neurofilament (NF-L) (Neuronal Marker); Clone Species Reac vity: Human, Mouse, Rat, Pig and Chicken. Others not known. NFL/736 (Concentrate) Posi ve Control: Brain, Neuroblastoma. Species: Mouse Specificity: This an body reacts with a 200kDa protein, Immunogen: Recombinant human NF-L protein identified as the heavy subunit of neurofilaments (NF-H). Anti- Clone: NFL/736 neurofilament stains a number of neural, neuroendocrine, and Isotype: IgG1 endocrine tumors. Neuromas, ganglioneuromas, gangliogliomas, Species Reac vity: Human, Rat, Pig, Cow and Chicken. Others ganglioneuroblastomas, and neuroblastomas stain positively for not known. anti-neurofilament. Neurofilaments are also present in Posi ve Control: Brain, Neuroblastoma. paragangliomas as well as adrenal and extra-adrenal Specificity: This an body reacts with a 68kDa protein, iden fied pheochromocytomas. Carcinoids, neuroendocrine carcinomas of as the light subunit of neurofilaments (NF-L). Anti-neurofilament the skin, and oat cell carcinomas of the lung also express stains a number of neural, neuroendocrine, and endocrine neurofilament. tumors. Neuromas, ganglioneuromas, gangliogliomas, Status: RUO ganglioneuroblastomas, and neuroblastomas stain positively for Catalog Number Volume anti-neurofilament. Neurofilaments are also present in paragangliomas as well as adrenal and extra-adrenal RA0243-C.1 0.1 ml pheochromocytomas. Carcinoids, neuroendocrine carcinomas of RA0243-C.5 0.5 ml the skin, and oat cell carcinomas of the lung also express neurofilament. Status: RUO Catalog Number Volume RA0246-C.1 0.1 ml RA0246-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
102 Antibodies
Neurofilament (NF-L) (Neuronal Marker); Clone NR- NGF-Receptor (p75) / CD271 (Soft Tissue Tumor 4 (Concentrate) Marker); Clone NGFR5 (Concentrate) Species: Mouse Species: Mouse Immunogen: Pig neurofilament, light sub-unit (NF-L) Immunogen: NGFR from A875 melanoma cells Clone: NR-4 Clone: NGFR5 Isotype: IgG1 Isotype: IgG1, kappa Species Reac vity: Human, Rat, Pig, Cow and Chicken. Others Species Reac vity: Human, Monkey, Baboon, Cat, Rabbit and not known. Ferret. Does not react with Mouse and Rat. Others not known. Posi ve Control: Brain, Neuroblastoma. Posi ve Control: Neuronal axons, Schwann cells, and perineural Specificity: This an body reacts with a 68kDa protein, iden fied cells of peripheral nerves, or tumors of nerve sheath as the light subunit of neurofilaments (NF-L). Anti-neurofilament differentiation, e.g. Schwannoma, Neurofibroma. Soma and stains a number of neural, neuroendocrine, and endocrine axons of sensory neurons, and ganglionic satellite cells. tumors. Neuromas, ganglioneuromas, gangliogliomas, Melanomas. ganglioneuroblastomas, and neuroblastomas stain positively for Specificity: Recognizes a glycoprotein of 75kDa, iden fied as anti-neurofilament. Neurofilaments are also present in the low affinity Nerve Growth Factor (NGF) Receptor (p75, NGFR) paragangliomas as well as adrenal and extra-adrenal or Neurotrophin Receptor (p75, NTR). Its epitope resides within pheochromocytomas. Carcinoids, neuroendocrine carcinomas of aa 1-160 of the extracellular domain of NGFR/NTR. the skin, and oat cell carcinomas of the lung also express Status: RUO neurofilament. Catalog Number Volume Status: RUO RA0247-C.1 0.1 ml Catalog Number Volume RA0247-C.5 0.5 ml RA0245-C.1 0.1 ml RA0245-C.5 0.5 ml NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Marker); Clone NTR/912 (Concentrate) NGF-Receptor (p75) / CD271 (Soft Tissue Tumor Species: Mouse Marker); Clone NGFR5 & NTR/912 (Concentrate) Immunogen: Recombinant human p75 NGFR protein Species: Mouse Clone: NTR/912 Immunogen: Recombinant human p75 NGFR protein Isotype: IgG1, kappa Clone: NGFR5 & NTR/912 Species Reac vity: Human and Non-human Primates. Does not Isotype: IgG1, kappa (NGFR5); IgG1, kappa (NTR/912) react with Mouse and Rat. Others not known. Species Reac vity: Human and Non-human Primates. Does not Posi ve Control: Neuronal axons, Schwann cells, and perineural react with Mouse and Rat. Others not known. cells of peripheral nerves, or tumors of nerve sheath Posi ve Control: Neuronal axons, Schwann cells, and perineural differentiation, e.g. Schwannoma, Neurofibroma. Soma and cells of peripheral nerves, or tumors of nerve sheath axons of sensory neurons, and ganglionic satellite cells. differentiation, e.g. Schwannoma, Neurofibroma. Soma and Melanomas. axons of sensory neurons, and ganglionic satellite cells. Specificity: Recognizes a glycoprotein of 75kDa, iden fied as Melanomas. low affinity Nerve Growth Factor (NGF) Receptor (p75, NGFR) or Specificity: Recognizes a glycoprotein of 75kDa, iden fied as Neurotrophin Receptor (p75, NTR). Reportedly, anti-NGFR is a low affinity Nerve Growth Factor (NGF) Receptor (p75, NGFR) or reliable marker for desmoplastic and neurotropic melanomas. Neurotrophin Receptor (p75, NTR). Reportedly, anti-NGFR is a Anti-NGFR stains the myoepithelial cells of breast ducts and intra- reliable marker for desmoplastic and neurotropic melanomas. lobular fibroblasts of breast ducts. Anti-NGFR stains the myoepithelial cells of breast ducts and intra- Status: RUO lobular fibroblasts of breast ducts. Catalog Number Volume Status: RUO RA0248-C.1 0.1 ml Catalog Number Volume RA0248-C.5 0.5 ml RA0249-C.1 0.1 ml RA0249-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
103 Antibodies
NKX2.2 (Neuroendocrine & Ewing Sarcoma Nuclear Membrane Marker; Clone NM97 Marker); Clone NX2/294 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human NKX2.2 protein Immunogen: Nuclei of myeloid leukemia biopsy cells Clone: NX2/294 Clone: NM97 Isotype: IgG2b, kappa Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat and Chicken. Others not Species Reac vity: Human. Others not known. known. Posi ve Control: Human cell lines or tonsil. Posi ve Control: Pancreas or Ewing sarcoma. Specificity: Clone NM97 recognizes an an gen associated with Specificity: The NKX2.2 protein was iden fied as a target of the nuclear membrane expressed in human cells. It can be used EWS-FLI-1, the fusion protein specific to Ewing sarcoma, and was to stain the nuclear membrane in cell or tissue preparations and shown to be differentially upregulated in Ewing sarcoma on the can be used as a marker of the nuclear membrane in subcellular basis of array-based gene expression analysis. It acts as a fractions. valuable marker for Ewing sarcoma, with a sensitivity of 93% and Status: RUO a specificity of 89%, and aids in the differential diagnosis of small Catalog Number Volume round cell tumors. Status: RUO RA0401-C.1 0.1 ml RA0401-C.5 0.5 ml Catalog Number Volume RA0250-C.1 0.1 ml Nuclear Mitotic Apparatus Protein (NuMA); Clone RA0250-C.5 0.5 ml A73-B/D12 (Concentrate) NSE gamma (Neuron Specific Enolase, gamma) Species: Mouse Immunogen: Colon carcinoma 174T cells (Neuroendocrine Marker); Clone ENO2/1462 Clone: A73-B/D12 (Concentrate) Isotype: IgM, kappa Species: Mouse Species Reac vity: Human. Others not known. Immunogen: A synthetic peptide corresponding to aa416-433 of Posi ve Control: Exponen ally growing any cultured human human NSE gamma (exact sequence is proprietary) cells. Tonsil or lymph node. Clone: ENO2/1462 Specificity: Recognizes a phosphorylated protein of 228kDa, Isotype: Mouse / IgG2b identified as nuclear mitotic apparatus protein (NuMA). Its Species Reactivity: Human. Others not known. epitope is resistant to phosphatases. Positive Control: HepG2, SH-SY-5Y, HeLa or Y79 cells. Pancreas, Status: RUO Cerebellum or Pheochromocytoma. Catalog Number Volume Specificity: Recognizes a protein of about 50kDa, which is RA0251-C.1 0.1 ml identified as gamma-enolase. RA0251-C.5 0.5 ml Status: RUO Catalog Number Volume Nucleoli Marker; Clone NM95 (Concentrate) RA0462-C.1 0.1 ml Species: Mouse RA0462-C.5 0.5 ml Immunogen: Nuclei of myeloid leukemia biopsy cells RA0462-C1 1 ml Clone: NM95 Isotype: IgG1, kappa Nuclear Membrane Marker; Clone AE-5 Species Reac vity: Human. Others not known. (Concentrate) Posi ve Control: Tonsil Specificity: Clone NM95 recognizes an an gen associated with Species: Mouse the nucleoli in human cells. It can be used to stain the nucleoli in Immunogen: Nuclei of myeloid leukemia biopsy cells cell or tissue preparations and can be used as a marker of the Clone: AE-5 nucleoli in subcellular fractions. Isotype: IgG1, kappa Status: RUO Species Reac vity: Human. Others not known. Posi ve Control: Tonsil. Catalog Number Volume Specificity: This an body recognizes an an gen associated with RA0404-C.1 0.1 ml the nuclear membrane expressed in human cells. It can be used RA0404-C.5 0.5 ml to stain the nuclear membrane in cell or tissue preparations and can be used as a marker of the nuclear membrane in subcellular fractions. Status: RUO Catalog Number Volume RA0402-C.1 0.1 ml RA0402-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
104 Antibodies
Nucleolin (Marker of Nucleoli); Clone NCL/902 p21WAF1 (Tumor Suppressor Protein); Clone (Concentrate) CIP1/823 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human nucleolin protein Immunogen: Human recombinant CDKN1A protein Clone: NCL/902 Clone: CIP1/823 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Does not react with Mouse, Rat and Species Reac vity:Human. Does not react with Mouse and Rat. Cow. Others not known. Others not known. Posi ve Control: HeLa cells, breast cancer. Posi ve Control: HeLa Cells. Skin, colon, or breast carcinoma. Specificity: Recognizes a protein of ~76kDa, which is iden fied Specificity: This an body recognizes a 21kDa protein, iden fied as Nucleolin (NCL). This antibody can be used to stain the nucleoli as the p21WAF1 tumor suppressor protein. It is highly specific to in cell or tissue preparations and can be used as a marker of the p21 and shows no cross-reaction with other closely related nucleoli in subcellular fractions. It produces a speckled pattern in mitotic inhibitors. the nuclei of normal and malignant cells and may be used to Status: RUO stain the nucleoli of cells in fixed or frozen tissue sections. It can Catalog Number Volume be used with paraformaldehyde-fixed frozen tissue or cell preparations and formalin-fixed, paraffin-embedded tissue RA0076-C.1 0.1 ml sections. RA0076-C.5 0.5 ml Status: RUO p21WAF1 (Tumor Suppressor Protein); Clone DCS- Catalog Number Volume 60.2 (Concentrate) RA0242-C.1 0.1 ml Species: Mouse RA0242-C.5 0.5 ml Immunogen: Human recombinant p21 protein Ornithine Decarboxylase-1 (ODC-1); Clone Clone: DCS-60.2 Isotype: IgG2a, kappa ODC1/485 (Concentrate) Species Reac vity: Human. Does not react with Mouse and Rat. Species: Mouse Others not known. Immunogen: Recombinant human ODC-1 protein Posi ve Control: HeLa Cells. Skin, colon, or breast carcinoma. Clone: ODC1/485 Specificity: This monoclonal an body recognizes a 21kDa Isotype: IgG1, kappa protein, identified as the p21WAF1 tumor suppressor protein. Species Reac vity: Human. Others not known. This antibody is highly specific to p21 and shows no cross- Posi ve Control: Epithelial cells in normal placenta or prostate reaction with other closely related mitotic inhibitors. carcinoma. Status: RUO Specificity: Recognizes a 53kDa protein, iden fied as Ornithine Catalog Number Volume Decarboxylase (ODC-1). Status: RUO RA0075-C.1 0.1 ml RA0075-C.5 0.5 ml Catalog Number Volume RA0252-C.1 0.1 ml p21WAF1 (Tumor Suppressor Protein); Clone HJ21 RA0252-C.5 0.5 ml (Concentrate) p21WAF1 (Tumor Suppressor Protein); Clone Species: Mouse Immunogen: Human recombinant p21 protein CIP1/823 & DCS-60.2 (Concentrate) Clone: HJ21 Species: Mouse Isotype: Mouse / IgG1, kappa Immunogen: Recombinant full-length human CDKN1A protein Species Reactivity: Human, Monkey, Chimpanzee, Mouse and (CIP1/823); Human recombinant p21 protein (DCS-60.2) Rat. Others not known. Clone: CIP1/823 & DCS-60.2 Positive Control: HeLa Cells. Skin, colon, or breast carcinoma. Isotype: Mouse / IgG2a, kappa Specificity: This MAb recognizes a 21kDa protein, identified as Species Reactivity: Human, does not react with mouse and rat. the p21WAF1 tumor suppressor protein. It is highly specific to Others not known. p21 and shows no cross-reaction with other closely related Positive Control: HeLa Cells. Skin, colon, or breast carcinoma. mitotic inhibitors. Specificity: This MAb recognizes a 21kDa protein, identified as Status: RUO the p21WAF1 tumor suppressor protein. This MAb is highly Catalog Number Volume specific to p21 and shows no cross-reaction with other closely related mitotic inhibitors. RA0472-C.1 0.1 ml Status: RUO RA0472-C.5 0.5 ml RA0472-C1 1 ml Catalog Number Volume RA0473-C.1 0.1 ml RA0473-C.5 0.5 ml RA0473-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
105 Antibodies p21WAF1 (Tumor Suppressor Protein); Clone p27Kip1 (Mitotic Inhibitor/Suppressor Protein); SPM306 (Concentrate) Clone DCS-72.F6 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human recombinant p21 protein Immunogen: Mouse recombinant p27 protein Clone: SPM306 Clone: DCS-72.F6 Isotype: IgG2a, kappa Isotype: IgG1, kappa Species Reactivity: Human, does not react with mouse and rat. Species Reac vity: Human, Mouse, Rat and Monkey. Others Others not known. not known Positive Control: HeLa Cells. Skin, colon, or breast carcinoma. Posi ve Control: ZR75, T47D, SK-BR-3, MDA-MB-231, MCF7 Specificity: This MAb recognizes a 21kDa protein, identified as cells. Tonsil, Breast or Colon Carcinoma. the p21WAF1 tumor suppressor protein. This MAb is highly Specificity: Recognizes a 27kDa protein, iden fied as p27Kip1, a specific to p21 and shows no cross-reaction with other closely cell cycle regulatory mitotic inhibitor. Its epitope spans between related mitotic inhibitors. amino acids 83-204 of p27. It is highly specific and shows no Status: RUO cross-reaction with other related mitotic inhibitors. Catalog Number Volume Status: RUO RA0471-C.1 0.1 ml Catalog Number Volume RA0471-C.5 0.5 ml RA0079-C.1 0.1 ml RA0471-C1 1 ml RA0079-C.5 0.5 ml p21WAF1 (Tumor Suppressor Protein); Clone WA-1 p27Kip1 (Mitotic Inhibitor/Suppressor Protein); (HJ21) (Concentrate) Clone KIP1/769 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human recombinant p21 protein Immunogen: Recombinant human CDKN1B protein Clone: WA-1 (HJ21) Clone: KIP1/769 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Monkey, Mouse and Rat. Others Species Reac vity: Human, Mouse, Rat and Monkey. Others not known. not known. Posi ve Control: HeLa Cells. Skin, colon, or breast carcinoma. Posi ve Control: ZR75, T47D, SK-BR-3, MDA-MB-231, MCF7 Specificity: This an body recognizes a 21kDa protein, iden fied cells. Tonsil, breast or colon carcinoma. as the p21WAF1 tumor suppressor protein. It is highly specific to Specificity: This an body recognizes a 27kDa protein, iden fied p21 and shows no cross-reaction with other closely related as p27Kip1, a cell cycle regulatory mitotic inhibitor. It is highly mitotic inhibitors. specific and shows no cross-reaction with other related mitotic Status: RUO inhibitors. Catalog Number Volume Catalog Number Volume RA0074-C.1 0.1 ml RA0078-C.1 0.1 ml RA0074-C.5 0.5 ml RA0078-C.5 0.5 ml p27Kip1 (Mitotic Inhibitor/Suppressor Protein); p27Kip1 (Mitotic Inhibitor/Suppressor Protein); Clone DCS-72.F6 & KIP1/769 (Concentrate) Clone SPM348 (Concentrate) Species: Mouse Species: Mouse Immunogen: Mouse recombinant p27 protein (DCS-72.F6); Immunogen: Purified GST-p27 fusion protein of mouse origin Recombinant human CDKN1B protein (KIP1/769) Clone: SPM348 Clone: DCS-72.F6 + KIP1/769 Isotype: Mouse / IgG1, kappa Isotype: Mouse / IgG's Species Reactivity: Human, mouse, rat and monkey. Others not Species Reactivity: Human, monkey, mouse and rat. Others not known known. Positive Control: ZR75, T47D, SK-BR-3, MDA-MB-231, MCF7 Positive Control: ZR75, T47D, SK-BR-3, MDA-MB-231, HeLa or cells. Tonsil, Breast or Colon Ca MCF7 cells. Tonsil, Breast, Cervical or Colon Carcinoma. Specificity: This MAb recognizes a 27kDa protein, identified as Specificity: Recognizes a 27kDa protein, identified as the the p27Kip1, a cell cycle regulatory mitotic inhibitor. It is highly p27Kip1, a cell cycle regulatory mitotic inhibitor. It is highly specific and shows no cross-reaction with other related mitotic specific and shows no cross-reaction with other related mitotic inhibitors. inhibitors. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0474-C.1 0.1 ml RA0475-C.1 0.1 ml RA0474-C.5 0.5 ml RA0475-C.5 0.5 ml RA0474-C1 1 ml RA0475-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
106 Antibodies p27Kip1 (Mitotic Inhibitor/Suppressor Protein); p53 Tumor Suppressor Protein; Clone DO-7 Clone SX53G8 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Purified GST-p27 fusion protein of human origin Immunogen: Recombinant human wild type p53 protein Clone: SX53G8 expressed in E. coli. Isotype: IgG1, kappa Clone: DO-7 Species Reac vity: Human, Mouse, Rat and Monkey. Others Isotype: IgG2b, kappa not known. Species Reac vity: Human, Monkey, and Cow. Others not Posi ve Control: ZR75, T47D, SK-BR-3, MDA-MB-231, MCF7 known. cells. Tonsil, breast or colon carcinoma. Posi ve Control: MDA-MB-231 Cells. Breast or colon carcinoma. Specificity: This an body recognizes a 27kDa protein, iden fied Specificity: Recognizes a 53kDa protein, which is iden fied as as p27Kip1, a cell cycle regulatory mitotic inhibitor. It is highly p53 suppressor gene product. It reacts with the mutant as well as specific and shows no cross-reaction with other related mitotic the wild type form of p53. Its epitope maps within the N- inhibitors. terminus (aa 37-45) of p53. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0077-C.1 0.1 ml RA0319-C.1 0.1 ml RA0077-C.5 0.5 ml RA0319-C.5 0.5 ml p53 Tumor Suppressor Protein; Clone BP53-12 & p53 Tumor Suppressor Protein; Clone TRP/816 DO-7 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human wild-type p53 protein (BP53- Immunogen: Recombinant human TP53 protein 12); Recombinant human wild type p53 protein expressed in E. Clone: TRP/816 coli (DO-7). Isotype: IgG2a Clone: BP53-12 & DO-7 Species Reac vity: Human. Others not known. Isotype: IgG2a (BP53-12); IgG2b, kappa (DO-7) Posi ve Control: MDA-MB-231 Cells. Breast or colon carcinoma. Species Reac vity: Human, Monkey, and Cow. Others not Specificity: Recognizes a 53kDa protein, which is iden fied as known. p53 suppressor gene product. It reacts with the mutant as well as Posi ve Control: MDA-MB-231 Cells. Breast or colon carcinoma. the wild type form of p53 under denaturing and non-denaturing Specificity: Recognizes a 53kDa protein, which is iden fied as conditions. p53 suppressor gene product. It reacts with the mutant as well as Status: RUO the wild type form of p53 under denaturing and non-denaturing Catalog Number Volume conditions. Its epitope maps within the N-terminus (aa 20-25) of p53. RA0322-C.1 0.1 ml Status: RUO RA0322-C.5 0.5 ml Catalog Number Volume p53 Tumor Suppressor Protein; Clone TRP/817 RA0321-C.1 0.1 ml (Concentrate) RA0321-C.5 0.5 ml Species: Mouse p53 Tumor Suppressor Protein; Clone BP53-12 Immunogen: Recombinant human TP53 protein Clone: TRP/817 (Concentrate) Isotype: IgG2b, kappa Species: Mouse Species Reac vity: Human. Others not known. Immunogen: Recombinant human wild type p53 protein Posi ve Control: MDA-MB-231 Cells. Breast or colon carcinoma. Clone: BP53-12 Specificity: Recognizes a 53kDa protein, which is iden fied as Isotype: IgG2a p53 suppressor gene product. It reacts with the mutant as well as Species Reac vity: Human. Does not react with Mouse and Rat. the wild type form of p53 protein. Others not known. Status: RUO Posi ve Control: MDA-MB-231 Cells. Breast or colon carcinoma. Catalog Number Volume Specificity: Recognizes a 53kDa protein, which is iden fied as p53 suppressor gene product. It reacts with the mutant as well as RA0323-C.1 0.1 ml the wild type form of p53 under denaturing and non-denaturing RA0323-C.5 0.5 ml conditions. Its epitope maps within the N-terminus (aa 20-25) of p53 oncoprotein. Status: RUO Catalog Number Volume RA0318-C.1 0.1 ml RA0318-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
107 Antibodies p57Kip2 (Mitotic Inhibitor/Suppressor Protein); p57Kip2 (Mitotic Inhibitor/Suppressor Protein); Clone 57P06 (Concentrate) Clone KP10 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human p57Kip2 protein Immunogen: Recombinant human p57Kip2 protein Clone: 57P06 Clone: KP10 Isotype: IgG2b, kappa Isotype: IgG2b, kappa Species Reactivity: Human and Mouse. Others-not known Species Reac vity: Human and Mouse. Others not known. Positive Control: LS174T, Raji, HT29, SK-BR3 cells. Colon or Posi ve Control: LS174T, Raji, HT29, SK-BR3 cells. Colon Prostate carcinomas. carcinomas. Specificity: Recognizes a protein of 57kDa, identified as p57Kip2. Specificity: Recognizes a protein of 57kDa, iden fied as It shows no cross-reaction with p27Kip1. p57Kip2. It shows no cross-reaction with p27Kip1. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0478-C.1 0.1 ml RA0080-C.1 0.1 ml RA0478-C.5 0.5 ml RA0080-C.5 0.5 ml RA0478-C1 1 ml p57Kip2 (Mitotic Inhibitor/Suppressor Protein); p57Kip2 (Mitotic Inhibitor/Suppressor Protein); Clone SPM308 (Concentrate) Clone KIP2/880 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human p57Kip2 protein Immunogen: Recombinant human p57Kip2 protein Clone: SPM308 Clone: KIP2/880 Isotype: IgG2b, kappa Isotype: IgG2b, kappa Species Reactivity: Human and mouse. Others not known Species Reac vity: Human and Mouse. Others not known. Positive Control: LS174T, Raji, HT29, SK-BR3 cells. Colon or Posi ve Control: LS174T, Raji, HT29, SK-BR3 cells. Colon Prostate carcinomas. carcinomas. Specificity: Recognizes a protein of 57kDa, identified as p57Kip2. Specificity: Recognizes a protein of 57kDa, iden fied as It shows no cross-reaction with p27Kip1. p57Kip2. It shows no cross-reaction with p27Kip1. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0476-C.1 0.1 ml RA0081-C.1 0.1 ml RA0476-C.5 0.5 ml RA0081-C.5 0.5 ml RA0476-C1 1 ml p57Kip2 (Mitotic Inhibitor/Suppressor Protein); Parathyroid Hormone (PTH); Clone 3H9 Clone KP10 & KIP2/880 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human p57Kip2 protein Immunogen: Synthe c pep de corresponding to amino acids 1 Clone: KP10 + KIP2/880 to 34 of mature PTH conjugated to a carrier Isotype: IgG's Clone: 3H9 Species Reactivity: Human and Mouse. Others: not known Isotype: IgG2b, kappa Positive Control: LS174T, Raji, HT29, SK-BR3 cells. Colon or Species Reac vity: Human. Predicted to react with Mouse, Rat, Prostate carcinomas. Rabbit, Cow, Dog, Pig, Deer, and Orangutan. Specificity: Recognizes a protein of 57kDa, identified as p57Kip2. Posi ve Control: Human parathyroid gland carcinoma. It shows no cross-reaction with p27Kip1. Specificity: The epitope of this an body maps in between Status: RUO amino acids 1-34. Catalog Number Volume Status: RUO RA0477-C.1 0.1 ml Catalog Number Volume RA0477-C.5 0.5 ml RA0272-C.1 0.1 ml RA0477-C1 1 ml RA0272-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
108 Antibodies
Parathyroid Hormone (PTH); Clone PTH1/911 PCNA (Proliferating Cell Nuclear Antigen) (G1- & S- (Concentrate) phase Marker); Clone PC10 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human PTH polypep de Immunogen: Rat PCNA/Protein A fusion protein Clone: PTH1/911 Clone: PC10 Isotype: IgG2b, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Monkey, Pig, Mouse, Rat, Chicken, Posi ve Control: Human parathyroid gland carcinoma. Zebrafish, Drosophila melanogaster and Yeast (S. pombe & S. Specificity: The epitope of this an body maps in between cerevisiae). Others not known. amino acids 1-34. Posi ve Control: Tonsil or reac ve lymph node. Status: RUO Specificity: Recognizes a non-histone protein of 36kDa, which is Catalog Number Volume identified as proliferating cell nuclear antigen (PCNA). It is also known as cyclin or polymerase delta auxiliary protein. RA0273-C.1 0.1 ml Status: RUO RA0273-C.5 0.5 ml Catalog Number Volume P-Cadherin (CDH3); Clone 12H6 (Concentrate) RA0253-C.1 0.1 ml Species: Mouse RA0253-C.5 0.5 ml Immunogen: Recombinant human full-length P-cadherin fusion protein PDCD1 / PD1 / CD279 (Programmed Cell Death 1); Clone: 12H6 Clone NAT105 (Concentrate) Isotype: IgG1, kappa Species: Mouse Species Reactivity: Human. Others not known. Immunogen: TY cells (human T/NK cell Leukemia) Positive Control: A431 or PC-3 cells. Pancreas, Placenta or Clone: NAT105 Prostate Isotype: IgG1, kappa Specificity: Recognizes a protein of 116kDa, identified as P- Species Reac vity: Human. Others not known. Cadherin-1 (CDH3). Posi ve Control: TY cells or Tonsil. Status: RUO Specificity: An -PDCD1 is a marker of angioimmunoblas c Catalog Number Volume lymphoma and suggests a unique cell of origin for this neoplasm. Status: RUO RA0466-C.1 0.1 ml RA0466-C.5 0.5 ml Catalog Number Volume RA0466-C1 1 ml RA0254-C.1 0.1 ml RA0254-C.5 0.5 ml P-Cadherin (CDH3); Clone 6A9 (Concentrate) Species: Mouse PDCD1 / PD1 / CD279 (Programmed Cell Death 1); Immunogen: A431 trypsinized membranes Clone PDCD1/922 (Concentrate) Clone: 6A9 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant human PDCD1 protein Species Reactivity: Human. Others not known. Clone: PDCD1/922 Positive Control: A431 or PC-3 cells. Pancreas, Placenta or Isotype: IgG1, kappa Prostate Species Reac vity: Human. Others not known. Specificity: Recognizes a protein of 116kDa, identified as P- Posi ve Control: TY cells or Tonsil. Cadherin-1 (CDH3). Specificity: An -PDCD-1 is a marker of angioimmunoblas c Status: RUO lymphoma and suggests a unique cell of origin for this neoplasm. Catalog Number Volume Status: RUO RA0467-C.1 0.1 ml Catalog Number Volume RA0467-C.5 0.5 ml RA0255-C.1 0.1 ml RA0467-C1 1 ml RA0255-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
109 Antibodies
PD-L1 / PDCD1LG1 / CD274 / B7-H1; Clone Phosphotyrosine (P-Tyr); Clone PTR/793 PDL1/2746 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant fragment of human CD274 protein Immunogen: Phosphotyrosine conjugated to BSA (around aa 39-191). Exact sequence is proprietary. Clone: PTR/793 Clone: PDL1/2746 Isotype: IgG2b Isotype: IgG2b, kappa Species Reac vity: All species. Species Reactivity: Human and Mouse. Others not tested. Posi ve Control: MCF-7, MDA-231, T47-D cells or breast Positive Control: Heart, Placenta, Spleen or Tonsil. RAW, HEK293 carcinoma. or HepG2 cell lysates. Jurkat cells. Specificity: This an body shows no cross-reac on with other Specificity: This antibody reacts with PD-L1, also known as B7-H1 phosphoamino acids and is superb for multiple applications or CD274. including staining of formalin-fixed, paraffin-embedded tissues. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0501-C.1 0.1 ml RA0420-C.1 0.1 ml RA0501-C.5 0.5 ml RA0420-C.5 0.5 ml RA0501-C1 1 ml Phosphotyrosine (P-Tyr); Clone PY20 (Concentrate) PGP9.5 / UchL1 (pan-Neuronal Marker); Clone Species: Mouse 31A3 (Concentrate) Immunogen: Phosphotyrosine conjugated to KLH Species: Mouse Clone: PY20 Immunogen: Na ve UchL1 (PGP9.5) protein from brain Isotype: IgG2b Clone: 31A3 Species Reac vity: All species Isotype: IgG1, kappa Posi ve Control: MCF-7, MDA-231, T47-D cells or breast Species Reac vity: Human, Mouse, Rat, Cow, and Pig. Others carcinoma. not known. Specificity: This an body shows no cross-reac on with other Posi ve Control: Cerebellum phosphoamino acids and is superb for multiple applications, Specificity: This an body reacts with a protein of 20-30kDa, including staining of formalin-fixed, paraffin-embedded tissues. identified as PGP9.5, also known as ubiquitin carboxyl-terminal Status: RUO hydrolase-1 (UchL1). Catalog Number Volume Status: RUO RA0419-C.1 0.1 ml Catalog Number Volume RA0419-C.5 0.5 ml RA0333-C.1 0.1 ml RA0333-C.5 0.5 ml Placental Alkaline Phosphatase (PLAP) (Germ Cell Tumor Marker); Clone ALP/870 (Concentrate) PGP9.5 / UchL1 (pan-Neuronal Marker); Clone Species: Mouse PARK5/775 (Concentrate) Immunogen: Recombinant human PLAP protein Species: Mouse Clone: ALP/870 Immunogen: Recombinant human UCHL1 protein Isotype: IgG2b, kappa Clone: PARK5/775 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: HepG2 cells. Placenta or seminoma. Species Reac vity: Human. Shows a broad species reac vity. Specificity: Reacts with a 70kDa membrane-bound isozyme Posi ve Control: Cerebellum (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) Specificity: This an body reacts with a protein of 20-30kDa, occurring in the placenta during the 3rd trimester of gestation. It identified as PGP9.5, also known as ubiquitin carboxyl-terminal is highly specific for PLAP and shows no cross-reaction with other hydrolase-1 (UchL1). isozymes of alkaline phosphatase. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0334-C.1 0.1 ml RA0005-C.1 0.1 ml RA0334-C.5 0.5 ml RA0005-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
110 Antibodies
Placental Alkaline Phosphatase (PLAP) (Germ Cell PNL2 (Melanoma Associated Antigen); Clone PNL2 Tumor Marker); Clone GM022 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human PLAP protein Immunogen: Melanocyte an gen Clone: GM022 Clone: PNL2 Isotype: IgG2b, kappa Isotype: IgG1 Species Reac vity: Human. Others not known. Species Reac vity: Human, Mouse and Dog. Others not known. Posi ve Control: HepG2 cells. Placenta or seminoma. Posi ve Control: Melanoma Specificity: Reacts with a 70kDa membrane-bound isozyme Specificity: An -PNL2 is a novel monoclonal an body which has (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) recently been introduced as an immunohistochemical reagent to occurring in the placenta during the 3rd trimester of gestation. It stain melanocytes and tumors derived therefrom. The antigen is highly specific for PLAP and shows no cross-reaction with other recognized by PNL2 is different from Melan A and gp100. Its isozymes of alkaline phosphatase. epitope is not destroyed by digestion with neuraminidase, i.e., its Status: RUO epitope is not glycosylated. Catalog Number Volume Status: RUO RA0006-C.1 0.1 ml Catalog Number Volume RA0006-C.5 0.5 ml RA0415-C.1 0.1 ml RA0415-C.5 0.5 ml Placental Alkaline Phosphatase (PLAP) (Germ Cell Tumor Marker); Clone PL8-F6 (Concentrate) Podocalyxin (PODXL) (Hematopoietic Stem Cell Species: Mouse Marker); Clone 3D3 (Concentrate) Immunogen: Purified human PLAP protein Species: Mouse Clone: PL8-F6 Immunogen: A recombinant protein fragment containing the Isotype: IgG2b, kappa intracellular, transmembrane, and part of the extracellular Species Reac vity: Human. Others not known. domain of human podocalyxin Posi ve Control: HepG2 cells. Placenta or seminoma. Clone: 3D3 Specificity: Reacts with a 70kDa membrane-bound isozyme Isotype: IgG1 (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) Species Reac vity: Human, Rabbit, and Rat. Others not known. occurring in the placenta during the 3rd trimester of gestation. It Posi ve Control: HeLa, Raji, Jurkat cells, and angiosarcoma. is highly specific for PLAP and shows no cross-reaction with other Specificity: The podocalyxin an body can iden fy podocytes in isozymes of alkaline phosphatase. the urine (podocyturia) that may indicate glomerular disease, pre- Status: RUO eclampsia, and other kidney pathology. Catalog Number Volume Status: RUO RA0007-C.1 0.1 ml Catalog Number Volume RA0007-C.5 0.5 ml RA0264-C.1 0.1 ml RA0264-C.5 0.5 ml Plasma Cell Marker; Clone LIV3G11 (7B18) (Concentrate) Podoplanin (Lymphatic Endothelium & Alveolar Species: Mouse Epithelial Marker); Clone PDPN/601 (Concentrate) Immunogen: Pancrea c cancer-related mucin Species: Rat Clone: LIV3G11; same as 7B18 Immunogen: Recombinant fragment containing platelet- Isotype: IgG2a aggregation-stimulating (PLAG) domain of HUMAN podoplanin Species Reac vity: Human. Does not react with Rat. Others not Clone: PDPN/601 known. Isotype: IgG2a Posi ve Control: Tonsil or lymph node. Species Reac vity: Human, Monkey and Gorilla. Does not react Specificity: This an body recognizes an intra-cytoplasmic with Mouse, Rat, and Hamster. Others not known. antigen, which shows a very high degree of specificity for plasma Posi ve Control: NCCIT cells. Kidney, placenta, lung, skeletal cells. This antigen is present in normal as well as neoplastic muscle and brain. plasma cells. Specificity: This an body recognizes the platelet aggrega on- Status: RUO stimulating (PLAG) domain of podoplanin. Catalog Number Volume Status: RUO RA0398-C.1 0.1 ml Catalog Number Volume RA0398-C.5 0.5 ml RA0351-C.1 0.1 ml RA0351-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
111 Antibodies
Podoplanin (PDPN) (Lymphatic Endothelial & Prolactin Receptor (PRL-R); Clone B6.2 Mesothelial Marker); Clone PDPN/1433 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Semi-purified human prolac n receptor Immunogen: Recombinant human Podoplanin (PDPN) protein Clone: B6.2 fragment (aa24-126) (exact sequence is proprietary). Isotype: IgG1, kappa Clone: PDPN/1433 Species Reac vity: Human. Others not known. Isotype: IgG1, kappa Posi ve Control: Breast, placenta, liver or pancreas. Species Reactivity: Human. Others-not known. Specificity: This an body recognizes a protein of 70kDa Positive Control: HeLa Cells. Angiosarcoma or Mesothelioma. identified as the prolactin receptor. Specificity: This antibody recognizes a muco-protein of 38- Status: RUO 43kDa, which is identified Podoplanin (PDPN). Catalog Number Volume Status: RUO RA0269-C.1 0.1 ml Catalog Number Volume RA0269-C.5 0.5 ml RA0495-C.1 0.1 ml RA0495-C.5 0.5 ml Prolactin Receptor (PRL-R); Clone PRLR742 RA0495-C1 1 ml (Concentrate) Species: Mouse Progesterone Receptor (Marker of Progestin Immunogen: Recombinant human prolac n receptor Dependence); Clone PR484 (Concentrate) Clone: PRLR742 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant human Progesterone Receptor Species Reac vity: Human. Others not known. protein Posi ve Control: Breast, placenta, liver or pancreas. Clone: PR484 Specificity: This an body recognizes a protein of 70kDa Isotype: IgG1, kappa identified as the prolactin receptor. Species Reac vity: Human. Others not known. Status: RUO Posi ve Control: T47-D cells or breast cancers. Catalog Number Volume Specificity: This an body is specific to the progesterone RA0270-C.1 0.1 ml receptor and shows minimal cross-reaction with other members RA0270-C.5 0.5 ml of the family. Status: RUO Prostate Specific Antigen (PSA); Clone A67-B/E3 Catalog Number Volume (Concentrate) RA0263-C.1 0.1 ml Species: Mouse RA0263-C.5 0.5 ml Immunogen: PSA from human sperm plasma Clone: A67-B/E3 Prolactin Receptor (PRL-R); Clone B6.2 & PRLR742 Isotype: IgG1, kappa (Concentrate) Species Reac vity: Human. Others not known. Species: Mouse Posi ve Control: PC12 cells or normal prostate or prostate Immunogen: Semi-purified human prolac n receptor (B6.2); carcinoma. Recombinant human prolactin receptor (PRLR742) Specificity: Recognizes a single protein of 33-34kDa, iden fied Clone: B6.2 & PRLR742 as the prostate specific antigen (PSA). This MAb is highly specific Isotype: IgG1, kappa (B6.2); IgG1, kappa (PRLR742) to PSA and stains prostatic secretory and ductal epithelium in Species Reac vity: Human. Others not known. both normal and neoplastic tissues. Posi ve Control: Breast, placenta, liver or pancreas. Status: RUO Specificity: This an body recognizes a protein of 70kDa Catalog Number Volume identified as the prolactin receptor. RA0008-C.1 0.1 ml Status: RUO RA0008-C.5 0.5 ml Catalog Number Volume RA0008-C1 1 ml RA0271-C.1 0.1 ml RA0271-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
112 Antibodies
Prostate Specific Antigen (PSA); Clone KLK3/801 Renal Cell Carcinoma / gp200 (Carbonic Anhydrase (Concentrate) IX); Clone 66.4.C2 (PN-15) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human KLK3 protein Immunogen: Microsomal frac on of human renal cor cal Clone: KLK3/801 tissue homogenate Isotype: IgG1, kappa Clone: 66.4.C2 (PN-15) Species Reac vity: Human. Others not known. Isotype: IgG2b, kappa Posi ve Control: PC12 cells or normal prostate or prostate Species Reac vity: Human and Horse. Others not known. carcinoma. Posi ve Control: Normal kidney or renal cell carcinoma. Specificity: Recognizes a single protein of 33-34kDa, iden fied Specificity: Recognizes a glycoprotein of ~200kDa, iden fied as as the prostate specific antigen (PSA). This MAb is highly specific carbonic anhydrase IX (CAIX/gp200). Its epitope resides in the to PSA and stains prostatic secretory and ductal epithelium in carbohydrate domain of gp200. It shows no significant cross- both normal and neoplastic tissues. reactivity with other carbohydrate determinants, such as the Status: RUO Lewis blood group antigens, epithelial membrane antigen, Catalog Number Volume HMFG, and AB blood group antigens. Status: RUO RA0009-C.1 0.1 ml RA0009-C.5 0.5 ml Catalog Number Volume RA0026-C.1 0.1 ml pS2 / pNR-2 / Trefoil Factor 1 (Estrogen-Regulated RA0026-C.5 0.5 ml Protein); Clone GE2 (R47/94) (Concentrate) Renal Cell Carcinoma / gp200 (Carbonic Anhydrase Species: Mouse Immunogen: Synthe c pep de of 28 amino acid residues IX); Clone CA9/781 (Concentrate) corresponding to CFDDTVRGVPWCFYPNTIDVPPEEECEF (aa 57- Species: Mouse 84) from the C-terminus of human pS2. Immunogen: Recombinant human CA9 protein Clone: GE2; same as R47/94 Clone: CA9/781 Isotype: IgG1, kappa Isotype: IgG2b, kappa Species Reac vity: Human and Cynomolgus Monkey. Others Species Reac vity: Human and Horse. Others not known. not known. Posi ve Control: Normal kidney or renal cell carcinoma Posi ve Control: Spent medium of MCF-7 cells, treated with Specificity: Recognizes a glycoprotein of ~200kDa, iden fied as estrogen. Normal stomach. About 60% of breast carcinomas are carbonic anhydrase IX (CAIX/gp200). positive for pS2, especially those that are also positive for Status: RUO estrogen and/or progesterone receptor. Catalog Number Volume Specificity: This an body recognizes a polypep de of 6.5kDa, identified as pS2 estrogen-regulated protein. Its epitope is RA0027-C.1 0.1 ml localized between aa 57-84 of human pS2 protein. RA0027-C.5 0.5 ml Status: RUO Retinol Binding Protein-1 (RBP1); Clone G4E4 Catalog Number Volume (Concentrate) RA0300-C.1 0.1 ml Species: Mouse RA0300-C.5 0.5 ml Immunogen: Retinol binding protein-1 purified from human pS2 / pNR-2 / Trefoil Factor 1 (Estrogen-Regulated plasma Clone: G4E4 Protein); Clone TFF1/1091 (Concentrate) Isotype: IgG1, kappa Species: Mouse Species Reactivity: Human, Chimpanzee, Monkey, Goat, Rabbit, Immunogen: A synthetic peptide from the C-terminus of human Rat, and Mouse. Others not tested. TFF1 protein. Positive Control: Liver Clone: TFF1/1091 Specificity: This antibody recognizes an epitope within the 74- Isotype: IgG1, kappa 182 C-terminal sequence (11kD peptide fragment) of human Species Reactivity: Human and Monkey. Others not known. serum Retinol Binding Protein 1 (RBP1). Positive Control: Spent medium of MCF-7 cells, treated with Status: RUO estrogen. Normal stomach. About 60% of breast carcinomas are Catalog Number Volume positive for pS2, especially those that are also positive for estrogen and/or progesterone receptor. RA0446-C.1 0.1 ml Specificity: This antibody recognizes a polypeptide of 6.5kDa, RA0446-C.5 0.5 ml identified as pS2 estrogen-regulated protein. Its epitope is RA0446-C1 1 ml located in the C-terminus of the human pS2 protein. Status: RUO Catalog Number Volume RA0452-C.1 0.1 ml RA0452-C.5 0.5 ml RA0452-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
113 Antibodies
Retinol Binding Protein-1 (RBP1); Clone RBP/872 Secretory Component / ECM1; Clone ECM1/792 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human retinol binding protein-1 Immunogen: Recombinant human ECM1 protein (RBP1) Clone: ECM1/792 Clone: RBP/872 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human and Rat. Others not known. Species Reactivity: Human, Monkey, Goat, Rabbit, Rat, and Posi ve Control: Stomach, lung, or breast tumor. Mouse. Others not tested. Specificity: This an body reacts with a reduc on-resistant Positive Control: Liver epitope present in both free and SIgA bound Secretory Specificity: This antibody recognizes a protein of 21kDa-25kDa, Component. It does not react with the cell lines lacking Secretory identified as retinol binding protein-1 (RBP1). Component. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0447-C.1 0.1 ml RA0106-C.1 0.1 ml RA0447-C.5 0.5 ml RA0106-C.5 0.5 ml RA0447-C1 1 ml Secretory Component / ECM1; Clone SC05 S100 (Astrocyte Marker); Clone 4C4.9 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Secretory Component protein isolated from Immunogen: Purified bovine brain S100 protein human colostrum Clone: 4C4.9 Clone: SC05 Isotype: IgG2a, kappa Isotype: IgG1, kappa Species Reac vity: Human, Mouse, Rat, Cow. Others not Species Reac vity: Human and Rat. Others not known. known. Posi ve Control: Stomach, lung, or breast tumor. Posi ve Control: Brain and Melanoma. Specificity: This an body reacts with a reduc on-resistant Specificity: S-100 protein has been found in normal epitope present in both free and SIgA bound Secretory melanocytes, Langerhans cells, histiocytes, chondrocytes, Component. It does not react with the cell lines lacking Secretory lipocytes, skeletal and cardiac muscle, Schwann cells, epithelial Component. and myoepithelial cells of the breast, salivary and sweat glands, Status: RUO as well as in glial cells. Neoplasms derived from these cells also Catalog Number Volume express S-100 protein, albeit non-uniformly. A large number of well-differentiated tumors of the salivary gland, adipose and RA0105-C.1 0.1 ml cartilaginous tissue, and Schwann cell-derived tumors express S- RA0105-C.5 0.5 ml 100 protein. Almost all malignant melanomas and cases of histiocytosis X are positive for S-100 protein. Secretory Component / ECM1; Clone SPM217 Status: RUO (Concentrate) Catalog Number Volume Species: Mouse. Immunogen: Secretory Component protein isolated from human RA0285-C.1 0.1 ml colostrum. RA0285-C.5 0.5 ml Clone: SPM217. S100A7 / HID5 / Psoriasin (Proliferative Epithelial Isotype: IgG1, kappa. Species Reactivity: Reacts with human and rat. Others not Cell Marker); Clone S100A7/542 (Concentrate) known. Species: Mouse Positive Control: Stomach, lung, or breast tumor. Immunogen: Recombinant human S100A7 protein Specificity: This monoclonal antibody reacts with a reduction- Clone: S100A7/542 resistant epitope present in both free and SIgA bound Secretory Isotype: IgG1, kappa Component. It does not react with the cell lines lacking secretory Species Reac vity: Human. Others not known. component. Posi ve Control: MCF-7 cells. Breast carcinoma. Status: RUO Specificity: This an body recognizes a protein of 11kDa, Catalog Number Volume identified as S100A7. This protein is markedly over-expressed in the skin lesions of psoriatic patients. This protein is found to have RA0575-C.1 0.1 ml elevated expression in abnormally differentiating primary RA0575-C.5 0.5 ml keratinocytes and in various carcinomas, including ductal RA0575-C1 1 ml carcinoma in situ. It may serve as a marker of abnormally proliferative epithelia. Status: RUO Catalog Number Volume RA0286-C.1 0.1 ml RA0286-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
114 Antibodies
Sex Hormone Binding Globulin (SHBG); Clone Smooth Muscle Myosin Heavy Chain (SM-MHC) SHBG/245 (Concentrate) (Leiomyosarcoma & Myoepithelial Cell Marker); Species: Mouse Clone SMMS-1 (Concentrate) Immunogen: Recombinant full-length human SHBG protein Species: Mouse Clone: SHBG/245 Immunogen: Human uterus extract Isotype: IgG Clone: SMMS-1 Species Reactivity: Human. Others not known. Isotype: IgG1, kappa Positive Control: Liver, Placenta, or Testis. Species Reac vity: Human, Cow, Pig, Dog, Cat, Rabbit, Rat, Specificity: This antibody recognizes a protein of 45kDa, Guinea pig and Chicken. Others not known. identified as SHBG. Posi ve Control: Uterus or normal breast. Status: RUO Specificity: This an body may be useful for the study of breast Catalog Number Volume tumors as the presence of an intact layer of myoepithelial cells is an important feature which may distinguish benign breast lesions RA0449-C.1 0.1 ml and carcinoma in situ from invasive tumors. RA0449-C.5 0.5 ml Status: RUO RA0449-C1 1 ml Catalog Number Volume Smooth Muscle Myosin Heavy Chain (SM-MHC) RA0228-C.1 0.1 ml (Leiomyosarcoma & Myoepithelial Cell Marker); RA0228-C.5 0.5 ml Clone ID8 (Concentrate) SOX10 (Melanoma Marker); Clone SOX10/991 Species: Mouse Immunogen: Human uterus extract (Concentrate) Clone: ID8 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant human SOX10 protein fragment Species Reac vity: Human, Cow, Pig, Dog, Cat, Rabbit, Rat, (aa115-269) (exact sequence is proprietary). Guinea pig and Chicken. Others not known. Clone: SOX10/991 Posi ve Control: Uterus or normal breast. Isotype: Mouse / IgG2b, kappa Specificity: This an body may be useful for the study of breast Species Reactivity: Reacts with human and mouse. Others not tumors as the presence of an intact layer of myoepithelial cells is known. an important feature which may distinguish benign breast lesions Positive Control: HepG2 cells. Melanomas, breast carcinomas, and carcinoma in situ from invasive tumors. gliomas. Status: RUO Specificity: Recognizes a protein of ~55kDa, identified as SOX10. This monoclonal antibody is highly specific and does not cross- Catalog Number Volume react with other members of the SOX-family. RA0229-C.1 0.1 ml Status: RUO RA0229-C.5 0.5 ml Catalog Number Volume Smooth Muscle Myosin Heavy Chain (SM-MHC) RA0594-C.1 0.1 ml (Leiomyosarcoma & Myoepithelial Cell Marker); RA0594-C.5 0.5 ml Clone MYH11/923 (Concentrate) RA0594-C1 1 ml Species: Mouse SUMO-1; Clone SM1/495 (Concentrate) Immunogen: Recombinant human MYH11 protein Mouse Clone: MYH11/923 Species:
Isotype: IgG1, kappa Immunogen: Recombinant human SUMO1 protein
Species Reac vity: Human. Predicted to have broad species Clone: SM1/495 reactivity. Isotype: IgG1, kappa
Posi ve Control: Uterus or normal breast. Species Reac vity: Human. Shows broad species reac vity.
Specificity: This an body may be useful for the study of breast Posi ve Control: Breast carcinoma. tumors as the presence of an intact layer of myoepithelial cells is Specificity: This an body is specific to SUMO-1 and shows no an important feature which may distinguish benign breast lesions cross-reaction with either SUMO-2 or SUMO-3. and carcinoma in situ from invasive tumors. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0332-C.1 0.1 ml RA0230-C.1 0.1 ml RA0332-C.5 0.5 ml RA0230-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
115 Antibodies
SUMO-2/3; Clone SM23/496 (Concentrate) TAG-72 (Tumor-Associated Glycoprotein); Clone Species: Mouse B72.3 (Concentrate) Immunogen: Recombinant human SUMO2 protein Species: Mouse Clone: SM23/496 Immunogen: Membrane-enriched frac on of a human breast Isotype: IgG1, kappa carcinoma liver metastasis Species Reac vity: Human. Shows broad species reac vity. Clone: B72.3 Posi ve Control: HeLa cells or breast carcinoma. Isotype: IgG1, kappa Specificity: This an body reacts with both SUMO-2 and SUMO- Species Reac vity: Human, Cow, Dog, Hamster, and Rat. Others 3. not known. Status: RUO Posi ve Control: Jurkat cells, breast or lung carcinoma. Catalog Number Volume Specificity: Recognizes an oncofetal an gen of 220kDa, identified as a tumor-associated glycoprotein (TAG-72) with RA0295-C.1 0.1 ml properties of a mucin. This antibody defines the mucin-carried RA0295-C.5 0.5 ml sialylated-Tn epitope. TAG-72 is usually expressed by TAG-72 (Tumor-Associated Glycoprotein); Clone adenocarcinomas, but is negative in mesotheliomas. Studies have reported that this antibody has 80% sensitivity and 93% B72.3 & CA72/733 (Concentrate) specificity for pulmonary adenocarcinoma. Therefore, TAG-72 is Species: Mouse a useful marker to distinguish between mesothelioma and Immunogen: TAG-72 protein (B72.3 & CA72/733) adenocarcinoma. However, false positive reactions can occur, so Clone: B72.3 & CA72/733 results must be interpreted with the utmost degree of caution. Isotype: IgG1, kappa (B72.3 & CA72/733) Status: RUO Species Reac vity: Human, Cow, Dog, and Rat. Others not Catalog Number Volume known. Posi ve Control: Jurkat cells, breast or lung carcinoma. RA0367-C.1 0.1 ml Specificity: Recognizes an oncofetal an gen of 220kDa, RA0367-C.5 0.5 ml identified as a tumor-associated glycoprotein (TAG-72) with properties of a mucin. This antibody defines the mucin-carried TAG-72 (Tumor-Associated Glycoprotein); Clone sialylated-Tn epitope. TAG-72 is usually expressed by CA72/733 (Concentrate) adenocarcinomas, but is negative in mesotheliomas. Studies Species: Mouse have reported that this antibody has 80% sensitivity and 93% Immunogen: Recombinant human TAG-72 protein specificity for pulmonary adenocarcinoma. Therefore, TAG-72 is Clone: CA72/733 a useful marker to distinguish between mesothelioma and Isotype: IgG1, kappa adenocarcinoma. However, false positive reactions can occur, so Species Reac vity: Human, Cow, Dog, and Rat. Others not results must be interpreted with the utmost degree of caution. known. Status: RUO Posi ve Control: Jurkat cells, breast or lung carcinoma. Catalog Number Volume Specificity: Recognizes an oncofetal an gen of 220kDa, identified as a tumor-associated glycoprotein (TAG-72) with RA0370-C.1 0.1 ml properties of a mucin. This antibody defines the mucin-carried RA0370-C.5 0.5 ml sialylated-Tn epitope. TAG-72 is usually expressed by TAG-72 (Tumor-Associated Glycoprotein); Clone adenocarcinomas, but is negative in mesotheliomas. Studies have reported that this antibody has 80% sensitivity and 93% B72.3 & CC49 (Concentrate) specificity for pulmonary adenocarcinoma. Therefore, TAG-72 is Species: Mouse a useful marker to distinguish between mesothelioma and Immunogen: TAG-72 protein (B72.3 & CC49) adenocarcinoma. However, false positive reactions can occur, so Clone: B72.3 & CC49 results must be interpreted with the utmost degree of caution. Isotype: IgG1, kappa (B72.3 & CC49) Status: RUO Species Reac vity: Human, Cow, Dog, and Rat. Others not Catalog Number Volume known. Posi ve Control: Jurkat cells, breast or lung carcinoma. RA0369-C.1 0.1 ml Specificity: Recognizes an oncofetal an gen of 220kDa, RA0369-C.5 0.5 ml identified as a tumor-associated glycoprotein (TAG-72) with properties of a mucin. This antibody defines the mucin-carried sialylated-Tn epitope. TAG-72 is usually expressed by adenocarcinomas, but is negative in mesotheliomas. Studies have reported that this antibody has 80% sensitivity and 93% specificity for pulmonary adenocarcinoma. Therefore, TAG-72 is a useful marker to distinguish between mesothelioma and adenocarcinoma. However, false positive reactions can occur, so results must be interpreted with the utmost degree of caution. Status: RUO Catalog Number Volume RA0371-C.1 0.1 ml RA0371-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
116 Antibodies
TAG-72 (Tumor-Associated Glycoprotein); Clone TAG-72 / CA72.4 (Tumor-Associated Glycoprotein); CC49 (Concentrate) Clone SPM536 (Concentrate) Species: Mouse Species: Mouse. Immunogen: Purified TAG-72 protein Immunogen: Purified TAG-72 protein. Clone: CC49 Clone: SPM536. Isotype: IgG1, kappa Isotype: IgG1, kappa. Species Reac vity: Human, Cow, Dog, and Rat. Others not Species Reactivity: Reacts with human, cow, dog, and rat. Others known. not known. Posi ve Control: Jurkat cells, breast or lung carcinoma. Positive Control: Jurkat cells. Breast or lung carcinoma. Specificity: Recognizes an oncofetal an gen of 220kDa, Specificity: Recognizes an oncofetal antigen of 220kDa, identified identified as a tumor-associated glycoprotein (TAG-72) with as a tumor-associated glycoprotein (TAG-72) with properties of a properties of a mucin. This antibody defines the mucin-carried mucin. sialylated-Tn epitope. TAG-72 is usually expressed by Status: RUO adenocarcinomas, but is negative in mesotheliomas. Studies Catalog Number Volume have reported that this antibody has 80% sensitivity and 93% specificity for pulmonary adenocarcinoma. Therefore, TAG-72 is RA0567-C.1 0.1 ml a useful marker to distinguish between mesothelioma and RA0567-C.5 0.5 ml adenocarcinoma. However, false positive reactions can occur, so RA0567-C1 1 ml results must be interpreted with the utmost degree of caution. Status: RUO Tenascin C (Stromal Marker For Epithelial Catalog Number Volume Malignancy); Clone T2H5 (Concentrate)
RA0368-C.1 0.1 ml Species: Mouse Immunogen: Human breast carcinoma RA0368-C.5 0.5 ml Clone: T2H5 TAG-72 / CA72.4 (Tumor-Associated Glycoprotein); Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Clone SPM148 (Concentrate) Posi ve Control: Extracellular matrix in tonsil and blood Species: Mouse. vessels. Stroma of many tumors such as breast, squamous cell, Immunogen: Membrane-enriched fraction of a human breast and lung carcinomas. Staining of normal fibroblasts serves as carcinoma liver metastasis. internal positive control. Clone: SPM148. Specificity: In Western blo ng, it reacts with two bands at Isotype: IgG1, kappa. ~MW of 210kDa and 300kDa, identified as two isoforms of Species Reactivity: Reacts with human, cow, dog, hamster, and Tenascin C. Specificity of this monoclonal antibody is validated by rat. Others not known. sequential immunoprecipitation with a polyclonal antibody Positive Control: Jurkat cells. Breast or lung carcinoma. against Tenascin C. Specificity: Recognizes an oncofetal antigen of 220kDa, identified Status: RUO as a tumor-associated glycoprotein (TAG-72) with properties of a Catalog Number Volume mucin. Studies have reported that this antibody has 80% sensitivity and 93% specificity for pulmonary adenocarcinoma. RA0135-C.1 0.1 ml Therefore, TAG-72 is a useful marker to distinguish between RA0135-C.5 0.5 ml mesothelioma and adenocarcinoma. However, false positive reactions can occur so results must be interpreted with the TGF-alpha (Transforming Growth Factor alpha); utmost caution. Clone 1E8-G6 (Concentrate) Status: RUO Species: Mouse Catalog Number Volume Immunogen: A 10-amino acid synthe c pep de (aa 34-43) RA0566-C.1 0.1 ml from human TGFα. Clone: 1E8-G6 RA0566-C.5 0.5 ml Isotype: IgG1, kappa RA0566-C1 1 ml Species Reac vity: Human, Rabbit, and Zebrafish. Others not known. Posi ve Control: Jurkat or Ramos cells. Heart, kidney, pituitary, breast cancer, melanoma. Specificity: This an body reacts with TGF-alpha and shows no cross-reaction with EGF or the neuropeptide synenkephalin. The staining with this antibody is completely blocked by the peptide used for raising the antibody. Status: RUO Catalog Number Volume RA0305-C.1 0.1 ml RA0305-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
117 Antibodies
TGF-alpha (Transforming Growth Factor alpha); Thymidine Phosphorylase / PD-ECGF (Angiogenesis Clone P/T1 (Concentrate) Marker); Clone P-GF.44C (Concentrate) Species: Mouse Species: Mouse. Immunogen: A 10-amino acid synthe c pep de (aa 34-43) Immunogen: Recombinant full-length human Thymidine from human TGFα. Phosphorylase (TP / PD-ECGF) protein. Clone: P/T1 Clone: P-GF.44C. Isotype: IgG1, kappa Isotype: IgG1. Species Reac vity: Human, Rabbit, and Zebrafish. Others not Species Reactivity: Reacts with human, mouse, and rat. Others known. not known. Posi ve Control: Jurkat or Ramos cells. Heart, kidney, pituitary, Positive Control: HUVEC cells. Breast, bladder, lung or Kaposi breast cancer, melanoma. Tumors. Specificity: This an body reacts with TGF-alpha and shows no Specificity: Recognizes a protein (amino acid 482) of 55kDa (in cross-reaction with EGF or the neuropeptide synenkephalin. The vivo 110kDa homodimer), identified as platelet-derived staining with this antibody is completely blocked by the peptide endothelial growth factor (PD-ECGF), same as thymidine used for raising the antibody. phosphorylase (TP) or gliostatin. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0307-C.1 0.1 ml RA0573-C.1 0.1 ml RA0307-C.5 0.5 ml RA0573-C.5 0.5 ml RA0573-C1 1 ml TGF-alpha (Transforming Growth Factor alpha); Clone TG86 & P/T1 (Concentrate) Thymidine Phosphorylase / PD-ECGF (Angiogenesis Species: Mouse Marker); Clone SPM322 (Concentrate) Immunogen: A 10-amino acid synthe c pep de (aa 34-43) Species: Mouse. from human TGFα (TG86 & P/T1). Immunogen: Recombinant full-length human Thymidine Clone: TG86 & P/T1 Phosphorylase (TP / PD-ECGF) protein. Isotype: IgG1, kappa (TG86 & P/T1) Clone: SPM322. Species Reac vity: Human, Rabbit, and Zebrafish. Others not Isotype: IgG1. known. Species Reactivity: Reacts with human, mouse, and rat. Others Posi ve Control: Jurkat or Ramos cells. Heart, kidney, pituitary, not known. breast cancer, melanoma. Positive Control: HUVEC cells. Breast, bladder, lung, or Kaposi Specificity: This an body reacts with TGF-alpha and shows no Tumors. cross-reaction with EGF or the neuropeptide synenkephalin. The Specificity: Recognizes a protein of 55kDa (in vivo 110kDa staining with this antibody is completely blocked by the peptide homodimer), identified as platelet-derived endothelial growth used for raising the antibody. factor (PD-ECGF), same as thymidine phosphorylase (TP) or Status: RUO gliostatin. Catalog Number Volume Status: RUO RA0308-C.1 0.1 ml Catalog Number Volume RA0308-C.5 0.5 ml RA0574-C.1 0.1 ml RA0574-C.5 0.5 ml TGF-alpha (Transforming Growth Factor alpha); RA0574-C1 1 ml Clone TG86 (Concentrate) Species: Mouse Thymidylate Synthase (5-FU Resistance Marker); Immunogen: A 10-amino acid synthe c pep de (aa 34-43) Clone TMS715 (Concentrate) from human TGFα. Species: Mouse Clone: TG86 Immunogen: Recombinant human thymidylate synthase Isotype: IgG1, kappa Clone: TMS715 Species Reac vity: Human, Rabbit, and Zebrafish. Others not Isotype: IgG1, kappa known. Species Reac vity: Human. Others not known. Posi ve Control: Jurkat or Ramos cells. Heart, kidney, pituitary, Posi ve Control: 5-FU-resistant colon carcinoma cell lines (NCI breast cancer, melanoma. H630R10, NCI H630R1), 5-FU-resistant breast cancer cell lines, Specificity: This an body reacts with TGF-alpha and shows no MCF-Ad5 and MCF-Ad10. Colorectal, gastric, head & neck, and cross-reaction with EGF or the neuropeptide synenkephalin. The breast carcinomas. staining with this antibody is completely blocked by the peptide Specificity: This an body recognizes a protein of 36kDa, used for raising the antibody. identified as Thymidylate Synthase (TS) (EC 2.1.1.45). Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0306-C.1 0.1 ml RA0327-C.1 0.1 ml RA0306-C.5 0.5 ml RA0327-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
118 Antibodies
Thymidylate Synthase (5-FU Resistance Marker); Thyroglobulin (Thyroidal Cell Marker); Clone 2H11 Clone TS106 & TMS715 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human thymidylate synthase Immunogen: Human thyroid follicular cells (TS106 & TMS715) Clone: 2H11 Clone: TS106 & TMS715 Isotype: IgG1, kappa Isotype: IgG1, kappa (TS106 & TMS715) Species Reac vity: Human, Mouse, Rat. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Thyroid Posi ve Control: 5-FU-resistant colon carcinoma cell lines (NCI Specificity: The vast majority of follicular carcinomas of the H630R10, NCI H630R1), 5-FU-resistant breast cancer cell lines, thyroid will give positive immunoreactivity for anti-thyroglobulin MCF-Ad5 and MCF-Ad10. Colorectal, gastric, head & neck, and even though sometimes only focally. Poorly differentiated breast carcinomas. carcinomas of the thyroid are frequently anti-thyroglobulin Specificity: This an body recognizes a protein of 36kDa, negative. Adenocarcinomas of an origin other than the thyroid identified as Thymidylate Synthase (TS) (EC 2.1.1.45). do not react with this antibody. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0328-C.1 0.1 ml RA0301-C.1 0.1 ml RA0328-C.5 0.5 ml RA0301-C.5 0.5 ml Thymidylate Synthase (5-FU Resistance Marker); Thyroglobulin (Thyroidal Cell Marker); Clone 6E1 Clone TS106 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human thymidylate synthase Immunogen: Human thyroid follicular cells Clone: TS106 Clone: 6E1 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Mouse, Rat. Others not known. Posi ve Control: 5-FU-resistant colon carcinoma cell lines (NCI Posi ve Control: Thyroid H630R10, NCI H630R1), 5-FU-resistant breast cancer cell lines, Specificity: The vast majority of follicular carcinomas of the MCF-Ad5 and MCF-Ad10. Colorectal, gastric, head & neck, and thyroid will give positive immunoreactivity for anti-thyroglobulin breast carcinomas. even though sometimes only focally. Poorly differentiated Specificity: This an body recognizes a protein of 36kDa, carcinomas of the thyroid are frequently anti-thyroglobulin identified as Thymidylate Synthase (TS) (EC 2.1.1.45). negative. Adenocarcinomas of an origin other than the thyroid Status: RUO do not react with this antibody. Catalog Number Volume Status: RUO RA0326-C.1 0.1 ml Catalog Number Volume RA0326-C.5 0.5 ml RA0302-C.1 0.1 ml RA0302-C.5 0.5 ml Thyroglobulin (Thyroidal Cell Marker); Clone 2H11 & 6E1 (Concentrate) Thyroglobulin (Thyroidal Cell Marker); Clone Species: Mouse TGB04 & TGB05 (Concentrate) Immunogen: Human thyroid follicular cells (2H11 & 6E1) Species: Mouse Clone: 2H11 & 6E1 Immunogen: Human thyroid follicular cells (TGB04 & TGB05) Isotype: IgG1, kappa (2H11 & 6E1) Clone: TGB04 & TGB05 Species Reac vity: Human, Mouse, Rat. Others not known. Isotype: IgG1, kappa (TGB04 & TGB05) Posi ve Control: Thyroid Species Reac vity: Human, Mouse, Rat. Others not known. Specificity: The vast majority of follicular carcinomas of the Posi ve Control: Thyroid thyroid will give positive immunoreactivity for anti-thyroglobulin Specificity: The vast majority of follicular carcinomas of the even though sometimes only focally. Poorly differentiated thyroid will give positive immunoreactivity for anti-thyroglobulin carcinomas of the thyroid are frequently anti-thyroglobulin even though sometimes only focally. Poorly differentiated negative. Adenocarcinomas of an origin other than the thyroid carcinomas of the thyroid are frequently anti-thyroglobulin do not react with this antibody. negative. Adenocarcinomas of an origin other than the thyroid Status: RUO do not react with this antibody. Catalog Number Volume Status: RUO RA0303-C.1 0.1 ml Catalog Number Volume RA0303-C.5 0.5 ml RA0304-C.1 0.1 ml RA0304-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
119 Antibodies
TIGIT; Clone TG1 (Concentrate) TNF-alpha (Tumor Necrosis Factor alpha); Clone Species: Mouse TNF706 & P/T2 (Concentrate) Immunogen: Recombinant peptide from extracellular domain of Species: Mouse human TIGIT. Immunogen: Recombinant human TNF-alpha Clone: TG1 Clone: TNF706 & P/T2 Isotype: IgG1, kappa Isotype: IgM, kappa (TNF706 & P/T2) Species Reactivity: Human. Species Reac vity: Human, Mouse, Rat, Rabbit, Cat, Dog, and Positive Control: Tonsil Zebrafish. Others not known. Specificity: Human TIGIT / T-Cell marker (Immune Checkpoint Posi ve Control: HeLa, HL-60, or A431 cells. Macrophages in Protein). lymph node or tonsil. Status: RUO Specificity: This an body reacts with Tumor necrosis factor- Catalog Number Volume alpha. It reacts on paraffin sections with macrophages in which the cytoplasm is stained. Some keratinocytes are also positive DIA-TG1-M 0.1 ml (tonsils). DIA-TG1 0.5 ml Status: RUO TNF-alpha (Tumor Necrosis Factor alpha); Clone Catalog Number Volume 4C6-H8 (Concentrate) RA0317-C.1 0.1 ml Species: Mouse RA0317-C.5 0.5 ml Immunogen: A hexadecapep de corresponding to amino acids 115-130 of human TNF-alpha, conjugated to thyroglobulin. TNF-alpha (Tumor Necrosis Factor alpha); Clone Clone: 4C6-H8 TNF706 (Concentrate) Isotype: IgM, kappa Species: Mouse Species Reac vity: Human, Mouse, Rat, Rabbit, Cat, Dog, and Immunogen: Recombinant human TNF-alpha Zebrafish. Others not known. Clone: TNF706 Posi ve Control: HeLa, HL-60, or A431 cells. Macrophages in Isotype: IgM, kappa lymph node or tonsil. Species Reac vity: Human, Mouse, Rat, Rabbit, Cat, Dog, and Specificity: This an body reacts with Tumor necrosis factor- Zebrafish. Others not known. alpha. It reacts on paraffin sections with macrophages in which Posi ve Control: HeLa, HL-60, or A431 cells. Macrophages in the cytoplasm is stained. Some keratinocytes are also positive lymph node or tonsil. (tonsils). Specificity: This an body reacts with Tumor necrosis factor- Status: RUO alpha. It reacts on paraffin sections with macrophages in which Catalog Number Volume the cytoplasm is stained. Some keratinocytes are also positive (tonsils). RA0314-C.1 0.1 ml Status: RUO RA0314-C.5 0.5 ml Catalog Number Volume TNF-alpha (Tumor Necrosis Factor alpha); Clone RA0316-C.1 0.1 ml P/T2 (Concentrate) RA0316-C.5 0.5 ml Species: Mouse Immunogen: A hexadecapep de corresponding to amino acids Topoisomerase (DNA) I, Mitochondrial (TOP1MT); 115-130 of human TNF-alpha, conjugated to thyroglobulin. Clone TOP1MT/488 (Concentrate) Clone: P/T2 Species: Mouse. Isotype: IgM, kappa Immunogen: Recombinant full-length human TOP1MT protein. Species Reac vity: Human, Mouse, Rat, Rabbit, Cat, Dog, and Clone: TOP1MT/488 Zebrafish. Others not known. Isotype: IgG2b, kappa Posi ve Control: HeLa, HL-60, or A431 cells. Macrophages in Species Reactivity: Reacts with human. Others not known. lymph node or tonsil. Positive Control: A431 cells. Heart, skeletal muscle, brain, or Specificity: This an body reacts with Tumor necrosis factor- fetal liver. alpha. It reacts on paraffin sections with macrophages in which Specificity: Recognizes Topoisomerase (DNA) I. the cytoplasm is stained. Some keratinocytes are also positive Status: RUO (tonsils). Catalog Number Volume Status: RUO RA0520-C.1 0.1 ml Catalog Number Volume RA0520-C.5 0.5 ml RA0315-C.1 0.1 ml RA0520-C1 1 ml RA0315-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
120 Antibodies
TRAcP (Tartrate-Resistant Acid Phosphatase); TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker); Clone ACP5/1070 (Concentrate) Clone 8G7G3/1 & NX2.1/690 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant human ACP5 protein Immunogen: Recombinant full length Rat TTF-1 protein Clone: ACP5/1070 (8G7G3/1); Recombinant TTF-1 protein (NX2.1/690) Isotype: IgG2b, kappa Clone: 8G7G3/1 & NX2.1/690 Species Reac vity: Human, Mouse, and Rat. Others not known. Isotype: IgG1, kappa (8G7G3/1 & NX2.1/690) Posi ve Control: HepG2, 293T, K562 or RPMI-8226 Cells. Species Reac vity: Human, Mouse, and Rat. Others not known. Spleen from Hairy Cell Leukemia (HCL) patient. Posi ve Control: MAD109, MLE-15, H441-4, or H345 cells. Specificity: This an body recognizes a protein of 35kDa, which Normal thyroid or lung. is identified as tartrate-resistant acid phosphatase (TRAcP). It Specificity: Recognizes a protein of 40kDa, iden fied as thyroid exists as two isoforms (5a and 5b). This antibody reacts with both transcription factor 1 (TTF-1). the isoforms. The anti-TRAcP antibody labels the cells of Hairy Status: RUO Cell Leukemia (HCL) with a high degree of sensitivity and Catalog Number Volume specificity. Other cells stained with this antibody are tissue macrophages and osteoclasts. RA0313-C.1 0.1 ml Status: RUO RA0313-C.5 0.5 ml Catalog Number Volume TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker); RA0422-C.5 0.5 ml Clone 8G7G3/1 (Concentrate) Transgelin (SM22-alpha); Clone TAGLN/247 Species: Mouse Immunogen: Recombinant full length Rat TTF-1 protein (Concentrate) Clone: 8G7G3/1 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant full-length human transgelin (TAGLN) Species Reac vity: Human, Mouse, and Rat. Shows a broad protein. species reactivity. Clone: TAGLN/247 Posi ve Control: MAD109, MLE-15, H441-4, or H345 cells. Isotype: IgG1, kappa Normal thyroid or lung. Species Reactivity: Human, Cow, Pig, Rabbit, and Mouse. Others Specificity: Recognizes a protein of 40kDa, iden fied as thyroid not known. transcription factor 1 (TTF-1). Positive Control: U-2 OS, Hs68 or WI 38 cells. Colon carcinoma. Status: RUO Specificity: This antibody recognizes a 22kDa protein, identified Catalog Number Volume as Transgelin, also designated SM22-alpha. It may cross-react with SM22-beta. RA0310-C.1 0.1 ml Status: RUO RA0310-C.5 0.5 ml Catalog Number Volume TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker); RA0451-C.1 0.1 ml Clone NX2.1/690 (Concentrate) RA0451-C.5 0.5 ml Species: Mouse RA0451-C1 1 ml Immunogen: Recombinant TTF-1 protein TRIM29 (Lung Squamous Cell Carcinoma Marker); Clone: NX2.1/690 Isotype: IgG1, kappa Clone TRIM29/1041 (Concentrate) Species Reac vity: Human, Mouse, and Rat. Others not known. Species: Mouse Posi ve Control: MAD109, MLE-15, H441-4, or H345 cells. Immunogen: Recombinant human TRIM29 protein fragment Normal thyroid or lung. (amino acids approximately 1-150) Specificity: Recognizes a protein of 40kDa, iden fied as thyroid Clone: TRIM29/1041 transcription factor 1 (TTF-1). Isotype: IgG2a, kappa Status: RUO Species Reactivity: Human. Others not known. Catalog Number Volume Positive Control: A431 cells. Tonsil or Squamous cell carcinoma. Specificity: This antibody recognizes a 66kDa protein, which is RA0312-C.1 0.1 ml identified as Tripartite motif-containing protein 29 (TRIM29). RA0312-C.5 0.5 ml Status: RUO Catalog Number Volume RA0454-C.1 0.1 ml RA0454-C.5 0.5 ml RA0454-C1 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
121 Antibodies
Tubulin-alpha (Microtubule Marker); Clone TU-02 Tyrosinase (Melanoma Marker); Clone OCA1/812 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Full length na ve protein corresponding to Pig Immunogen: Recombinant human tyrosinase protein alpha-tubulin Clone: OCA1/812 Clone: TU-02 Isotype: IgG2a, kappa Isotype: IgM, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human, Pig, Mouse, and Rat. Others not Posi ve Control: SK-MEL-13, SK-MEL-19, SK-MEL-30, SK-MEL- known. 37 cells or Melanoma. Posi ve Control: A431, HeLa or NIH/3T3 cells. Colon ssue. Specificity: Recognizes a cluster of proteins between 70-80kDa, Specificity: This an body recognizes an epitope on the N- identified as tyrosinase. Occasionally, a minor band at 55kDa is terminal structural domain of alpha-tubulin. also detected. This antibody shows no cross-reaction with MAGE- Status: RUO 1 and tyrosinase-related protein 1, TRP-1/gp75. Catalog Number Volume Status: RUO RA0324-C.1 0.1 ml Catalog Number Volume RA0324-C.5 0.5 ml RA0330-C.1 0.1 ml RA0330-C.5 0.5 ml Tubulin-alpha (Microtubule Marker); Clone TU-16 (Concentrate) Tyrosinase (Melanoma Marker); Clone T311 & Species: Mouse OCA1/812 (Concentrate) Immunogen: Full length na ve protein corresponding to Pig Species: Mouse alpha-tubulin. Immunogen: Recombinant human tyrosinase protein (T311 & Clone: TU-16 OCA1/812) Isotype: IgM, kappa Clone: T311 & OCA1/812 Species Reac vity: Human, Pig, Cow, Mouse, Rat, Hamster, Isotype: IgG2a, kappa (T311 & OCA1/812) Chicken, and many others. Species Reac vity: Human. Others not known. Posi ve Control: A431, HeLa, Raji, or NIH/3T3 cells. Colon Posi ve Control: SK-MEL-13, SK-MEL-19, SK-MEL-30, SK-MEL- tissue. 37 cells or Melanoma. Specificity: This an body recognizes an epitope of alpha- Specificity: Recognizes a cluster of proteins between 70-80kDa, tubulin. identified as tyrosinase. Occasionally, a minor band at 55kDa is Status: RUO also detected. This antibody shows no cross-reaction with MAGE- Catalog Number Volume 1 and tyrosinase-related protein 1, TRP-1/gp75. Status: RUO RA0325-C.1 0.1 ml RA0325-C.5 0.5 ml Catalog Number Volume RA0331-C.1 0.1 ml Tumor Endothelial Marker 8 (TEM8) / Anthrax RA0331-C.5 0.5 ml Toxin Receptor 1; Clone TEM8/589 (Concentrate) Tyrosinase (Melanoma Marker); Clone T311 Species: Mouse Immunogen: Recombinant human TEM8 protein (Concentrate) Clone: TEM8/589 Species: Mouse Isotype: IgG1, kappa Immunogen: Recombinant tyrosinase protein Species Reac vity: Human, Non-human Primates, Dog, and Clone: T311 Rabbit. Others not known. Isotype: IgG2a, kappa Posi ve Control: P23 cells. Colon or breast carcinoma. Species Reac vity: Human. Others not known. Specificity: This an body recognizes a protein of ~63kDa, Posi ve Control: SK-MEL-13, SK-MEL-19, SK-MEL-30, SK-MEL- identified as Tumor Endothelial Marker 8 (TEM8). 37 cells or Melanoma. Status: RUO Specificity: Recognizes a cluster of proteins between 70-80kDa, Catalog Number Volume identified as tyrosinase. Occasionally, a minor band at 55kDa is also detected. This antibody shows no cross-reaction with MAGE- RA0365-C.1 0.1 ml 1 and tyrosinase-related protein 1, TRP-1/gp75. RA0365-C.5 0.5 ml Status: RUO Catalog Number Volume RA0329-C.1 0.1 ml RA0329-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
122 Antibodies
Vimentin (Mesenchymal Cell Marker); Clone V9 von Willebrand Factor / Factor VIII Related-Ag (Concentrate) (Endothelial Marker); Clone 3E2D10 (Concentrate) Species: Mouse Species: Mouse Immunogen: Porcine eye lens Immunogen: Recombinant human vWF fragment spanning aa Clone: V9 845-949. Isotype: IgG1, kappa Clone: 3E2D10 Species Reactivity: Reacts with Human, Rat, Horse, Chicken, Isotype: IgG1, kappa Cow, Cat, Dog, and Pig. Does not react with Mouse. Species Reac vity: Human. Others not known. Positive Control: U-87, Raji, Jurkat or HeLa cells. Lymph node or Posi ve Control: HUVEC or Tonsil. tonsil. Specificity: This an body helps to establish the endothelial Specificity: This antibody reacts with a 58kDa protein identified nature of some lesions of disputed histogenesis, e.g. Kaposi's as vimentin. It shows no cross-reactivity with other closely sarcoma and cardiac myxoma. It is widely used for differentiating related intermediate filament proteins such as desmin, keratin, vascular lesions from those of other tissue differentiation within neurofilament, and glial fibrillary acid protein. a panel of other vascular markers, although not all tumors of Status: RUO endothelial differentiation contain this antigen. Catalog Number Volume Status: RUO RA0589-C.1 0.1 ml Catalog Number Volume RA0589-C.5 0.5 ml RA0339-C.1 0.1 ml RA0589-C1 1 Min RA0339-C.5 0.5 ml Vimentin (Mesenchymal Cell Marker); Clone von Willebrand Factor / Factor VIII Related-Ag VM452 (Concentrate) (Endothelial Marker); Clone IIIE2.34 (Concentrate) Species: Mouse Species: Mouse Immunogen: Human vimen n recombinant protein Immunogen: Recombinant human vWF fragment spanning aa Clone: VM452 845-949 Isotype: IgG1 Clone: IIIE2.34 Species Reac vity: Human, Cow, Dog, Cat, Pig, Goat and Isotype: IgG1, kappa Chicken. Does not react with Mouse and Rat. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: Jurkat cells, Sarcomas, Melanomas. Posi ve Control: HUVEC or Tonsil. Specificity: This an body reacts with a 58kDa protein iden fied Specificity: This an body helps to establish the endothelial as vimentin. It shows no cross-reaction with other closely related nature of some lesions of disputed histogenesis, e.g. Kaposi's intermediate filament proteins (IFP's) such as desmin, keratin, sarcoma and cardiac myxoma. It is widely used for differentiating neurofilament, and glial fibrillary acid protein. vascular lesions from those of other tissue differentiation within Status: RUO a panel of other vascular markers, although not all tumors of endothelial differentiation contain this antigen. Catalog Number Volume Status: RUO RA0337-C.1 0.1 ml Catalog Number Volume RA0337-C.5 0.5 ml RA0342-C.1 0.1 ml von Willebrand Factor / Factor VIII Related-Ag RA0342-C.5 0.5 ml (Endothelial Marker); Clone 3E2D10 & VWF635 von Willebrand Factor / Factor VIII Related-Ag (Concentrate) (Endothelial Marker); Clone VWF635 (Concentrate) Species: Mouse Immunogen: Recombinant human vWF fragment (3E2D10 & Species: Mouse VWF635). Immunogen: Recombinant human vWF fragment. Clone: 3E2D10 & VWF635 Clone: VWF635 Isotype: IgG1, kappa (3E2D10 & VWF635) Isotype: IgG1, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: HUVEC or Tonsil. Posi ve Control: HUVEC or Tonsil. Specificity: This an body helps to establish the endothelial Specificity: This an body helps to establish the endothelial nature of some lesions of disputed histogenesis, e.g. Kaposi's nature of some lesions of disputed histogenesis, e.g. Kaposi's sarcoma and cardiac myxoma. It is widely used for differentiating sarcoma and cardiac myxoma. It is widely used for differentiating vascular lesions from those of other tissue differentiation within vascular lesions from those of other tissue differentiation within a panel of other vascular markers, although not all tumors of a panel of other vascular markers, although not all tumors of endothelial differentiation contain this antigen. endothelial differentiation contain this antigen. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0341-C.1 0.1 ml RA0340-C.1 0.1 ml RA0341-C.5 0.5 ml RA0340-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
123 Antibodies
Wilm's Tumor 1 (WT1) (Wilm's Tumor & ZAP-70 [Zeta-chain (TCR) Associated Protein Mesothelial Marker); Clone 6F-H2 (Concentrate) Kinase 70kDa]; Clone 2F3.2 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant protein corresponding to residues 1- Immunogen: Recombinant ZAP-70 protein including residues 1- 181 of human WT1. 254 and encompassing the SH2 domains of human ZAP-70. Clone: 6F-H2 Clone: 2F3.2 Isotype: IgG1, kappa Isotype: IgG2a, kappa Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: K562 cells, Wilm's Tumor, or fetal kidney. Posi ve Control: Jurkat cells. Tonsil or lymph node. Specificity: Recognizes a 47-55kDa tumor suppressor protein, Specificity: Recognizes human ZAP-70; does not recognize identified as Wilm's Tumor (WT1) protein. This antibody reacts murine ZAP-70. with all isoforms of the full-length WT1 and also identifies WT1 Status: RUO lacking exon 2-encoded amino acids, frequently found in subsets Catalog Number Volume of sporadic Wilm's tumors. Status: RUO RA0345-C.1 0.1 ml RA0345-C.5 0.5 ml Catalog Number Volume RA0343-C.1 0.1 ml RA0343-C.5 0.5 ml Polyclonal Concentrate Wilm's Tumor 1 (WT1) (Wilm's Tumor & Mesothelial Marker); Clone WMT/857 AMACR / p504S (Prostate Cancer Marker); Rabbit (Concentrate) Polyclonal (Concentrate) Species: Mouse Species: Rabbit Immunogen: Recombinant human WT1 protein Immunogen: A synthe c pep de from human AMACR protein Clone: WMT/857 Clone: Rabbit Polyclonal Isotype: IgG1, kappa Isotype: IgG Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: K562 cells, Wilm's Tumor, or fetal kidney. Posi ve Control: HEK cells or Prostate Adenocarcinoma. Specificity: Recognizes a 47-55kDa tumor suppressor protein, Specificity: This an body recognizes a protein of 54kDa, which identified as Wilm's Tumor (WT1) protein. This antibody reacts is identified as AMACR, also known as p504S. with all isoforms of the full-length WT1 and also identifies WT1 Status: RUO lacking exon 2-encoded amino acids, frequently found in subsets Catalog Number Volume of sporadic Wilm's tumors. Status: RUO RA0354-C.1 0.1 ml RA0354-C.5 0.5 ml Catalog Number Volume RA0344-C.1 0.1 ml beta-Catenin (p120); Rabbit Polyclonal RA0344-C.5 0.5 ml (Concentrate) ZAP-70 (Chronic Lymphocytic Leukemia Marker); Species: Rabbit
Clone ZAP70/528 (Concentrate) Immunogen: A synthe c pep de from the middle of beta- Catenin (p120) protein Species: Mouse Clone: Polyclonal Immunogen: Recombinant human ZAP-70 protein Isotype: IgG Clone: ZAP70/528 Species Reac vity: Human and Mouse. Others not known. Isotype: IgG2a, kappa Posi ve Control: HeLa or MCF-7 cells. Breast carcinoma. Species Reactivity: Human. Others not known. Specificity: Immuno-staining of beta-catenin and E-cadherin is Positive Control: Jurkat cells. Tonsil or lymph node. helpful in the accurate identification of ductal and lobular Specificity: This antibody recognizes a 70kDa protein identified neoplasms, including a distinction between low-grade ductal as ZAP-70. carcinoma in situ (DCIS) and lobular carcinoma. Additionally, Status: RUO some rectal and gastric adenocarcinomas demonstrate diffuse Catalog Number Volume cytoplasmic beta-catenin staining and a lack of membranous staining, mimicking the staining pattern observed with lobular RA0453-C.1 0.1 ml breast carcinomas. RA0453-C.5 0.5 ml Status: RUO RA0453-C1 1 ml Catalog Number Volume RA0104-C.1 0.1 ml RA0104-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
124 Antibodies
CD8A (Cytotoxic & Suppressor T-Cell Marker); Napsin A (Lung Adenocarcinoma Marker); Rabbit Rabbit Polyclonal (Concentrate) Polyclonal (Concentrate) Species: Rabbit Species: Rabbit Immunogen: Human CD8 recombinant fragment corresponding Immunogen: A synthe c pep de to aa 200-250 (RFDPKASSSFQANGTKFAIQYGT) of human Napsin-A. Clone: Polyclonal Clone: Rabbit Polyclonal Isotype: IgG Isotype: IgG Species Reac vity: Human. Others not known. Species Reac vity: Human. Others not known. Posi ve Control: HuT78 or hPBL. Tonsil. Posi ve Control: Lung adenocarcinoma. Specificity: CD8 is a 68 kDa transmembrane glycoprotein Specificity: Immunohistochemical studies revealed high expressed as a heterodimer by a majority of thymocytes, and by expression levels of napsin A in human lung and kidney, but low major histocompatibility complex (MHC) class I restricted, expression in spleen. Napsin A is expressed in type II mature, suppressor/cytotoxic T-cells. pneumocytes and in adenocarcinomas of lung. Status: RUO Status: RUO Catalog Number Volume Catalog Number Volume RA0044-C.1 0.1 ml RA0348-C.1 0.1 ml RA0044-C.5 0.5 ml RA0348-C.5 0.5 ml Chromogranin A / CHGA (Neuroendocrine p40 (deltaNp63) (Squamous, Basal, or Marker); Polyclonal (Concentrate) Myoepithelial Cell Marker); Rabbit Polyclonal Species: Rabbit. (Concentrate) Immunogen: Recombinant human full-length Chromogranin A Species: Rabbit protein. Immunogen: A synthe c pep de (ENNAQTQFSEPQY) Clone: Polyclonal. corresponding to aa 5-17 of human p40 Isotype: IgG, kappa Clone: Rabbit Polyclonal Species Reactivity: Human. Does not react with rat. Others not Isotype: IgG known. Species Reac vity: Human, Mouse, Rat, and Cow. Others not Positive Control: PC12 cells. Adrenal gland, bowel, parathyroid, known. pancreas, or pheochromocytoma. Posi ve Control: HEK293 cells, Prostate Carcinoma, or Lung Specificity: Recognizes the Chromogranin A protein. Squamous Cell Carcinoma. Status: RUO Specificity: p40 (p63 delta) is a marker recently determined to Catalog Number Volume be highly specific for squamous basal cells in the immunohistochemistry (IHC) application. RA0518-C.1 0.1 ml Status: RUO RA0518-C.5 0.5 ml RA0518-C1 1 ml Catalog Number Volume RA0346-C.1 0.1 ml Helicobacter Pylori; Rabbit Polyclonal RA0346-C.5 0.5 ml (Concentrate) Species: Rabbit TIMP-3 (Tissue Inhibitor of Metalloproteinase-3); Immunogen: Total sonicate of Helicobacter pylori Rabbit Polyclonal (Concentrate) Clone: Rabbit Polyclonal Species: Rabbit Isotype: IgG Immunogen: Recombinant fragment corresponding to Human Species Reac vity: Helicobacter pylori TIMP3 aa 175-211 Posi ve Control: Helicobacter pylori infected stomach biopsy. Clone: Rabbit polyclonal Specificity: This an body stains the individual H. pylori Isotype: IgG bacterium when it presents on the surface of the epithelium or in Species Reac vity: Human, Mouse, Rat, Horse, Cow, and Dog. the cytoplasm of the epithelial cells in biopsy tissue sections from Others not known. the antrum and body of the stomach. Posi ve Control: Placenta or breast carcinoma. Status: RUO Specificity: The amino acid sequence (a a175-211) used as the Catalog Number Volume immunogen for anti-TIMP3 is 100% homologous in human, cow, dog and horse, and 94% homologous in mouse and rat. RA0379-C.1 0.1 ml Status: RUO RA0379-C.5 0.5 ml Catalog Number Volume RA0309-C.1 0.1 ml RA0309-C.5 0.5 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
125 Antibodies
Bcl-2; Clone 124 (Ready-To-Use) Monoclonal Ready-to-Use Species: Mouse Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Cys) of human Bcl-2 protein Clone: 124 Actin, Alpha-Smooth Muscle; Clone 1A4 (Ready-To- Isotype: IgG1, kappa Species Reactivity: Human. Does not react with Mouse and Rat. Use) Others not known. Species: Mouse Monoclonal Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Clone: 1A4 follicular lymphomas. Isotype: IgG2a,k Specificity: This antibody recognizes a protein of 25-26kDa, Species Reactivity: Human, Baboon, Cow, Rabbit, Mouse, Rat, identified as the Bcl-2 alpha oncoprotein. It shows no cross- Chicken. reaction with Bcl-x or Bax protein. Positive Control: Blood vessels Catalog Number Volume
Specificity: This antibody recognizes the a-smooth muscle form A00004-0002 2 ml of actin. It shows no cross reaction with actin from fibroblasts (b- A00004-0007 7 ml and g-cytoplasmic), striated muscle (a-sarcometric), and A00004-0025 25 ml myocardium (a-myocardial). Its epitope is composed of the acetyl group and the first 4 amino acids on the N-terminal end of the CA15-3; Clone GP1.4 (Ready-To-Use) peptidic chain of a-smooth actin. ScyTek's 1A4 stains smooth Species: Mouse Monoclonal muscle cells in vessel walls, gut wall, and myometrium. Isotype: IgG1 Myoepithelial cells in breast and salivary gland are also stained as Species Reactivity: Human they also contain this actin. Positive Control: Human Breast Catalog Number Volume Specificity: Human Breast Tumor Antigen (CA15-3). No cross- A00002-0002 2 ml reactivity with Human AFP, CEA, PAP, PSA, CA19-9, or CA125. A00002-0007 7 ml A00002-0025 25 ml Catalog Number Volume A00078-0002 2 ml Actin, Muscle Specific; Clone HHF35 (Ready-To-Use) A00078-0007 7 ml Species: Mouse Monoclonal A00078-0025 25 ml Clone: HHF35 Isotype: IgG1, kappa CA19-9; Clone 121SLE (Ready-To-Use) MW: 42kD Species: Mouse Species Reactivity: Human Clone: 121SLE Positive Control: Skeletal or cardiac muscle. Isotype: IgM, Kappa Species Reactivity: Human Specificity: This antibody is specific to alpha and gamma specific Cellular Localization: Lumenal surface and cytoplasm. actinisomers from skeletal, cardiac and smooth muscle but does Specificity: CA19-9, a carbohydrate epitope expressed on a high not recognize beta and non-smooth muscle gamma actin MW (>400kDa) mucin glycoprotein, is a sialyl Lewisa structure isomers. In western blot, HHF35 detects a 42kD protein extract which is synthesized from type 1 blood group precursor chains from skeletal muscle but not from epithelial cell lines. and is present in individuals expressing the Lewisa and/or Lewisb Catalog Number Volume blood group antigens. In normal tissues, sialyl Lewisa antigen is present in ductal epithelium of the breast, kidney, salivary gland, A00001-0002 2 ml and sweat glands. Its expression is greatly enhanced in serum as A00001-0007 7 ml well as in the majority of tumor cells in gastrointestinal (GI) A00001-0025 25 ml carcinomas, including adenocarcinomas of the stomach, intestine, and pancreas. Preoperative elevated CA19-9 levels in Bcl-2; Clone 100/D5 (Ready-To-Use) patients with stage I pancreatic carcinoma decrease to normal Species: Mouse values following surgery. When used serially, CA19-9 can predict Clone: 100/D5 recurrence of disease prior to radiographic or clinical findings. Isotype: Mouse IgG1, Kappa Catalog Number Volume Species Reactivity: Human, Monkey. Others not tested. Positive Control Tonsil. A00107-0002 2 ml Cellular Localization: Cytoplasmic & Cell Membrane. A00107-0007 7 ml Specificity: Human Bcl-2 alpha is a 239 amino acid (aa) protein A00107-0025 25 ml and human Bcl-2 beta is a 205 aa protein. The 100/D5 antibody [also known as clone Bcl-2/100 (Kren, 2004, Kaur, 2004)] recognizes both Bcl-2 isoforms (Pezzela et al, 1990). Catalog Number Volume A00119-0002 2 ml A00119-0007 7 ml A00119-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
126 Antibodies
Carcinoembryonic Antigen, Pan (CEA); Clone COL-1 CD20, B-Cell; Clone L26 (Ready-To-Use) (Ready-To-Use) Species: Mouse Monoclonal Species: Mouse Clone: L26 Immunogen: BALB/c mice were injected with an extract of Isotype: IgG2a,k human colon carcinoma. MW: 33 kD and 30 kD Clone: COL-1 Species Reactivity: Human Isotype: IgG1 Kappa Positive Control: Tonsil Species Reactivity: Human. Others not tested. Positive Control: Colon Adenocarcinoma. Specificity: This antibody is specific to a 33 kD polypeptide Specificity: This antibody labels the CEA-positive glycocalyx present on the majority of B cells in peripheral blood and surface of gastrointestinal cells and is useful for the identification lymphoid tissue and also with a minor component of 30 kD. No of colon carcinomas. reactivity with other haematopoietic cells has been observed. Catalog Number Volume Catalog Number Volume A00135-0002 2 ml A00003-0002 2 ml A00135-0007 7 ml A00003-0007 7 ml A00135-0025 25 ml A00003-0025 25 ml CD10, CALLA (Neutral Endopeptidase); Clone 56C6 CD23, B-Cell; Clone MHM6 (Ready-To-Use) Species: Mouse Species: Mouse Clone: MHM6 Immunogen: Recombinant human CD10 protein fragment. Isotype: IgG1, Kappa Clone: 56C6 Isotype: IgG1, kappa Specificity: In lymphoid tissue, the antibody labels a variable Species Reactivity: Human, Rat. Others not tested. proportion of mantle zone lymphocytes and a fraction of Positive Control: Kidney, small intestine, or tonsil. dendritic reticulum cells. In lymph nodes with progressive Specificity: Recognizes a 100kDa glycoprotein, identified as germinal centre transformation, the number and staining CD10, also known as Common Acute Lymphatic Leukemia intensity of small follicular lymphocytes are increased. Essentially Antigen (CALLA). no staining is seen on splenic marginal zone lymphocytes.
Catalog Number Volume The CD23 an gen is expressed on neaopla c cells from cases of A00091-0002 2 ml B-Cell chronic lymphocytic leukemia and some cases of A00091-0007 7 ml centroblastic/centrocytic lymphoma, but not in other types of A00091-0025 25 ml lymphoid neoplasms. Catalog Number Volume CD15 / FUT4; Clone Leu-M1 (Ready-To-Use) A20081 2 ml Species: Mouse A00081 6 ml Immunogen: U937 his ocy c cell line A00081.0025 25 ml Clone: Leu-M1 Isotype: IgM, kappa CD30, Ki-1 Antigen; Clone Ber-H2 (Ready-To-Use) Species Reac vity: Human. Others not known. Posi ve Control: U937 cells, Reed-Sternberg's cells in Hodgkin's Species: Mouse lymphoma. Immunogen: Cancer cell line established from a patient with Specificity:This an body reacts with a 220 kDa protein, CD15 / Hodgkin's disease of T-cell lineage FUT4 expressed on Reed-Sternberg cells. Clone: Ber-H2 Isotype: IgG1, kappa Catalog Number Volume Species Reactivity: Human. Others not known. A00151-0002 2 ml Positive Control: Hodgkin's lymphoma A00151-0007 7 ml Specificity: Recognizes a single chain glycoprotein of A00151-0025 25 ml 105/120kDa, identified as CD30/Ki-1. This Mab distinguishes large cell lymphomas derived from activated lymphoid cells from histiocytic malignancies and lymphomas derived from resting and precursor lymphoid cells or from anaplastic carcinomas. umor cells of a majority of anaplastic large cell lymphomas, and by a varying proportion of activated T and B cells. Catalog Number Volume A00016-0002 2 ml A00016-0007 7 ml A00016-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
127 Antibodies
CD31, Endothelial Cell; Clone JC/70A (Ready-To- CD34, Endothelial Cell; Clone QBEnd/10 (Ready-To- Use) Use) Species: Mouse Species: Mouse Immunogen: Membrane prepara on of a spleen from a pa ent Immunogen: Detergent solubilized vesicular suspension with hairy cell leukemia. prepared from human term placenta Clone: JC/70A Clone: QBEnd/10 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reac vity: Human, Cynomolgus Monkey, and Rabbit. Species Reac vity: Human, Cynomolgus Monkey, Rhesus Others not known. Monkey. Does not react with rat, sheep, cow and dog. Others not Posi ve Control: Tonsil, Angiosarcoma. known. Specificity: An -CD31 has shown to be highly specific and Posi ve Control: KG-1 cells, Tonsil, or Angiosarcoma sensitive for vascular endothelial cells. Staining of nonvascular Specificity: This an body recognizes a single chain, tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 transmembrane, heavily glycosylated protein of 90-120kDa, reacts with normal, benign, and malignant endothelial cells which is identified as CD34. On the basis of differential sensitivity which make up blood vessel lining. to degradation by specific enzymes, epitopes of monoclonal Catalog Number Volume antibodies to CD34 are classified into three main categories, class I, class II and class III. It is a class II antibody whose epitope is A00009-0002 2 ml resistant to neuraminidase but sensitive to glycoprotease and A00009-0007 7 ml chymopapain. Anti-CD34 labels > 85% of angiosarcoma and A00009-0025 25 ml Kaposi's sarcoma, but with a lower specificity. CD31; Clone C31.3 (Ready-To-Use) Catalog Number Volume A00070-0002 2 ml Species: Mouse Clone: C31.3 A00070-0007 7 ml Isotype: Mouse IgG1, Kappa A00070-0025 25 ml Species Reactivity: Human. Positive Control: Tonsil, Liver, Kidney. CD43 (T-Cell); Clone DF-T1 (Ready-To-Use) Specificity: The CD31 antibody (clone C31.3 or PECAM-1) is Species: Mouse widely used as a pan-endothelial cell marker to demonstrate the Immunogen: Myeloblastic KG1 cells presence of endothelial cells in tissue sections by Clone: DF-T1 immunohistochemistry. The CD31 (PECAM-1) antibody reacts Isotype: IgG1, kappa with normal, benign, and malignant endothelium. Species Reactivity: Human. Others not known. Catalog Number Volume Positive Control: Paracortex in a tonsil or a reactive lymph node. Specificity: This antibody recognizes a cell surface glycoprotein A00126-0002 2 ml of 95/115/135kDa (depending upon the extent of glycosylation), A00126-0007 7 ml identified as CD43 [Workshop IV]. A00126-0025 25 ml Catalog Number Volume CD31; Clone C31.7 (Ready-To-Use) A00082-0002 2 ml Species: Mouse A00082-0007 7 ml Clone: C31.7 A00082-0025 25 ml Isotype: IgG1, Kappa Species Reactivity: Human. CD45, Leucocyte Common Antigen (LCA); Clones Cellular Localization: Primarily membrane. PD7/26 & 2B11 (Ready-To-Use) Specificity: This antibody recognizes a 100kDa glycoprotein in Species: Mouse endothelial cells and 130kDa in platelets. This antibody reacts Immunogen: Isolated neoplas c cells from T-cell lymphoma with endothelial cells in normal tissues and in benign and (2B11); human peripheral blood lymphocytes maintained in T- malignant proliferations. In cryostat sections and blood smears cell growth factor (PD7/26). the antibody also stains megakaryocytes, platelets and Clone: 2B11 & PD7/26 occasionally plasma cells. It reacts weakly with mantle zone B Isotype: IgG1, kappa (2B11); IgG1, kappa (PD7/26). cells, peripheral T cells, and neutrophils. Antibody to CD31 is of Species Reac vity: Human. Others not known. value in the study of benign and malignant vascular tumors. Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. Staining for CD31 has also been used to measure angiogenesis, Specificity: This an body recognizes the CD45 leukocyte which reportedly predicts tumor recurrence. common antigen (LCA) family. Catalog Number Volume Catalog Number Volume A00110-0002 2 ml A00017-0002 2 ml A00110-0007 7 ml A00017-0007 7 ml A00110-0025 25 ml A00017-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
128 Antibodies
CD45; Clone 2B11 (Ready-To-Use) CD45RO, T-Cell; Clone UCHL1 (Ready-To-Use) Species: Mouse Species: Mouse Monoclonal Clone: 2B11 Clone: UCHL1 Isotype: Mouse IgG1, Kappa Isotype: IgG2a,k Species Reactivity: Human. Species Reactivity: Human, Rhesus Monkey. Does not react with Positive Control: Tonsil. Rat. Specificity: This antibody is specific for hematopoietic cells, Positive Control: Tonsil or Lymph Node. including basophils, granulocytes, lymphocytes, macrophages / histiocytes, mast cells, monocytes, plasma cells; NOT mature red Specificity: This antibody reacts with a 180 kD glycoprotein of blood cells and their immediate progenitors, platelets or CD45 family, occurring on most thymocytes and activated T cells megakaryocytes, Dendritic cells, medullary thymocytes. but only on the portion of the resting T cells. It reacts with most Catalog Number Volume thymocytes, a subpopulation of resting cells within both the CD4 and CD8 subsets and mature activated T cells. This antibody A00129-0002 2 ml shows no reactivity with normal B or natural killer cells, but A00129-0007 7 ml reacts with granulocytes and monocytes. Though this antibody is A00129-0025 25 ml useful to identify T-cell lymphomas and leukemia, rare staining with B cell lymphomas reported. CD45RA (LCA); Clone 158-4D3 (Ready-To-Use) Catalog Number Volume Species: Mouse A00024-0002 2 ml Clone: 158-4D3 Isotype: Mouse IgG2a, Kappa A00024-0007 7 ml Species Reactivity: Human. Others not tested. A00024-0025 25 ml Positive Control: Tonsil, Spleen. Specificity: The CD45RA 158-4D3 antibody clone reacts with the CD5 (Mantel Cell Lymphoma Marker); 4C7 ABC and BC isoforms (Schlossman et al, 1995). CD45RA has a Species: Mouse Monoclonal molecular weight of 205-220 kDa. Clone: 4C7 Catalog Number Volume Isotype: IgG1 Species Reactivity: Human A00123-0002 2 ml A00123-0007 7 ml Specificity: This antibody recognizes a 67kD transmembrane A00123-0025 25 ml protein, which is identified as CD5. The CD5 antigen is found on 95% of thymocytes and 72% of peripheral blood lymphocytes. In CD45RB; Clone PD7/26 (Ready-To-Use) lymph nodes, the main reactivity is observed in T cells. CD5 is Species: Mouse expressed by many T cell leukemia, lymphomas, and activated T Clone: PD7/26 cells. Occasionally, CD5 antigen is also expressed on a subset of B Isotype: Mouse IgG1 cells. Mantle cell lymphomas (same as diffuse centrocytic Species Reactivity: Human. lymphomas) are CD5+ while the follicle center cell lymphoma are Positive Control: Tonsil. CD5-. Specificity: This antibody is specific for hematopoietic cells, Catalog Number Volume including basophils, granulocytes, lymphocytes, A20090 2 ml macrophages/histiocytes, mast cells, monocytes, plasma cells; NOT mature red blood cells and their immediate progenitors, A00090 6 ml platelets or megakaryocytes, dendritic cells, medullary A00090.0025 25 ml thymocytes. CD45RB is highly expressed on memory B cells and A00090.050 50 ml plasmablasts but not on naïve B cells, Langerhans cells and some T cells, B cells, monocytes, macrophages, granulocytes. CD56; Clone 123C3 (Ready-To-Use) Catalog Number Volume Species: Mouse Clone: 123C3 A00130-0002 2 ml Isotype: Mouse IgG1, Kappa A00130-0007 7 ml Species Reactivity: Human. A00130-0025 25 ml Positive Control: Tonsil, Neuroblastoma, Pancreatic Islet cells. Specificity: This antibody recognizes two proteins (185kDa & 145kDa), identified as two isoforms of neural cell adhesion molecule (NCAM/CD56). It is used as a tumor marker in various cancers such as NK lymphomas and Merkel cell carcinoma. NCAM is expressed on most neuroectodermal derived lines, tissues, and neoplasms such as retinoblastoma, medulloblastoma, astrocytoma, and neuroblastoma. It is also expressed on some mesodermally derived tumors such as rhabdomyosarcoma and also on natural killer cells. Catalog Number Volume A00121-0002 2 ml A00121-0007 7 ml A00121-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
129 Antibodies
CD57 (HNK-1); Clone NK-1 (Ready-To-Use) CDX2; Clone EP25 (Ready-To-Use) Species: Mouse Species: Rabbit Clone: NK-1 Immunogen: Rabbits were injected with a synthe c pep de Isotype: Mouse IgM, Kappa corresponding to residues near the C-terminus of human CDX-2. Species Reactivity: Human. Clone: EP25 Positive Control: Tonsil, spleen, lymph node. Isotype: Rabbit IgG Specificity: The NK1 antibody clone recognizes the glycoepitope Species Reac vity: Human referred to as both CD57 and HNK1. Posi ve Control: Colon for normal ssue and colon Catalog Number Volume adenocarcinoma for abnormal tissue. Specificity: CDX-2 expression is restricted to nuclear staining in A00117-0002 2 ml positive cells. A00117-0007 7 ml Catalog Number Volume A00117-0025 25 ml A00147-0002 2 ml CD74; Clone LN2 (Ready-To-Use) A00147-0007 7 ml Species: Mouse A00147-0025 25 ml Clone: LN2 Isotype: IgG1,k c-erbB-2 Oncoprotein; Clone SP3 (Ready-To-Use) MW: 35 kD Species: Rabbit Species Reactivity: Human Clone: SP3 Mol. Weight: 185kD Specificity: This antibody reacts with 35 kD antigen present on Isotype: IgG the nuclear membrane protein related to the invariant chain of Species Reactivity: Human. Others not tested. the HLA-Dr antigen. This antibody reacts with the germinal Positive Control: Breast carcinoma. center and mantle zone B lymphocytes, interdigitating histiocytes Cellular Localization: Cell membrane. in T cell zones and mononuclear cells and Reed-Sternberg cells in Hodgkin's disease. Specificity: c-erbB-2 is a receptor tyrosine of the c-erbB family. It Catalog Number Volume is closely related in structure to the epidermal growth factor receptor. C-erbB-2 oncoprotein is detectable in a proportion of A00048-0002 2 ml breast and other adenocarcinomas, as well as transitional cell A00048-0007 7 ml carcinomas. A00048-0025 25 ml Catalog Number Volume CD75 (B-Cell Marker); Clone LN1 (Ready-To-Use) A00100-0002 2 ml Species: Mouse A00100-0007 7 ml Immunogen: Nuclei from pokeweed mitogen-stimulated A00100-0025 25 ml peripheral blood lymphocytes. Clone: LN1 Chromogranin A; Clone A3 Isotype: IgM, Kappa. Species: Mouse Monoclonal Species Reactivity: Human, Others-not known Clone: A3 Positive Control: HeLa or Daudi Cells. Germinal center B-cells in a Isotype: IgG2b,k lymph node or tonsil. Use LN1's ability to stain surface of Species Reactivity: Human erythrocytes as an internal positive control. Specificity: Recognizes a neuraminidase-sensitive sialoprotein Specificity: Chromogranin A is a 439 amino acid protein present (CDw75), present on cell membrane and cytoplasm of germinal in secretory granules of a wide variety of endocrine cells and center B-cells and derived lymphomas. This antibody reacts with neurons. A positive staining is seen in the secretory granules of RBC precursors of bone marrow, ductal, and ciliated epithelial parathyroid, adrenal medulla, anterior pituitary gland and cells of kidney, breast, prostate, pancreas, lung, and with Langerhans islets of the pancreas. This antibody stains a variety glioblastomas, astrocytomas, and Reed Sternberg cells in of neuroendocrine tumors. lymphocyte predominant Hodgkin's disease. Catalog Number Volume Catalog Number Volume A20097 2 ml A00047-0002 2 ml A00097 6 ml A00047-0007 7 ml A00097.0025 25 ml A00047-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
130 Antibodies
Chromogranin A; Clones LK2H10 & PHE5 (Ready-To- Cytokeratin 19; Clone A53-B/A2.26 (Ready-To-Use) Use) Species: Mouse Species: Mouse Clone: A53-B/A2.26 (Ks 19.1) Immunogen: Human pheochromocytoma (LK2H10 & PHE5). Isotype: Mouse IgG2a, Kappa Clone: LK2H10 & PHE2 Species Reactivity: Human. Reacts weakly with mouse, rat and Isotype: IgG1, Kappa (Both) guinea pig Cytokeratin 19. Species Reactivity: Human, Monkey, Pig, Mouse and Rat. Others- Positive Control: Skin, Breast carcinoma, Colon carcinoma, not known Thyroid. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Specificity: This antibody reacts with the rod domain of human pancreas, or pheochromocytoma. Cytokeratin 19, a polypeptide of 40kDa. The antibody recognition Specificity: Chromogranin A is present in neuroendocrine cells epitope maps between amino acid 312-335. This antibody reacts throughout the body, including the neuroendocrine cells of the with the MCF-7 cells which are known to contain Cytokeratin 19. large and small intestine, adrenal medulla and pancreatic islets. Catalog Number Volume It is an excellent marker for carcinoid tumors, A00122-0002 2 ml pheochromocytomas, paragangliomas, and other neuroendocrine tumors. A00122-0007 7 ml A00122-0025 25 ml Catalog Number Volume A00160-0002 2 ml Cytokeratin 19; Clone BA17 (Ready-To-Use) A00160-0007 7 ml Species: Mouse Monoclonal A00160-0025 25 ml Clone: BA 17 Isotype: IgG1 Cytokeratin (Pan); Clone Cocktail (Ready-To-Use) MW: 40 kD Species: Mouse Species Reactivity: Human Immunogen: Multiple Clone: Multiple Specificity: It is the smallest human keratin found in most simple Isotype: IgG and non-keratinizing stratified epithelia. This antigen is not Species Reactivity: Human present in adult intrafollicular epidermis. The antibody stains Positive Control: Skin most of the epithelial cell types including ductual and glandular Cellular Localization: Cytoplasmic epithelia. Specificity: This antibody cocktail reacts with keratins 4, 5, 6, 7, Catalog Number Volume 8, 10, 13, 14, 15, 16, 18, and 19. Cytokeratin (Pan) differentiates A00094-0002 2 ml epithelial tumors from non-epithelial tumors. A00094-0007 7 ml Catalog Number Volume A00094-0025 25 ml A00098-0002 2 ml A00098-0007 7 ml Cytokeratin 20; Clone EP23 (Ready-To-Use) A00098-0025 25 ml Species: Rabbit Immunogen: Rabbits were injected with a synthe c pep de Cytokeratin 10; Clone DE-K10 (Ready-To-Use) corresponding to residues near the C-terminus in human CK20 Species: Mouse protein. Immunogen: Cytoskeletal preparation extracted from human Clone: EP23 ectocervical epithelium. Isotype: Rabbit IgG Clone: DE-K10 Species Reac vity: Human Isotype: IgG1, kappa Posi ve Control: Colon for normal ssue and colon cancer for Species Reactivity: Human, Dog and Cat. Others not known. abnormal tissue. Positive Control: Esophagus or Tonsil. A431, HeLa, MCF7 cells. Specificity: CK20 expression is restricted to cytoplasmic / cell Specificity: This antibody recognizes a protein of 56.5kDa surface staining in positive cells. identified as Cytokeratin 10. Catalog Number Volume Catalog Number Volume A00146-0002 2 ml A00089-0002 2 ml A00146-0007 7 ml A00089-0007 7 ml A00146-0025 25 ml A00089-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
131 Antibodies
Cytokeratin 5,6 Cocktail; Clones EP42 & EP67 Cytokeratin 8; Clone K8/383 (Ready-To-Use) (Ready-To-Use) Species: Mouse Species: Rabbit Clone: K8/383 Designation: Rabbit Monoclonal Cocktail Isotype: IgG1 Clone: EP42 & EP67 Species Reactivity: Human, Rat. Others not tested. Isotype: IgG Positive Control: MCF-7 or A431 cells. Human Skin, Colon, Lung Species Reactivity: Human. Others not tested. or Breast carcinoma. Positive Control: Skin for normal tissue, Lung Squamous Cell Specificity: Cytokeratin 8 Antibody belongs to the type II (or B or Carcinoma or Mesothelioma for abnormal tissue. Basic) subfamily of high molecular weight Cytokeratins and exists Specificity: Cytokeratin 5,6 is expressed in many non-keratinizing in combination with Cytokeratin 18. Cytokeratin 8 is primarily stratified squamous epithelia including: basal epithelia, hair found in the non-squamous epithelia and is present in a majority follicles, trachea, tongue mucosa, as well as basal cells in of adenocarcinomas and ductal carcinomas. It is absent in prostate glands and myoepithelial cells in mammary glands. squamous cell carcinomas. Cytokeratin 5,6 protein is also found in most epithelial and Catalog Number Volume bispasic mesotheliomas, large cell carcinoma and pulmonary A00136-0002 2 ml squamous cell carcinomas. A00136-0007 7 ml Catalog Number Volume A00136-0025 25 ml A00141-0002 2 ml A00141-0007 7 ml Cytokeratin, High Molecular Weight; Clone 34bE12 A00141-0025 25 ml (Ready-To-Use) Species: Mouse Cytokeratin 6; Clone EP67 (Ready-To-Use) Immunogen: Solubilized kera n extract from human stratum Species: Rabbit corneum Designation: Rabbit Monoclonal Clone: 34BE12 Clone: EP67 Isotype: IgG1, kappa Isotype: IgG Species Reac vity: Human, Mouse, and Rat. Others not known. Species Reactivity: Human. Others not tested. Posi ve Control: PC12 cells, skin, prostate carcinoma. Positive Control: Skin for normal tissue and Mesothelioma for Specificity: This an body recognizes CK1, CK5, CK10, and CK14. abnormal tissue. In normal epithelia, it stains stratified epithelia, myoepithelial Specificity: Cytokeratin 6 is expressed in many non-keratinizing cells, and basal cells in the prostate gland and bronchi. This stratified squamous epithelia of large cell carcinoma and antibody shows no reactivity with hepatocytes, pancreatic acinar pulmonary squamous cell carcinomas. It can also be found on cells, proximal renal tubules, or endometrial glands; there is no stratified epithelia including: basal layer of epidermis, the outer reactivity with cells derived from simple epithelia. Mesenchymal root sheath of hair follicles, esophagus, oral mucosa, as well as tumors, lymphomas, melanomas, neural tumors, and basal cells in prostate glands and myoepithelial cells in mammary neuroendocrine tumors are negative with this antibody. glands. Catalog Number Volume Catalog Number Volume A00071-0002 2 ml A00140-0002 2 ml A00071-0007 7 ml A00140-0007 7 ml A00071-0025 25 ml A00140-0025 25 ml Cytokeratin, Multi (Acidic); Clone AE1 (Ready-To- Cytokeratin 7; Clone OV-TL12/30 (Ready-To-Use) Use) Species: Mouse Species: Mouse Monoclonal Clone: OV-TL12/30 Clone: AE-1 Isotype: IgG1 Isotype: IgG1 Species Reactivity: Human. Others not tested. MW: 56.5, 50, 50', 48 and 40 kD Positive Control: Carinoma of Ovary, Lung, Cervix or Breast. Species Reactivity: Human, Monkey, Cow, Rabbit, Mouse, Rat, Specificity: Cytokeratin 7 expression is restricted to most Chicken. Others not tested. glandular and transitional epithelia including lung, breast, Positive Control: Human epidermal keratin or carcinoma. HT29 bladder and female genital tract and their adenocarcinomas, but cells. not in most gastrointerstinal epithelium, prostate, hepatocyte and squamous epithelium. Specificity: Monoclonal antibody AE1 recognizes the 56.5, 50, Catalog Number Volume 50', 48, and 40kDa keratins of the acidic subfamily. Twenty human keratins are resolved with two-dimensional gel A00142-0002 2 ml electrophoresis into acidic (pI<5.7) and basic (pI>6.0) subfamilies. A00142-0007 7 ml The acidic keratins have molecular weights of 56.5, 55, 51, 50, A00142-0025 25 ml 50', 48, 46, 45, and 40kDa. Catalog Number Volume A00051-0002 2 ml A00051-0007 7 ml A00051-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
132 Antibodies
Cytokeratin, Multi (Basic); Clone AE-3 (Ready-To- Epithelial Membrane Antigen; Clone E29 (Ready- Use) To-Use) Species: Mouse Species: Mouse Immunogen: Human epidermal keratin Immunogen: Delipidated extract of human milk fat globule Clone: AE-3 membranes Isotype: IgG1, kappa Clone: E29 Species Reactivity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Isotype: IgG2a, kappa Rat, Chicken. Others not known. Species Reac vity: Human. Reacts moderately with Pig and Positive Control: Epithelial cells, skin or adenocarcinomas. Dog. Others not known. Specificity: This antibody recognizes basic (Type II or HMW) Posi ve Control: MCF-7 or MDA-231 cells. Breast or colon cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa carcinoma. (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8). Specificity: In Western blo ng, this an body recognizes Catalog Number Volume proteins in a MW range of 265-400kDa, identified as different glycoforms of MUC1. This antibody reacts with the DTRP epitope A00052-0002 2 ml within the tandem repeats. In immunohistochemical assays, it A00052-0007 7 ml superbly stains routine formalin/paraffin carcinoma tissues. An A00052-0025 25 ml antibody to MUC1 is useful as a pan-epithelial marker for detecting early metastatic loci of carcinoma in bone marrow or Cytokeratin, Pan; Clones AE1 & AE3 (Ready-To-Use) liver. Species: Mouse Catalog Number Volume Immunogen: Human epidermal keratin A00008-0002 2 ml Clone: AE-1 & AE-3 A00008-0007 7 ml Isotype: IgG1, kappa (AE-1); IgG1, kappa (AE-3) Species Reactivity: Human, Monkey, Cow, Dog, Rabbit, Mouse, A00008-0025 25 ml Rat, Chicken. Others not known. Positive Control: Skin, Adeno- or Squamous carcinomas. GFAP; Clone ASTRO/789 (Ready-To-Use) Specificity: This antibody cocktail recognizes acidic (Type I or Species: Mouse LMW) and basic (Type II or HMW) cytokeratins, which include Immunogen: Recombinant GFAP protein 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa Clone: ASTRO/789 (CK6); 52kDa (CK8); 56.5kDa (CK10); 50kDa (CK14); 50kDa Isotype: IgG1 (CK15); 48kDa (CK16); 40kDa (CK19). This antibody stains Species Reac vity: Human, Mouse, Rat, Cow, Pig, Rabbit, and cytokeratins present in normal and abnormal human tissues and Chicken. Others not known. has shown high sensitivity in the recognition of epithelial cells Posi ve Control: Brain or Astrocytoma. and carcinomas. Specificity: This an body recognizes a protein of ~50kDa which Catalog Number Volume is identified as Glial Fibrillary Acidic Protein (GFAP). It shows no cross-reaction with other intermediate filament proteins. A00152-0002 2 ml A00152-0007 7 ml Catalog Number Volume A00152-0025 25 ml A00158-0002 2 ml A00158-0007 7 ml Desmin, Clone D33 (Ready-To-Use) A00158-0025 25 ml Species: Mouse Immunogen: Proteins from human Leiomyoma. Glial Fibrillary Acidic Protein (GFAP); Clone GA-5 Clone: D33 (Ready-To-Use) Isotype: IgG1, kappa Species: Mouse Species Reactivity: Human, Rat, Mouse, Hamster, Chicken. Immunogen: Porcine Spinal Chord Others not known. Mol. Weight: 51-52kDa Positive Control: Muscle, Uterus, Leiomyosarcoma or SJRH30 Clone: GA-5 cells. Isotype IgG1 Specificity: Desmin, Clone D33 detects cells of normal smooth, Species Reactivity: Human, Pig, Rat, and Chicken. Others not skeletal, and cardiac muscles. This antibody reacts with tested. leiomyomas, leiomyosarcoma, rhabdomyomas, Positive Control: IMR5, Brain, or Astrocytoma. rhabdomyosarcoma, and perivascular cells of glomus tumors of Cellular Localization: Cytoplasmic. the skin. Catalog Number Volume Specificity: Glial Fibrillary Acidic Protein (GFAP) is specific to astrocytes and ependymal cells of the central nervous system. A00007-0002 2 ml This product effectively stains astrocytes, glial cells, ependymal A00007-0007 7 ml cells and their associated tumors. A00007-0025 25 ml Catalog Number Volume A00102-0002 2 ml A00102-0007 7 ml A00102-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
133 Antibodies
Hairy Cell Leukemia; Clone DBA.44 (Ready-To-Use) Lambda Light Chain; Clone LcN-2 (Ready-To-Use) Species: Mouse Species: Mouse Clone: DBA.44 Immunogen: Purified human IgG Isotype: IgM, Kappa Clone: LcN-2 Species Reactivity: Human Isotype: IgG2a, kappa Species Reactivity: Human. Others not known. Specificity: This antibody reacts with over 97% of hairy cell Positive Control: 293T, Raji or hPBL cells. Tonsil or spleen. leukaemia as well as about 35% of high grade B cell lymphomas. Specificity: This monoclonal antibody is specific to the lambda It reacts with B lymphocytes, cells of mantle zone and light chain of immunoglobulins and shows no cross-reaction with immunoblasts outside the lymphoid tissues. the kappa light chain or any of the five heavy chains. Catalog Number Volume Catalog Number Volume A00015-0002 2 ml A00155-0002 2 ml A00015-0007 7 ml A00155-0007 7 ml A00015-0025 25 ml A00155-0025 25 ml Insulin; Clone 2D11-H5 (Ready-To-Use) MART-1; Clone M2-7C10 (Ready-To-Use) Species: Mouse Species: Mouse Clone: 2D11-H5 Clone: M2-7C10 Isotype: Mouse IgG1, Kappa Isotype: Mouse IgG2b, Kappa Species Reactivity: Human, Pig, Cow. Species Reactivity: Human. Clone M2-7C10 does not react with Positive Control: Pancreatic tissue. mouse or rat. Specificity: Detects insulin and insulin producing cells. Positive Control: Metastatic melanoma in lymph nodes. Catalog Number Volume Specificity: The clone M2-7C10 MART-1 antibody labels melanomas and other tumors showing melanocyte A00114-0002 2 ml differentiation. A00114-0007 7 ml Catalog Number Volume A00114-0025 25 ml A00115-0002 2 ml Kappa, Light Chain; Clone KLC264 (Ready-To-Use) A00115-0007 7 ml Species: Mouse A00115-0025 25 ml Immunogen: Recombinant human Ig kappa chain Clone: KLC264 MART-1; Clone M2-9E2 (Ready-To-Use) Isotype: IgG1, kappa Species: Mouse Species Reactivity: Human. Others not known. Clone: M2-9E2 Positive Control: 293T, Raji or hPBL cells. Tonsil or Spleen. Isotype: Mouse IgG2b, Kappa Specificity: This monoclonal antibody is specific to the kappa Species Reactivity: Human, Mouse, Rat. light chain of immunoglobulins and shows no cross-reaction with Positive Control: Metastatic melanoma in lymph nodes. the lambda light chain or any of the five heavy chains. Specificity: The clone M2-9E2 MART-1 antibody labels Catalog Number Volume melanomas and other tumors showing melanocyte differentiation. A00156-0002 2 ml A00156-0007 7 ml Catalog Number Volume A00156-0025 25 ml A00116-0002 2 ml A00116-0007 7 ml Kappa; Clone L1C1 (Ready-To-Use) A00116-0025 25 ml Species: Mouse Clone: L1C1 MART-1; Clones M2-7C10 & M2-9E3 (Ready-To- Isotype: Mouse IgG1, Kappa Use) Species Reactivity: Human. Species: Mouse Positive Control: Tonsil. Clones: M2-7C10 & M2-9E3 Specificity: The kappa light chain antibody recognizes the kappa Isotype: Mouse IgG2b, kappa light chain of immunoglobulin. Species Reactivity: Human. Catalog Number Volume Positive Control: Human Melanoma. Specificity: MART-1 has been shown to be a very specific marker A00113-0002 2 ml for melanomas. A00113-0007 7 ml A00113-0025 25 ml Catalog Number Volume A00133-0002 2 ml A00133-0007 7 ml A00133-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
134 Antibodies
Melanoma Associated Antigen; Clone KBA.62 MIC2 Gene Protein, CD99; Clone HO36-1.1 (Ready- (Ready-To-Use) To-Use) Species: Mouse Species: Mouse Immunogen: Human KAL cells derived from lymph node Immunogen: Purified E-rosette forming cells from human metastasis of malignant melanoma peripheral blood lymphocytes. Clone: KBA.62 Clone: HO36-1.1 Isotype: IgG1, kappa Isotype: IgM, Kappa. Species Reactivity: Human. Others not known. Species Reactivity: Human and Rat. Others-not known Positive Control: Melanoma Positive Control: Pancreas or Ewing's sarcoma. Cellular Localization: Cell Surface Specificity: Recognizes a sialoglycoprotein of 27-32kDa, Specificity: KBA.62 is a novel anti-melanoma antibody. It reacts identified as CD99, MIC2 gene product, or E2 antigen. This positively against melanocytic tumors but not against other antibody shows a very similar reactivity to other CD99 antibodies tumors, thus demonstrating specificity and sensitivity. Moreover, (e.g. O13, 12E7, or HBA-71) and is excellent for it reacts positively against junctional nevus cells but not immunohistochemical staining of formalin-fixed, paraffin- intradermal nevi, and against fetal melanocytes but not normal embedded tissues. adult melanocytes. Catalog Number Volume Catalog Number Volume A00044-0002 2 ml A00153-0002 2 ml A00044-0007 7 ml A00153-0007 7 ml A00044-0025 25 ml A00153-0025 25 ml MSH6; Clone EP49 (Ready-To-Use) Melanoma; Clone HMB45 (Ready-To-Use) Species: Rabbit Species: Mouse Monoclonal Immunogen: Rabbits were injected with a synthe c pep de Clone: HMB45 corresponding to residues at the N-terminus in human MSH6 Isotype: IgG1 / Kappa protein. Species Reactivity: Human. Does not react with dog and rat. Clone: EP49 Positive Control: Melanoma Isotype: Rabbit IgG Species Reac vity: Human Specificity: By immunohistochemistry, it specifically recognizes a Posi ve Control: Colon for normal ssue and colon protein in melanocytes and melanomas. Biochemical nature of its adenocarcinoma for abnormal tissue. antigen is yet not fully characterized. This antibody reacts with Specificity: MSH6 is restricted to nuclear staining in posi ve junctional and blue nevus cells and variably with fetal and cells. neonatal melanocytes. Intradermal nevi, normal adult Catalog Number Volume melanocytes, and non-melanocytic cells are negative. It does not stain tumor cells of epithelial, lymphoid, glial, or mesenchymal A00149-0002 2 ml origin. A00149-0007 7 ml A00149-0025 25 ml Catalog Number Volume A00019-0002 2 ml MSH6; Clone MSH6/3091 (Ready-To-Use) A00019-0007 7 ml Species: Mouse A00019-0025 25 ml Immunogen: Recombinant fragment of human MSH6 protein (around aa 374-540) (exact sequence is proprietary). Melanoma; Pan (Ready-To-Use) Clone: MSH6/3091 Species: Mouse Isotype: IgG2b, Kappa Clones: MART-1; Clone M2-7C10, MART-1; Clone M2-9E3, Species Reactivity: Human, Others-not known Tyrosinase; Clone T311, Melanoma: HMB45. Positive Control: HCT116, MCF-7 cells, Human colon carcinoma Isotype: Mouse IgG1 (IHC). Species Reactivity: Human. Specificity: This antibody reacts with a 163kDa protein identified Positive Control: Human Melanoma as MSH6. Positive staining for MSH6 is seen in the nuclei of Specificity: Melanoma; Pan is a broad spectrum marker for colon carcinomas, stromal cells and lymphocytes. metastatic melanoma. Cellular Localization: Nuclear Catalog Number Volume Catalog Number Volume A00134-0002 2 ml A00162-0002 2 ml A00134-0007 7 ml A00162-0007 7 ml A00134-0025 25 ml A00162-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
135 Antibodies
MUC5AC (Gastric Mucin); Clone 45M1 (Ready-To- p21WAF1; Clone WA-1 (Ready-To-Use) Use) Species: Mouse Species: Mouse Clone: WA-1 Clone: 45M1 Isotype: Mouse IgG1, Kappa Isotype: Mouse IgG1, Kappa Species Reactivity: Human. Species Reactivity: Human, Monkey, Cat, Chicken, Hedgehog, Positive Control: Colon Carcinoma. Mouse, Pig, Rabbit, Rat. Does not react with cow. Specificity: The antibody is highly specific to p21; it does not Positive Control: Stomach. cross-react with other closely related mitotic inhibitors. Specificity: MUC5AC is expressed in airway and gastric epithelial Specificity validations include antibody recognition of cells and highly expressed in colorectal carcinomas. recombinant p21 by western blot (Koike, 2011) and in direct ELISA assays (Rossner, 2002 & 2007). Although the exact epitope Catalog Number Volume for the antibody has not been mapped, the epitope appears to A00124-0002 2 ml be different from those recognize by other p21 antibody clones. A00124-0007 7 ml Catalog Number Volume A00124-0025 25 ml A00125-0002 2 ml Napsin A; Clones NAPSA/1238 & NAPSA/1239 A00125-0007 7 ml (Ready-To-Use) A00125-0025 25 ml Species: Mouse p53; Clone BP53-12 (Ready-To-Use) Immunogen: Recombinant human Napsin-A protein fragment (aa 189-299). Exact sequence is proprietary. Species: Mouse Clones: NAPSA/1238 & NAPSA/1239 Clone: BP53-12 Isotype: IgG1, Kappa Isotype: IgG2a, Kappa Species Reactivity: Human. Others not tested. Species Reactivity: Human. Will not cross-react with mouse or Positive Control: Lung adenocarcinoma. rat. Specificity: This antibody is specific for a pepsin-like aspartic Cellular Localization: Nuclear. proteinase identified as Napsin A. Specificity: This p53 antibody recognizes a 53kDa protein, which is identified as p53 suppressor gene product. The antibody Catalog Number Volume reacts with the mutant as well as the wild form of p53 under A00131-0002 2 ml denaturing and non-denaturing conditions. The epitope maps A00131-0007 7 ml within the N-terminus (aa 20-25) of p53 oncoprotein. A00131-0025 25 ml Catalog Number Volume Neurofilament (H&L); Clone 2F11 (Ready-To-Use) A00109-0002 2 ml A00109-0007 7 ml Species: Mouse A00109-0025 25 ml Clone: 2F11 Isotype: IgG1, Kappa p53; Clone DO-1 (Ready-To-Use) Species Reactivity: Human, Rabbit, Cat, Mouse and Rat. Does not react with dog. Species: Mouse Monoclonal Positive Control: Brain Clone: DO-1 Isotype: IgG2a Specificity: This antibody stains neurons (axons) of the central MW: 53 kD and peripheral nervous system. It is useful for the identification Species Reactivity: Human, Monkey, Cow, and weak reaction of tumors with neuronal differentiation viz. Neuroblastomas, with Mouse and Rat. Ganglioneuromas, Pheochromocytomas and Esthesioblastomas. Positive Control: About 50% of breast carcinomas are positive The antibody cross-reacts with the NF-equivalent protein in for p53, especially those lacking estrogen and/or progesterone mouse, rabbit, rat and swine. The antibody can also be utilized to receptor, or with high proliferation index. discriminate between Hirschsprung's disease and allied enteric nervous system malformations. Specificity: Recognizes a 53kDa phosphoprotein, identified as p53 suppressor gene product. It reacts with mutant as well as Catalog Number Volume wild form of p53. Its epitope maps within the N-terminus (aa37- A00020-0002 2 ml 45) of p53. Monoclonal antibody Pab 1801 does not block the A00020-0007 7 ml binding of DO-1 to p53 in an ELISA test. A00020-0025 25 ml Catalog Number Volume A00027-0002 2 ml A00027-0007 7 ml A00027-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
136 Antibodies p53; Clone DO-7 (Ready-To-Use) PSAP (Prostate Specific Acid Phosphatase); Clone Species: Mouse PASE/4LJ (Ready-To-Use) Immunogen: Recombinant human wild type p53 protein Species: Mouse Monoclonal expressed in E. coli. Clone: PASE/4LJ Clone: DO-7 Isotype: IgG1 Isotype: IgG2b,k MW: 52 kD MW: 53 kD Species Reactivity: Human, Dog, Rabbit, and Rat. Species Reactivity: Human, Monkey, and Cow. Others not Positive Control: Normal prostate or prostate carcinoma. known. Positive Control: MDA-MB-231 Cells. Breast or colon carcinoma. Specificity: Recognizes a protein of 52kDa, identified as prostate About 50% of breast carcinomas are positive for p53, especially specific acid phosphatase (PSAP). PASE/4LJ is highly specific to those lacking estrogen and/or progesterone receptor, or with PSAP and shows no cross-reaction with other phosphatases. It high proliferation index. does not inhibit the enzymatic activity of PSAP. This antibody Specificity: Recognizes a 53kDa protein, which is identified as reacts with non-neoplastic adult and fetal prostatic glands, p53 suppressor gene product. It reacts with the mutant as well as primary and metastatic prostatic carcinomas. ScyTek's PASE/4LJ the wild type form of p53. Its epitope maps within the N- is recommended for immunohistochemical staining of formalin- terminus (aa 37-45) of p53. fixed, paraffin-embedded tissues. Unlike polyclonal antibody to Catalog Number Volume PSAP, PASE/4LJ Mab shows no staining in granulocytes, osteoclasts, parietal cells of the stomach, liver cells, renal cell or A00021-0002 2 ml breast carcinomas. A00021-0007 7 ml A00021-0025 25 ml Catalog Number Volume A00041-0002 2 ml PCNA; Clone PC10 (Ready-To-Use) A00041-0007 7 ml Species: Mouse Monoclonal A00041-0025 25 ml Clone: PC10 Isotype: IgG2a/k Renal Cell Carcinoma (RCC); Clone 66.4.C2 (Ready- MW: 36 kD To-Use) Species Reactivity: Human, Murine, Insect, and Yeast Specie: Mouse Positive Control: Tonsil or reactive lymph node. Clone: 66.4.C2 Isotype: Mouse IgG2b, Kappa Specificity: Recognizes a non-histone protein of 36kDa which is Species Reactivity: Human, Horse. Others not tested. identified as proliferating cell nuclear antigen (PCNA). It is also Positive Control: Kidney. known as cyclin or polymerase delta auxiliary protein. Elevated Specificity: The actual protein recognized by RCC-ma antibody is expression of PCNA/cyclin has been shown in the nucleus during a 200 kDa glycoprotein (gp200) expressed in renal epithelial cells. late G1 phase immediately before the onset of DNA synthesis, In normal tissue, the renal cell carcinoma/RCC-ma/gp200 becoming maximal during S-phase and declining during G2 and antibody stains the brush border of proximal renal tubules in M phases. human kidneys. Gp200 is also expressed in some non-kidney Catalog Number Volume tissues including breast tubules and ducts, the surface of A00022-0002 2 ml epididymal tubular epithelia, and the colloid of thyroid follicles. However because of the reported high expression of gp200 in A00022-0007 7 ml renal cell carcinoma, gp200 is most commonly referred to as A00022-0025 25 ml Renal Cell Carcinoma Marker. Placental Alkaline Phosphatase (PLAP); Clone Catalog Number Volume ALP/870 (Ready-To-Use) A00118-0002 2 ml Species: Mouse A00118-0007 7 ml Immunogen: Recombinant human PLAP protein A00118-0025 25 ml Clone: ALP/870 Isotype: IgG2b, kappa Species Reac vity: Human. Others not known. Posi ve Control: HepG2 cells. Placenta or seminoma. Specificity: Reacts with a 70kDa membrane-bound isozyme (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) occurring in the placenta during the 3rd trimester of gestation. It is highly specific for PLAP and shows no cross-reaction with other isozymes of alkaline phosphatase. Catalog Number Volume A00154-0002 2 ml A00154-0007 7 ml A00154-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
137 Antibodies
S-100; Clone 4C4.9 (Ready-To-Use) Thyroglobulin; Clone 2H11 (Ready-To-Use) Species: Mouse Monoclonal Species: Mouse Clone: 4C4.9 Clone: 2H11 Isotype: IgG2a Isotype: IgG1, Kappa MW: 21-24 kD Species Reactivity: Human Species Reactivity: Human, Cow, Mouse Cellular Localization: Cytoplasmic Positive Control: Melanoma or Schwannoma. Specificity: Thyroglobulin is a 660 kDa dimeric preprotein with multiple glycosylation sites is produced by and processed within Specificity: Recognizes proteins of 21-24kDa, identified as the A the thyroid gland to produce the hormone thyroxine and and B subunits of S100 protein. S100 belongs to the family of triiodothyronine. Prior to forming dimmers, thyroglobulin calcium binding proteins such as calmodulin and troponin C. monomers undergo conformation maturation in the S100A is composed of an alpha and beta chain whereas S100B is endoplasmic reticulation. Thyroglobulin dimerization as well as composed of two beta chains. Antibody to S100 stains transport of thyroglobulin to the Golgi complex is calcium Schwannomas, ependymomas, astrogliomas, almost all benign dependent. Thyroglobulin defects resulting from defective dimer and malignant melanomas and their metastases. S100 protein is formation and export to the Golgi is thought to cause some types also expressed in the antigen presenting cells such as the of goiter. Antibody against thyroglobulin may be produced by Langerhans cells in skin and interdigitating reticulum cells in the individuals with other diseases arising from the gland such as paracortex of lymph nodes. S100 protein is highly soluble and Hashimoto's or Graves disease. Hence the presence of may be eluted from frozen tissue during staining. thyroglobulin autoantibodies can help to identify disease. Catalog Number Volume An body to thyroglobulin has been shown to be useful for the identification of papillary and follicular thyroid carcinoma; A00087-0002 2 ml thyroglobulin antibody positive lesions are of thyroidal origin. A00087-0007 7 ml Carcinomas of nonthyroidal origin do not express thyroglobulin A00087-0025 25 ml and hence are thyroglobulin antibody negative. It is important to note though that not every type of thyroidal lesion is Secretory Component; Clone SC05 (Ready-To-Use) thyroglobulin antibody positive, a number of forms are negative. Species: Mouse Hence a negative result does not necessarily rule out that a given Clone: SC05 lesion or metastasis originated from the thyroid gland. Isotype: IgG1, Kappa Catalog Number Volume Species Reactivity: Human, Rat. Others not tested. A00108-0002 2 ml Positive Control: Breast carcinoma, Lung, Stomach. Specificity: This antibody reacts with both free and bound A00108-0007 7 ml secretory component to secretory IgA. A00108-0025 25 ml Catalog Number Volume TTF-1; Clone 8G7G3/1 (Ready-To-Use) A00127-0002 2 ml Species: Mouse A00127-0007 7 ml Designation: Mouse Monoclonal A00127-0025 25 ml Clone: 8G7G3/1 Isotype: IgG1 SOX10; Clone SOX10/991 (Ready-To-Use) Species Reactivity: Human. Others not tested. Species: Mouse Positive Control: Adenocarcinoma of the Lung or Thyroid. Immunogen: Recombinant human SOX10 protein fragment Specificity: This antibody reacts with TTF-1 protein found in (aa115-269) (exact sequence is proprietary). adenocarcinomas of the lung and tumors originating in the Clone: SOX10/991 thyroid. TTF-1 positive cells are found in Type II pneumocytes Isotype: IgG2b, Kappa. and Clara cells in the lung. In the thyroid, follicular and Species Reactivity: Human and Mouse. Others-not known. parafollicular cells are positive. In lung cancers, Positive Control: HepG2 cells, Melanoma, breast carcinomas, Adenocarcinomas are usually positive, while Squamous Cell gliomas. Carcinomas and Large Cell Carcinomas are rarely positive. In Specificity: Recognizes a protein of ~55kDa, identified as SOX10. addition, Small-Cell Carcinomas (of any primary site) are usually This antibody does not cross-react with other members of the positive. SOX-family. Catalog Number Volume Catalog Number Volume A00144-0002 2 ml A00161-0002 2 ml A00144-0007 7 ml A00161-0007 7 ml A00144-0025 25 ml A00161-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
138 Antibodies
Tyrosinase; Clone T311 (Ready-To-Use) Vimentin; Clone V9 (Ready-To-Use) Species: Mouse Species: Mouse Monoclonal Clone: T311 Clone: V9 Isotype: Mouse IgG1 Isotype: IgG1/k Species Reactivity: Human. MW: 57-60 kD Positive Control: Human Melanoma Species Reactivity: Human, Monkey, Cow, Horse, Pig, Rabbit, Specificity: Tyrosinase has been shown to be a very specific Dog, Cat, Rat, Mouse, Hamster, Gerbil and Chicken. marker for melanomas. Cross reactivity with other tumors or Positive Control: Sarcomas, meningiomas, or melanomas. normal tissues tested has not been reported. Catalog Number Volume Specificity: Recognizes a 57-60kDa protein which is identified as vimentin. It shows no cross reactivity with other closely related A00132-0002 2 ml intermediate filament proteins including desmin and GFAP. A00132-0007 7 ml Catalog Number Volume A00132-0025 25 ml A00045-0002 2 ml UchL1 (PGP9.5); Clone 31A3 (Ready-To-Use) A00045-0007 7 ml Species: Mouse A00045-0025 25 ml Clone: 31A3 Isotype: Mouse IgG1, Kappa Species Reactivity: Cow, Human, Mouse, Pig, Rat. Monoclonal Concentrates Positive Control: Brain. Specificity: The UchL1 clone 31A3 antibody stains neuronal cell bodies and axons in the central and peripheral nervous systems as well as small nerve fibers in peripheral tissues, including Actin, Alpha-Smooth Muscle; Clone 1A4 epidermal tissues (Day & Thompson, 2010). The antibody also stains neuroendrocrine cells in the kidney, pituitary, thyroid, (Concentrate) pancreas, gastrointestinal tract, and tumors of the diffuse Species: Mouse Monoclonal neuroendocrine system. This antibody has also identified UchL1 Clone: 1A4 expression in renal tubule spermatogonia, testis, ovary, and both Isotype: IgG2a,k pregnant and non-pregnant corpus luteum. Species Reactivity: Human, Baboon, Cow, Rabbit, Mouse, Rat, Catalog Number Volume Chicken. Positive Control: Blood vessels A00120-0002 2 ml A00120-0007 7 ml Specificity: This antibody recognizes the a-smooth muscle form A00120-0025 25 ml of actin. It shows no cross reaction with actin from fibroblasts (b- and g-cytoplasmic), striated muscle (a-sarcometric), and Vimentin; Clone SP20 (Ready-To-Use) myocardium (a-myocardial). Its epitope is composed of the acetyl Species: Rabbit group and the first 4 amino acids on the N-terminal end of the Immunogen: Recombinant protein encoding human vimentin. peptidic chain of a-smooth actin. ScyTek's 1A4 stains smooth Mol. Weight: 57-60kDa muscle cells in vessel walls, gut wall, and myometrium. Clone: SP20 Myoepithelial cells in breast and salivary gland are also stained as Isotype: IgG they also contain this actin. Specificity: This antibody selectively stains vimentin in human Catalog Number Volume tissue sections. Vimentin is the main intermediate filament in A00002-C.1 0.1 ml mesenchymal cells and is therefore of value in the differential diagnosis of undifferentiated neoplasms. A00002-C 1 ml Species Reactivity: Human. Others not tested. Actin, Muscle Specific; Clone HHF35 (Concentrate) Catalog Number Volume Species: Mouse A00105-0002 2 ml Immunogen: SDS extract of human myocardium. A00105-0007 7 ml Clone: HHF35 A00105-0025 25 ml Isotype: IgG1, Kappa. Species Reactivity: Human, Rabbit, Rat and Pig. Others-not known Positive Control: Muscle or sarcoma. Specificity: This antibody recognizes actin of skeletal, cardiac, and smooth muscle cells. It is not reactive with other mesenchymal cells except for myoepithelium. Catalog Number Volume A00001-C.1 0.1 ml A00001-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
139 Antibodies
Bcl-2; Clone 100/D5 (Concentrate) Carcinoembryonic Antigen, Pan (CEA); Clone COL-1 Species: Mouse (Concentrate) Clone: 100/D5 Species: Mouse Isotype: Mouse IgG1, Kappa Immunogen: BALB/c mice were injected with an extract of Species Reactivity: Human, Monkey. Others not tested. human colon carcinoma. Positive Control Tonsil. Clone: COL-1 Cellular Localization: Cytoplasmic & Cell Membrane. Isotype: IgG1 Kappa Specificity: Human Bcl-2 alpha is a 239 amino acid (aa) protein Species Reactivity: Human. Others not tested. and human Bcl-2 beta is a 205 aa protein. The 100/D5 antibody Positive Control: Colon Adenocarcinoma. [also known as clone Bcl-2/100 (Kren, 2004, Kaur, 2004)] Specificity: This antibody labels the CEA-positive glycocalyx recognizes both Bcl-2 isoforms (Pezzela et al, 1990). surface of gastrointestinal cells and is useful for the identification Catalog Number Volume of colon carcinomas. A00119-C.1 0.1 ml Catalog Number Volume A00119-C 1 ml A00135-C 1 ml Bcl-2; Clone 124 (Concentrate) CD10, CALLA (Neutral Endopeptidase); Clone 56C6 Species: Mouse (Concentrate) Immunogen: A synthetic peptide, aa41-54 (GAAPAPGIFSSQPG- Species: Mouse Cys) of human Bcl-2 protein Immunogen: Recombinant human CD10 protein fragment. Clone: 124 Clone: 56C6 Isotype: IgG1, kappa Isotype: IgG1, kappa Species Reactivity: Human. Does not react with Mouse and Rat. Species Reactivity: Human, Rat. Others not tested. Others not known. Positive Control: Kidney, small intestine, or tonsil. Positive Control: Jurkat, K562, HL-60, or HeLa Cells. Tonsil or Specificity: Recognizes a 100kDa glycoprotein, identified as follicular lymphomas. CD10, also known as Common Acute Lymphatic Leukemia Specificity: This antibody recognizes a protein of 25-26kDa, Antigen (CALLA). identified as the Bcl-2 alpha oncoprotein. It shows no cross- Catalog Number Volume reaction with Bcl-x or Bax protein. A00091-C.1 0.1 ml Catalog Number Volume A00091-C 1 ml A00004-C.1 0.1 ml A00004-C 1 ml CD15 / FUT4; Clone Leu-M1 (Concentrate) CA19-9; Clone 121SLE (Concentrate) Species: Mouse Immunogen: U937 his ocy c cell line Species: Mouse Clone: Leu-M1 Clone: 121SLE Isotype: IgM, kappa Isotype: IgM, Kappa Species Reac vity: Human. Others not known. Species Reactivity: Human Posi ve Control: U937 cells, Reed-Sternberg's cells in Hodgkin's Cellular Localization: Lumenal surface and cytoplasm. lymphoma. Specificity: CA19-9, a carbohydrate epitope expressed on a high Specificity:This an body reacts with a 220 kDa protein, CD15 / MW (>400kDa) mucin glycoprotein, is a sialyl Lewisa structure FUT4 expressed on Reed-Sternberg cells. which is synthesized from type 1 blood group precursor chains Catalog Number Volume and is present in individuals expressing the Lewisa and/or Lewisb blood group antigens. In normal tissues, sialyl Lewisa antigen is A00151-C.1 0.1 ml present in ductal epithelium of the breast, kidney, salivary gland, A00151-C 1 ml and sweat glands. Its expression is greatly enhanced in serum as well as in the majority of tumor cells in gastrointestinal (GI) CD20, B-Cell; Clone L26 (Concentrate) carcinomas, including adenocarcinomas of the stomach, Species: Mouse intestine, and pancreas. Preoperative elevated CA19-9 levels in Immunogen: Human tonsil B-cells patients with stage I pancreatic carcinoma decrease to normal Clone: L26 values following surgery. When used serially, CA19-9 can predict Isotype: IgG2a, kappa recurrence of disease prior to radiographic or clinical findings. Species Reactivity: Human, Baboon, and Monkey. Does not Catalog Number Volume react with Cow, Dog, Pig, and Rat. Others not known. A00107-C 1 ml Positive Control: Daudi, Raji, and U266, and human lymphocytes, lymph nodes and tonsils. Specificity: Recognizes a protein of 30-33kDa, which is identified as CD20. Its epitope is located in the cytoplasmic domain of CD20 and was, therefore, ascribed as CD20cy in the 5th Workshop. Catalog Number Volume A00003-C.1 0.1 ml A00003-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
140 Antibodies
CD30, Ki-1 Antigen; Clone Ber-H2 (Concentrate) CD31; Clone C31.7 (Concentrate) Species: Mouse Species: Mouse Immunogen: Cancer cell line established from a patient with Clone: C31.7 Hodgkin's disease of T-cell lineage Isotype: IgG1, Kappa Clone: Ber-H2 Species Reactivity: Human. Isotype: IgG1, kappa Positive Control: Tonsil Species Reactivity: Human. Others not known. Cellular Localization: Primarily membrane. Positive Control: Hodgkin's lymphoma Specificity: This antibody recognizes a 100kDa glycoprotein in Specificity: Recognizes a single chain glycoprotein of endothelial cells and 130kDa in platelets. This antibody reacts 105/120kDa, identified as CD30/Ki-1. This Mab distinguishes with endothelial cells in normal tissues and in benign and large cell lymphomas derived from activated lymphoid cells from malignant proliferations. In cryostat sections and blood smears histiocytic malignancies and lymphomas derived from resting and the antibody also stains megakaryocytes, platelets and precursor lymphoid cells or from anaplastic carcinomas. occasionally plasma cells. It reacts weakly with mantle zone B Catalog Number Volume cells, peripheral T cells, and neutrophils. Antibody to CD31 is of value in the study of benign and malignant vascular tumors. A00016-C.1 0.1 ml Staining for CD31 has also been used to measure angiogenesis, A00016-C 1 ml which reportedly predicts tumor recurrence. CD31, Endothelial Cell; Clone JC/70A (Concentrate) Catalog Number Volume Species: Mouse A00110-C 1 ml Immunogen: Membrane prepara on of a spleen from a pa ent CD34, Endothelial Cell; Clone QBEnd/10 with hairy cell leukemia. Clone: JC/70A (Concentrate) Isotype: IgG1, kappa Species: Mouse Species Reac vity: Human, Cynomolgus Monkey, and Rabbit. Immunogen: Detergent solubilized vesicular suspension Others not known. prepared from human term placenta Posi ve Control: Tonsil, Angiosarcoma. Clone: QBEnd/10 Specificity: An -CD31 has shown to be highly specific and Isotype: IgG1, kappa sensitive for vascular endothelial cells. Staining of nonvascular Species Reac vity: Human, Cynomolgus Monkey, Rhesus tumors (excluding hematopoietic neoplasms) is rare. Anti-CD31 Monkey. Does not react with rat, sheep, cow and dog. Others not reacts with normal, benign, and malignant endothelial cells known. which make up blood vessel lining. Posi ve Control: KG-1 cells, Tonsil, or Angiosarcoma Catalog Number Volume Specificity: This an body recognizes a single chain, transmembrane, heavily glycosylated protein of 90-120kDa, A00009-C.1 0.1 ml which is identified as CD34. On the basis of differential sensitivity A00009-C 1 ml to degradation by specific enzymes, epitopes of monoclonal antibodies to CD34 are classified into three main categories, class CD31; Clone C31.3 (Concentrate) I, class II and class III. It is a class II antibody whose epitope is Species: Mouse resistant to neuraminidase but sensitive to glycoprotease and Clone: C31.3 chymopapain. Anti-CD34 labels > 85% of angiosarcoma and Isotype: Mouse IgG1, Kappa Kaposi's sarcoma, but with a lower specificity. Species Reactivity: Human. Catalog Number Volume Positive Control: Tonsil, Liver, Kidney. Specificity: The CD31 antibody (clone C31.3 or PECAM-1) is A00070-C.1 0.1 ml widely used as a pan-endothelial cell marker to demonstrate the A00070-C 1 ml presence of endothelial cells in tissue sections by immunohistochemistry. The CD31 (PECAM-1) antibody reacts CD43, T-Cell; Clone DF-T1 (Concentrate) with normal, benign, and malignant endothelium. Species: Mouse Catalog Number Volume Immunogen: Myeloblastic KG1 cells Clone: DF-T1 A00126-C 1 ml Isotype: IgG1, kappa Species Reactivity: Human. Others not known. Positive Control: Paracortex in a tonsil or a reactive lymph node. Specificity: This antibody recognizes a cell surface glycoprotein of 95/115/135kDa (depending upon the extent of glycosylation), identified as CD43 [Workshop IV]. Catalog Number Volume A00082-C.1 0.1 ml A00082-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
141 Antibodies
CD45, Leucocyte Common Antigen (LCA); Clones CD45RO, T-Cell; Clone UCHL1 (Concentrate) PD7/26 & 2B11 (Concentrate) Species: Mouse Monoclonal Species: Mouse Clone: UCHL1 Immunogen: Isolated neoplas c cells from T-cell lymphoma Isotype: IgG2a,k (2B11); human peripheral blood lymphocytes maintained in T- Species Reactivity: Human, Rhesus Monkey. Does not react with cell growth factor (PD7/26). Rat. Clone: 2B11 & PD7/26 Positive Control: Tonsil or Lymph Node. Isotype: IgG1, kappa (2B11); IgG1, kappa (PD7/26). Species Reac vity: Human. Others not known. Specificity: This antibody reacts with a 180 kD glycoprotein of Posi ve Control: Ramos, U-698, or GA-10 cells. Tonsil. CD45 family, occurring on most thymocytes and activated T cells Specificity: This an body recognizes the CD45 leukocyte but only on the portion of the resting T cells. It reacts with most common antigen (LCA) family. thymocytes, a subpopulation of resting cells within both the CD4 and CD8 subsets and mature activated T cells. This antibody Catalog Number Volume shows no reactivity with normal B or natural killer cells, but A00017-C.1 0.1 ml reacts with granulocytes and monocytes. Though this antibody is A00017-C 1 ml useful to identify T-cell lymphomas and leukemia, rare staining with B cell lymphomas reported. CD45; Clone 2B11 (Concentrate) Catalog Number Volume Species: Mouse A00024-C.1 0.1 ml Clone: 2B11 A00024-C 1 ml Isotype: Mouse IgG1, Kappa Species Reactivity: Human. CD56; Clone 123C3 (Concentrate) Positive Control: Tonsil. Specificity: This antibody is specific for hematopoietic cells, Species: Mouse including basophils, granulocytes, lymphocytes, macrophages / Clone: 123C3 histiocytes, mast cells, monocytes, plasma cells; NOT mature red Isotype: Mouse IgG1, Kappa blood cells and their immediate progenitors, platelets or Species Reactivity: Human. megakaryocytes, Dendritic cells, medullary thymocytes. Positive Control: Tonsil, Neuroblastoma, Pancreatic Islet cells. Specificity: This antibody recognizes two proteins (185kDa & Catalog Number Volume 145kDa), identified as two isoforms of neural cell adhesion A00129-C 1 ml molecule (NCAM/CD56). It is used as a tumor marker in various cancers such as NK lymphomas and Merkel cell carcinoma. CD45RA (LCA); Clone 158-4D3 (Concentrate) NCAM is expressed on most neuroectodermal derived lines, Species: Mouse tissues, and neoplasms such as retinoblastoma, Clone: 158-4D3 medulloblastoma, astrocytoma, and neuroblastoma. It is also Isotype: Mouse IgG2a, Kappa expressed on some mesodermally derived tumors such as Species Reactivity: Human. Others not tested. rhabdomyosarcoma and also on natural killer cells. Positive Control: Tonsil, Spleen. Catalog Number Volume Specificity: The CD45RA 158-4D3 antibody clone reacts with the A00121-C.1 0.1 ml ABC and BC isoforms (Schlossman et al, 1995). CD45RA has a molecular weight of 205-220 kDa. A00121-C 1 ml Catalog Number Volume CD57 (HNK-1); Clone NK-1 (Concentrate) A00123-C 1 ml Species: Mouse Clone: NK-1 CD45RB; Clone PD7/26 (Concentrate) Isotype: Mouse IgM, Kappa Species: Mouse Species Reactivity: Human. Clone: PD7/26 Positive Control: Tonsil, spleen, lymph node. Isotype: Mouse IgG1 Specificity: The NK1 antibody clone recognizes the glycoepitope Species Reactivity: Human. referred to as both CD57 and HNK1. Positive Control: Tonsil. Catalog Number Volume Specificity: This antibody is specific for hematopoietic cells, including basophils, granulocytes, lymphocytes, A00117-C.1 0.1 ml macrophages/histiocytes, mast cells, monocytes, plasma cells; A00117-C 1 ml NOT mature red blood cells and their immediate progenitors, platelets or megakaryocytes, dendritic cells, medullary thymocytes. CD45RB is highly expressed on memory B cells and plasmablasts but not on naïve B cells, Langerhans cells and some T cells, B cells, monocytes, macrophages, granulocytes. Catalog Number Volume A00130-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
142 Antibodies
Chromogranin A; Clones LK2H10 & PHE5 Cytokeratin 6; Clone EP67 (Concentrate) (Concentrate) Species: Rabbit Species: Mouse Designation: Rabbit Monoclonal Immunogen: Human pheochromocytoma (LK2H10 & PHE5). Clone: EP67 Clone: LK2H10 & PHE2 Isotype: IgG Isotype: IgG1, Kappa (Both) Species Reactivity: Human. Others not tested. Species Reactivity: Human, Monkey, Pig, Mouse and Rat. Others- Positive Control: Skin for normal tissue and Mesothelioma for not known abnormal tissue. Positive Control: PC12 cells. Adrenal gland, bowel, thyroid, Specificity: Cytokeratin 6 is expressed in many non-keratinizing pancreas, or pheochromocytoma. stratified squamous epithelia of large cell carcinoma and Specificity: Chromogranin A is present in neuroendocrine cells pulmonary squamous cell carcinomas. It can also be found on throughout the body, including the neuroendocrine cells of the stratified epithelia including: basal layer of epidermis, the outer large and small intestine, adrenal medulla and pancreatic islets. root sheath of hair follicles, esophagus, oral mucosa, as well as It is an excellent marker for carcinoid tumors, basal cells in prostate glands and myoepithelial cells in mammary pheochromocytomas, paragangliomas, and other glands. neuroendocrine tumors. Catalog Number Volume Catalog Number Volume A00140-C.1 0.1 ml A00160-C.1 0.1 ml A00140-C 1 ml A00160-C 1 ml Cytokeratin 7; Clone OV-TL12/30 (Concentrate) Cytokeratin 10; Clone DE-K10 (Concentrate) Species: Mouse Species: Mouse Clone: OV-TL12/30 Immunogen: Cytoskeletal preparation extracted from human Isotype: IgG1 ectocervical epithelium. Species Reactivity: Human. Others not tested. Clone: DE-K10 Positive Control: Carinoma of Ovary, Lung, Cervix or Breast. Isotype: IgG1, kappa Specificity: Cytokeratin 7 expression is restricted to most Species Reactivity: Human, Dog and Cat. Others not known. glandular and transitional epithelia including lung, breast, Positive Control: Esophagus or Tonsil. A431, HeLa, MCF7 cells. bladder and female genital tract and their adenocarcinomas, but Specificity: This antibody recognizes a protein of 56.5kDa not in most gastrointerstinal epithelium, prostate, hepatocyte identified as Cytokeratin 10. and squamous epithelium. Catalog Number Volume Catalog Number Volume A00089-C.1 0.1 ml A00142-C.1 0.1 ml A00089-C 1 ml A00142-C 1 ml Cytokeratin 19; Clone A53-B/A2.26 (Concentrate) Cytokeratin 8; Clone K8/383 (Concentrate) Species: Mouse Species: Mouse Clone: A53-B/A2.26 (Ks 19.1) Clone: K8/383 Isotype: Mouse IgG2a, Kappa Isotype: IgG1 Species Reactivity: Human. Reacts weakly with mouse, rat and Species Reactivity: Human, Rat. Others not tested. guinea pig Cytokeratin 19. Positive Control: MCF-7 or A431 cells. Human Skin, Colon, Lung Positive Control: Skin, Breast carcinoma, Colon carcinoma, or Breast carcinoma. Thyroid. Specificity: Cytokeratin 8 Antibody belongs to the type II (or B or Specificity: This antibody reacts with the rod domain of human Basic) subfamily of high molecular weight Cytokeratins and exists Cytokeratin 19, a polypeptide of 40kDa. The antibody recognition in combination with Cytokeratin 18. Cytokeratin 8 is primarily epitope maps between amino acid 312-335. This antibody reacts found in the non-squamous epithelia and is present in a majority with the MCF-7 cells which are known to contain Cytokeratin 19. of adenocarcinomas and ductal carcinomas. It is absent in squamous cell carcinomas. Catalog Number Volume Catalog Number Volume A00122-C.1 0.1 ml A00122-C 1 ml A00136-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
143 Antibodies
Cytokeratin, High Molecular Weight; Clone 34bE12 Cytokeratin, Pan; Clones AE1 & AE3 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Human epidermal keratin Immunogen: Solubilized kera n extract from human stratum Clone: AE-1 & AE-3 corneum Isotype: IgG1, kappa (AE-1); IgG1, kappa (AE-3) Clone: 34BE12 Species Reactivity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Isotype: IgG1, kappa Rat, Chicken. Others not known. Species Reac vity: Human, Mouse, and Rat. Others not known. Positive Control: Skin, Adeno- or Squamous carcinomas. Posi ve Control: PC12 cells, skin, prostate carcinoma. Specificity: This antibody cocktail recognizes acidic (Type I or Specificity: This an body recognizes CK1, CK5, CK10, and CK14. LMW) and basic (Type II or HMW) cytokeratins, which include In normal epithelia, it stains stratified epithelia, myoepithelial 67kDa (CK1); 64kDa (CK3); 59kDa (CK4); 58kDa (CK5); 56kDa cells, and basal cells in the prostate gland and bronchi. This (CK6); 52kDa (CK8); 56.5kDa (CK10); 50kDa (CK14); 50kDa antibody shows no reactivity with hepatocytes, pancreatic acinar (CK15); 48kDa (CK16); 40kDa (CK19). This antibody stains cells, proximal renal tubules, or endometrial glands; there is no cytokeratins present in normal and abnormal human tissues and reactivity with cells derived from simple epithelia. Mesenchymal has shown high sensitivity in the recognition of epithelial cells tumors, lymphomas, melanomas, neural tumors, and and carcinomas. neuroendocrine tumors are negative with this antibody. Catalog Number Volume Catalog Number Volume A00152-C.1 0.1 ml A00071-C.1 0.1 ml A00152-C 1 ml A00071-C 1 ml Desmin; Clone D33 (Concentrate) Cytokeratin, Multi (Acidic); Clone AE1 Species: Mouse (Concentrate) Immunogen: Proteins from human Leiomyoma. Species: Mouse Monoclonal Clone: D33 Clone: AE-1 Isotype: IgG1, kappa Isotype: IgG1 Species Reactivity: Human, Rat, Mouse, Hamster, Chicken. MW: 56.5, 50, 50', 48 and 40 kD Others not known. Species Reactivity: Human, Monkey, Cow, Rabbit, Mouse, Rat, Positive Control: Muscle, Uterus, Leiomyosarcoma or SJRH30 Chicken. Others not tested. cells. Positive Control: Human epidermal keratin or carcinoma. HT29 Specificity: Desmin, Clone D33 detects cells of normal smooth, cells. skeletal, and cardiac muscles. This antibody reacts with Specificity: Monoclonal antibody AE1 recognizes the 56.5, 50, leiomyomas, leiomyosarcoma, rhabdomyomas, 50', 48, and 40kDa keratins of the acidic subfamily. Twenty rhabdomyosarcoma, and perivascular cells of glomus tumors of human keratins are resolved with two-dimensional gel the skin. electrophoresis into acidic (pI<5.7) and basic (pI>6.0) subfamilies. Catalog Number Volume The acidic keratins have molecular weights of 56.5, 55, 51, 50, A00007-C.1 0.1 ml 50', 48, 46, 45, and 40kDa. A00007-C 1 ml Catalog Number Volume A00051-C.1 0.1 ml Epithelial Membrane Antigen; Clone E29 A00051-C 1 ml (Concentrate) Species:Mouse Cytokeratin, Multi (Basic); Clone AE-3 Immunogen: Delipidated extract of human milk fat globule (Concentrate) membranes Species: Mouse Clone: E29 Immunogen: Human epidermal keratin Isotype: IgG2a, kappa Clone: AE-3 Species Reactivity: Human. Reacts moderately with Pig and Dog. Isotype: IgG1, kappa Others not known. Species Reactivity: Human, Monkey, Cow, Dog, Rabbit, Mouse, Positive Control: MCF-7 or MDA-231 cells. Breast or colon Rat, Chicken. Others not known. carcinoma. Positive Control: Epithelial cells, skin or adenocarcinomas. Specificity: In Western blotting, this antibody recognizes proteins Specificity: This antibody recognizes basic (Type II or HMW) in a MW range of 265-400kDa, identified as different glycoforms cytokeratins, which include 67kDa (CK1); 64kDa (CK3); 59kDa of EMA (MUC1). This antibody reacts with the DTRP epitope (CK4); 58kDa (CK5); 56kDa (CK6); 52kDa (CK8). within the tandem repeats. In immunohistochemical assays, it superbly stains routine formalin/paraffin carcinoma tissues. An Catalog Number Volume antibody to EMA (MUC1) is useful as a pan-epithelial marker for A00052-C.1 0.1 ml detecting early metastatic loci of carcinoma in bone marrow or A00052-C 1 ml liver. Catalog Number Volume A00008-C.1 0.1 ml A00008-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
144 Antibodies
GFAP; Clone ASTRO/789 (Concentrate) Kappa; Clone L1C1 (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant GFAP protein Clone: L1C1 Clone: ASTRO/789 Isotype: Mouse IgG1, Kappa Isotype: IgG1 Species Reactivity: Human. Species Reac vity: Human, Mouse, Rat, Cow, Pig, Rabbit, and Positive Control: Tonsil. Chicken. Others not known. Specificity: The kappa light chain antibody recognizes the kappa Posi ve Control: Brain or Astrocytoma. light chain of immunoglobulin. Specificity: This an body recognizes a protein of ~50kDa which Catalog Number Volume is identified as Glial Fibrillary Acidic Protein (GFAP). It shows no cross-reaction with other intermediate filament proteins. A00113-C.1 0.1 ml A00113-C 1 ml Catalog Number Volume A00158-C.1 0.1 ml Lambda Light Chain; Clone LcN-2 (Concentrate) A00158-C 1 ml Species: Mouse Immunogen: Purified human IgG Glial Fibrillary Acidic Protein (GFAP); Clone GA-5 Clone: LcN-2 (Concentrate) Isotype: IgG2a, kappa Species: Mouse Species Reactivity: Human. Others not known. Immunogen: Porcine Spinal Chord Positive Control: 293T, Raji or hPBL cells. Tonsil or spleen. Mol. Weight: 51-52kDa Specificity: This monoclonal antibody is specific to the lambda Clone: GA-5 light chain of immunoglobulins and shows no cross-reaction with Isotype IgG1 the kappa light chain or any of the five heavy chains. Species Reactivity: Human, Pig, Rat, and Chicken. Others not Catalog Number Volume tested. A00155-C.1 0.1 ml Positive Control: IMR5, Brain, or Astrocytoma. Cellular Localization: Cytoplasmic. A00155-C 1 ml MART-1; Clone M2-7C10 (Concentrate) Specificity: Glial Fibrillary Acidic Protein (GFAP) is specific to astrocytes and ependymal cells of the central nervous system. Species: Mouse This product effectively stains astrocytes, glial cells, ependymal Clone: M2-7C10 cells and their associated tumors. Isotype: Mouse IgG2b, Kappa Species Reactivity: Human. Clone M2-7C10 does not react with Catalog Number Volume mouse or rat. A00102-C.1 0.1 ml Positive Control: Metastatic melanoma in lymph nodes. A00102-C 1 ml Specificity: The clone M2-7C10 MART-1 antibody labels melanomas and other tumors showing melanocyte Insulin; Clone 2D11-H5 (Concentrate) differentiation. Species: Mouse Catalog Number Volume Clone: 2D11-H5 A00115-C 1 ml Isotype: Mouse IgG1, Kappa Species Reactivity: Human, Pig, Cow. MART-1; Clone M2-9E2 (Concentrate) Positive Control: Pancreatic tissue. Specificity: Detects insulin and insulin producing cells. Species: Mouse Clone: M2-9E2 Catalog Number Volume Isotype: Mouse IgG2b, Kappa A00114-C 1 ml Species Reactivity: Human, Mouse, Rat. Positive Control: Metastatic melanoma in lymph nodes. Kappa Light Chain; Clone KLC264 (Concentrate) Specificity: The clone M2-9E2 MART-1 antibody labels Species: Mouse melanomas and other tumors showing melanocyte Immunogen: Recombinant human Ig kappa chain differentiation. Clone: KLC264 Catalog Number Volume Isotype: IgG1, kappa A00116-C 1 ml Species Reactivity: Human. Others not known. Positive Control: 293T, Raji or hPBL cells. Tonsil or Spleen. MART-1; Clones M2-7C10 & M2-9E3 (Concentrate) Specificity: This monoclonal antibody is specific to the kappa light chain of immunoglobulins and shows no cross-reaction with Species: Mouse the lambda light chain or any of the five heavy chains. Clones: M2-7C10 & M2-9E3 Isotype: Mouse IgG2b, kappa Catalog Number Volume Species Reactivity: Human. A00156-C.1 0.1 ml Positive Control: Human Melanoma. A00156-C 1 ml Specificity: MART-1 has been shown to be a very specific marker for melanomas. Catalog Number Volume A00133-C.1 0.1 ml A00133-C 1 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
145 Antibodies
Melanoma Associated Antigen; Clone KBA.62 MSH6; Clone MSH6/3091 (Concentrate) (Concentrate) Species: Mouse Species: Mouse Immunogen: Recombinant fragment of human MSH6 protein Immunogen: Human KAL cells derived from lymph node (around aa 374-540) (exact sequence is proprietary). metastasis of malignant melanoma Clone: MSH6/3091 Clone: KBA.62 Isotype: IgG2b, Kappa Isotype: IgG1, kappa Species Reactivity: Human, Others-not known Species Reactivity: Human. Others not known. Positive Control: HCT116, MCF-7 cells, Human colon carcinoma Positive Control: Melanoma (IHC). Cellular Localization: Cell Surface Specificity: This antibody reacts with a 163kDa protein identified Specificity: KBA.62 is a novel anti-melanoma antibody. It reacts as MSH6. Positive staining for MSH6 is seen in the nuclei of positively against melanocytic tumors but not against other colon carcinomas, stromal cells and lymphocytes. tumors, thus demonstrating specificity and sensitivity. Moreover, Cellular Localization: Nuclear it reacts positively against junctional nevus cells but not Catalog Number Volume intradermal nevi, and against fetal melanocytes but not normal A00162-C.1 0.1 ml adult melanocytes. A00162-C 1 ml Catalog Number Volume A00153-C.1 0.1 ml MUC5AC (Gastric Mucin); Clone 45M1 A00153-C 1 ml (Concentrate) Species: Mouse Melanoma; Clone HMB45 (Concentrate) Clone: 45M1 Species: Mouse Isotype: Mouse IgG1, Kappa Clone: HMB45 Species Reactivity: Human, Monkey, Cat, Chicken, Hedgehog, Isotype: Mouse IgG1/ Kappa Mouse, Pig, Rabbit, Rat. Does not react with cow. Species Reactivity: Human. Does not react with dog and rat. Positive Control: Stomach. Positive Control: Human Melanoma Specificity: MUC5AC is expressed in airway and gastric epithelial Specificity: HMB45 has been shown to be a very specific marker cells and highly expressed in colorectal carcinomas. for melanomas. Catalog Number Volume Catalog Number Volume A00124-C.1 0.1 ml A00019-C 1 ml A00124-C 1 ml Melanoma; Pan (Concentrate) Napsin A; Clones NAPSA/1238 & NAPSA/1239 Species: Mouse (Concentrate) Clones: MART-1; Clone M2-7C10, MART-1; Clone M2-9E3, Species: Mouse Tyrosinase; Clone T311, Melanoma: HMB45. Immunogen: Recombinant human Napsin-A protein fragment Isotype: Mouse IgG1 (aa 189-299). Exact sequence is proprietary. Species Reactivity: Human. Clones: NAPSA/1238 & NAPSA/1239 Positive Control: Human Melanoma Isotype: IgG1, Kappa Specificity: Melanoma; Pan is a broad spectrum marker for Species Reactivity: Human. Others not tested. metastatic melanoma. Positive Control: Lung adenocarcinoma. Catalog Number Volume Specificity: This antibody is specific for a pepsin-like aspartic proteinase identified as Napsin A. A00134-C.1 0.1 ml A00134-C 1 ml Catalog Number Volume A00131-C.1 0.1 ml MIC2 Gene Protein, CD99; Clone HO36-1.1 A00131-C 1 ml (Concentrate) Species: Mouse Immunogen: Purified E-rosette forming cells from human peripheral blood lymphocytes. Clone: HO36-1.1 Isotype: IgM, Kappa. Species Reactivity: Human and Rat. Others-not known Positive Control: Pancreas or Ewing's sarcoma. Specificity: Recognizes a sialoglycoprotein of 27-32kDa, identified as CD99, MIC2 gene product, or E2 antigen. This antibody shows a very similar reactivity to other CD99 antibodies (e.g. O13, 12E7, or HBA-71) and is excellent for immunohistochemical staining of formalin-fixed, paraffin- embedded tissues. Catalog Number Volume A00044-C.1 0.1 ml A00044-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
146 Antibodies
Neurofilament (H&L); Clone 2F11 (Concentrate) Placental Alkaline Phosphatase (PLAP); Clone Species: Mouse ALP/870 (Concentrate) Clone: 2F11 Species: Mouse Isotype: IgG1, Kappa Immunogen: Recombinant human PLAP protein Species Reactivity: Human, Rabbit, Cat, Mouse and Rat. Does not Clone: ALP/870 react with dog. Isotype: IgG2b, kappa Positive Control: Brain Species Reac vity: Human. Others not known. Posi ve Control: HepG2 cells. Placenta or seminoma. Specificity: This antibody stains neurons (axons) of the central Specificity: Reacts with a 70kDa membrane-bound isozyme and peripheral nervous system. It is useful for the identification (Regan and Nagao type) of Placental Alkaline Phosphatase (PLAP) of tumors with neuronal differentiation viz. Neuroblastomas, occurring in the placenta during the 3rd trimester of gestation. It Ganglioneuromas, Pheochromocytomas and Esthesioblastomas. is highly specific for PLAP and shows no cross-reaction with other The antibody cross-reacts with the NF-equivalent protein in isozymes of alkaline phosphatase. mouse, rabbit, rat and swine. The antibody can also be utilized to Catalog Number Volume discriminate between Hirschsprung's disease and allied enteric nervous system malformations. A00154-C.1 0.1 ml Catalog Number Volume Renal Cell Carcinoma (RCC); Clone 66.4.C2 A00020-C.1 0.1 ml (Concentrate) A00020-C 1 ml Specie: Mouse p21WAF1; Clone WA-1 (Concentrate) Clone: 66.4.C2 Isotype: Mouse IgG2b, Kappa Species: Mouse Species Reactivity: Human, Horse. Others not tested. Clone: WA-1 Positive Control: Kidney. Isotype: Mouse IgG1, Kappa Specificity: The actual protein recognized by RCC-ma antibody is Species Reactivity: Human. a 200 kDa glycoprotein (gp200) expressed in renal epithelial cells. Positive Control: Colon Carcinoma. In normal tissue, the renal cell carcinoma/RCC-ma/gp200 Specificity: The antibody is highly specific to p21; it does not antibody stains the brush border of proximal renal tubules in cross-react with other closely related mitotic inhibitors. human kidneys. Gp200 is also expressed in some non-kidney Specificity validations include antibody recognition of tissues including breast tubules and ducts, the surface of recombinant p21 by western blot (Koike, 2011) and in direct epididymal tubular epithelia, and the colloid of thyroid follicles. ELISA assays (Rossner, 2002 & 2007). Although the exact epitope However because of the reported high expression of gp200 in for the antibody has not been mapped, the epitope appears to renal cell carcinoma, gp200 is most commonly referred to as be different from those recognize by other p21 antibody clones. Renal Cell Carcinoma Marker. Catalog Number Volume Catalog Number Volume A00125-C.1 0.1 ml A00118-C.1 0.1 ml A00125-C 1 ml A00118-C 1 ml p53; Clone BP53-12 (Concentrate) S-100; Clone 4C4.9 (Concentrate) Species: Mouse Species: Mouse Monoclonal Clone: BP53-12 Clone: 4C4.9 Isotype: IgG2a, Kappa Isotype: IgG2a Species Reactivity: Human. Will not cross-react with mouse or MW: 21-24 kD rat. Species Reactivity: Human, Cow, Mouse Cellular Localization: Nuclear. Positive Control: Melanoma or Schwannoma. Specificity: This p53 antibody recognizes a 53kDa protein, which is identified as p53 suppressor gene product. The antibody Specificity: Recognizes proteins of 21-24kDa, identified as the A reacts with the mutant as well as the wild form of p53 under and B subunits of S100 protein. S100 belongs to the family of denaturing and non-denaturing conditions. The epitope maps calcium binding proteins such as calmodulin and troponin C. within the N-terminus (aa 20-25) of p53 oncoprotein. S100A is composed of an alpha and beta chain whereas S100B is Catalog Number Volume composed of two beta chains. Antibody to S100 stains Schwannomas, ependymomas, astrogliomas, almost all benign A00109-C.1 0.1 ml and malignant melanomas and their metastases. S100 protein is A00109-C 1 ml also expressed in the antigen presenting cells such as the Langerhans cells in skin and interdigitating reticulum cells in the paracortex of lymph nodes. S100 protein is highly soluble and may be eluted from frozen tissue during staining. Catalog Number Volume A00087-C.1 0.1 ml A00087-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
147 Antibodies
Secretory Component; Clone SC05 (Concentrate) TTF-1; Clone 8G7G3/1 (Concentrate) Species: Mouse Species: Mouse Clone: SC05 Designation: Mouse Monoclonal Isotype: IgG1, Kappa Clone: 8G7G3/1 Species Reactivity: Human, Rat. Others not tested. Isotype: IgG1 Positive Control: Breast carcinoma, Lung, Stomach. Species Reactivity: Human. Others not tested. Specificity: This antibody reacts with both free and bound Positive Control: Adenocarcinoma of the Lung or Thyroid. secretory component to secretory IgA. Specificity: This antibody reacts with TTF-1 protein found in Catalog Number Volume adenocarcinomas of the lung and tumors originating in the thyroid. TTF-1 positive cells are found in Type II pneumocytes A00127-C 1 ml and Clara cells in the lung. In the thyroid, follicular and parafollicular cells are positive. In lung cancers, SOX10; Clone SOX10/991 (Concentrate) Adenocarcinomas are usually positive, while Squamous Cell Species: Mouse Carcinomas and Large Cell Carcinomas are rarely positive. In Immunogen: Recombinant human SOX10 protein fragment addition, Small-Cell Carcinomas (of any primary site) are usually (aa115-269) (exact sequence is proprietary). positive. Clone: SOX10/991 Catalog Number Volume Isotype: IgG2b, Kappa. Species Reactivity: Human and Mouse. Others-not known. A00144-C.1 0.1 ml Positive Control: HepG2 cells, Melanoma, breast carcinomas, A00144-C 1 ml gliomas. Specificity: Recognizes a protein of ~55kDa, identified as SOX10. Tyrosinase; Clone T311 (Concentrate) This antibody does not cross-react with other members of the Species: Mouse SOX-family. Clone: T311 Catalog Number Volume Isotype: Mouse IgG1 Species Reactivity: Human. A00161-C.1 0.1 ml Positive Control: Human Melanoma A00161-C 1 ml Specificity: Tyrosinase has been shown to be a very specific marker for melanomas, not cross reacting with other tumors or Thyroglobulin; Clone 2H11 (Concentrate) normal tissues tested. Species: Mouse Catalog Number Volume Clone: 2H11 Isotype: IgG1, Kappa A00132-C 1 ml Species Reactivity: Human Cellular Localization: Cytoplasmic UchL1 (PGP9.5); Clone 31A3 (Concentrate) Specificity: Thyroglobulin is a 660 kDa dimeric preprotein with Species: Mouse multiple glycosylation sites is produced by and processed within Clone: 31A3 the thyroid gland to produce the hormone thyroxine and Isotype: Mouse IgG1, Kappa triiodothyronine. Prior to forming dimmers, thyroglobulin Species Reactivity: Cow, Human, Mouse, Pig, Rat. monomers undergo conformation maturation in the Positive Control: Brain. endoplasmic reticulation. Thyroglobulin dimerization as well as Specificity: The UchL1 clone 31A3 antibody stains neuronal cell transport of thyroglobulin to the Golgi complex is calcium bodies and axons in the central and peripheral nervous systems dependent. Thyroglobulin defects resulting from defective dimer as well as small nerve fibers in peripheral tissues, including formation and export to the Golgi is thought to cause some types epidermal tissues (Day & Thompson, 2010). The antibody also of goiter. Antibody against thyroglobulin may be produced by stains neuroendrocrine cells in the kidney, pituitary, thyroid, individuals with other diseases arising from the gland such as pancreas, gastrointestinal tract, and tumors of the diffuse Hashimoto's or Graves disease. Hence the presence of neuroendocrine system. This antibody has also identified UchL1 thyroglobulin autoantibodies can help to identify disease. expression in renal tubule spermatogonia, testis, ovary, and both An body to thyroglobulin has been shown to be useful for the pregnant and non-pregnant corpus luteum. identification of papillary and follicular thyroid carcinoma; Catalog Number Volume thyroglobulin antibody positive lesions are of thyroidal origin. Carcinomas of nonthyroidal origin do not express thyroglobulin A00120-C 1 ml and hence are thyroglobulin antibody negative. It is important to note though that not every type of thyroidal lesion is thyroglobulin antibody positive, a number of forms are negative. Hence a negative result does not necessarily rule out that a given lesion or metastasis originated from the thyroid gland. Catalog Number Volume A00108-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
148 Antibodies
TTF-1 & Cytokeratin 5 Multiplex Cocktail; Clones Multiplex Cocktail 8G7G3/1 & EP42 (Ready-To-Use) Species: Mouse & Rabbit Designation: Mouse Monoclonal & Rabbit Monoclonal Clones: 8G7G3/1 & EP42 CDX-2 & CEA Multiplex Cocktail; Clones EP25 & Isotype: IgG1 & IgG COL-1 (Ready-To-Use) Species Reactivity: Human. Others not tested. Positive Control: Adenocarcinoma of the Lung or Thyroid for TTF- Species: Rabbit and Mouse 1. Skin for normal tissue and Mesothelioma for abnormal tissue Designa on: Cocktail of Rabbit and Mouse Monoclonal for Cytokeratin 5. Antibodies to CDX-2 and CEA. Principle: Multiplex IHC staining allows simultaneous testing of Immunogen: Rabbits were injected with a synthe c pep de two or more analytes on a single tissue section utilizing different corresponding to residues near the C-terminus of human CDX-2. colors for each antigenic target. BALB/C mice were injected with Human colon carcinoma cell Specificity: This antibody reacts with TTF-1 protein found in extracts (CEA). adenocarcinomas of the lung and tumors originating in the Mol. Weight: Unknown thyroid. TTF-1 positive cells are found in Type II pneumocytes Clone: EP25 & COL-1 and Clara cells in the lung. In the thyroid, follicular and Isotype: Rabbit IgG and Mouse IgG1, respec vely. parafollicular cells are positive. In lung cancers, Species Reac vity: Human Adenocarcinomas are usually positive, while Squamous Cell Posi ve Control: CDX-2: Colon for normal ssue and colon Carcinomas and Large Cell Carcinomas are rarely positive. In adenocarcinoma for abnormal tissue. addition, Small-Cell Carcinomas (of any primary site) are usually CEA: Adenocarcinoma of colon, intes ne, ovary, lung, cervix, positive. gallbladder, stomach. Cytokera n 5 is expressed in many non-kera nizing stra fied Specificity: CDX-2 expression is restricted to nuclear staining in squamous epithelia including: basal epithelia, hair follicles, positive cells while CEA expression is restricted mostly to the trachea, tongue mucosa, as well as basal cells in prostate glands lumen of colorectal crypts. The CEA antibody (COL-1) shows no and myoepithelial cells in mammary glands. Cytokeratin 5 reaction with a variety of normal tissues. CEA is not found in protein is also found in most epithelial and bispasic benign glands, stroma, or malignant prostatic cells. CEA positivity mesotheliomas, large cell carcinoma and pulmonary squamous is seen in adenocarcinomas from the lung, colon, stomach, cell carcinomas. esophagus, gallbladder, urachus, salivary gland, ovary, and This Mul plex cocktail of TTF-1 and Cytokera n 5 produces two- endocervix. color high contrast staining for differentiating primary Catalog Number Volume adenocarcinoma of the Lung from Metastatic Carcinomas of the breast and Malignant Mesothelioma. A00150-0002 2 ml A00150-0007 7 ml Catalog Number Volume A00150-0025 25 ml A00145-0002 2 ml A00145-0007 7 ml CDX2 & Cytokeratin 7 Multiplex Cocktail; Clones A00145-0025 25 ml EP25 & OV-TL12/30 (Ready-To-Use) Species: Rabbit and Mouse Designa on: Cocktail of Rabbit and Mouse monoclonal Polyclonal Ready-to-Use antibodies to CDX-2 and CK7. Immunogen: Rabbits were injected with a synthe c pep de corresponding to residues near the C-terminus of human CDX-2. BALB/C mice were injected with OTN11-ovarian cell carcinoma Alpha1-Antichymotrypsin; Polyclonal (Ready-To- cell line. Mol. Weight: Unknown Use) Clone: Clones EP25 and OV-TL12/30 Species: Rabbit Polyclonal Isotype: Rabbit IgG and Mouse IgG1, respec vely. Clone: Polyclonal Species Reac vity: Human Species Reactivity: Human. Shows no cross-reactivity with horse, Posi ve Control: CDX-2: Colon for normal ssue and colon sheep, swine, goat, cow, dog, cat, chicken, rat, mouse, mink, adenocarcinoma for abnormal tissue. kangaroo or Guinea pig. CK7: Carcinoma of ovary, lung, cervix, or breast. Positive Control: Tonsil Specificity: CDX-2 expression is restricted to nuclear staining in positive cells while CK7 expression is restricted to most glandular Specificity: This antibody recognizes macrophages and and transitional epithelia including lung, breast, bladder, and the monocytes in human colon, tonsil and skin. female genital tract and their adenocarcinomas, but not in most Catalog Number Volume gastrointestinal epithelium, prostate, hepatocyte, and squamous epithelium. A00073-0002 2 ml A00073-0007 7 ml Catalog Number Volume A00073-0025 25 ml A00148-0002 2 ml A00148-0007 7 ml A00148-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
149 Antibodies
Alpha1-Antitrypsin; Polyclonal (Ready-To-Use) c-erbB-2 Oncoprotein; Polyclonal (Ready-To-Use) Species: Rabbit Species: Rabbit Polyclonal Clone: Polyclonal Clone: Polyclonal Species Reactivity: Human and Swine. Stains weakly with horse, MW: 190 kD dog and mink, and shows no cross-reactivity with sheep, goat, Species Reactivity: Human cow, cat, chicken, rat, mouse, kangaroo or Guinea pig. Positive Control: Tonsil Specificity: This antibody reacts with the c-erbB-2 oncoprotein, a 190 kD protein. The proto-oncogene for c-erbB-2 is located on Specificity: This antibody recognizes macrophages the human chromosome 17, band 21. in human colon and tonsil. Catalog Number Volume Catalog Number Volume A00031-0002 2 ml A00074-0002 2 ml A00031-0007 7 ml A00074-0007 7 ml A00031-0025 25 ml A00074-0025 25 ml Factor VIII Related Antigen; Polyclonal (Ready-To- Alpha1-Fetoprotein (AFP); Polyclonal (Ready-To- Use) Use) Species: Rabbit Polyclonal Species: Rabbit Polyclonal Clone: Polyclonal Clone: Polyclonal MW: 270 kD Species Reactivity: Human Species Reactivity: Human Positive Control: Blood vessels in skin or intestine Specificity: This antibody reacts with alpha-1-fetoprotein. A positive staining in the hepatocytes of fetal tissue was observed. Specificity: Recognizes a multimeric glycoprotein of 270kDa, This antibody does not react with other cell or tissue types. identified as factor VIII related antigen or von Willebrand factor. Catalog Number Volume This protein has functional binding domains to platelet glycoprotein Ib, glycoprotein IIb/IIIa, collagen and heparin. Von A00058-0002 2 ml Willebrand factor is synthesized by endothelial cells and stored in A00058-0007 7 ml the Weibel-Palade granules. It mediates platelet adhesion to A00058-0025 25 ml injured vessel walls and serves as a carrier and stabilizer for coagulation factor VIII. ScyTek's antibody reacts specifically with Calcitonin; Polyclonal (Ready-To-Use) the endothelial cells of normal, reactive, and neoplastic blood Species: Rabbit and lymphatic vessels and shows a finely granular cytoplasmic Clone: Polyclonal staining. It also reacts with endocardium, platelets and megakaryocytes. Von Willebrand factor is one of the most useful Specificity: This antibody reacts with the mu-chains of human markers to identify endothelial (or megakaryocytic) lineage of IgM. Nonspecific antibodies have been removed by solid-phase neoplasms. However, because not all endothelial cells synthesize absorption. (or store) this molecule, about 30% of tumors of vascular origin fail to stain for factor VIII related antigen, regardless of whether Catalog Number Volume they are benign or malignant. A00080-0002 2 ml Catalog Number Volume A00080-0007 7 ml A00080-0025 25 ml A00059-0002 2 ml A00059-0007 7 ml CD3, T-Cell; Polyclonal (Ready-To-Use) A00059-0025 25 ml Species: Rabbit Hepatitis B Core Antigen (HBcAg); Polyclonal Clone: Polyclonal Species Reactivity: Human (Ready-To-Use) Positive Control: Tonsil Species: Rabbit Polyclonal Clone: Polyclonal Specificity: This antibody reacts with intracytoplasmic portion of Species Reactivity: Human the CD3 antigen on the T cells. It stains T cells in cortex as well as medulla of the thymus and lymphoid tissues. This antibody also Specificity: This antibody reacts in the nuclei of the liver cells of labels T cell neoplasm, malignant histiocytes and in Hodgkin's the Hepatitis type B virus infected patients. However, occasional disease. staining may also be seen in the perinuclear cytoplasm of the Catalog Number Volume infected cells. A00030-0002 2 ml Catalog Number Volume A00030-0007 7 ml A00060-0002 2 ml A00030-0025 25 ml A00060-0007 7 ml A00060-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
150 Antibodies
IgA; Polyclonal (Ready-To-Use) Ki-67 Antigen; Polyclonal (Ready-To-Use) Species: Rabbit Polyclonal Species: Rabbit Clone: Polyclonal Immunogen: Synthetic peptide from 62 base pair region of the Species Reactivity: Human human Ki-67 antigen. Clone: Polyclonal Specificity: This antibody reacts with alpha-chains of human Ig Species Reactivity: Human. A. This antibody has been absorbed to a very high level of Positive Control: Tonsil or Breast Carcinoma. specificity. Specificity: This antibody reacts with a nuclear antigen present in Catalog Number Volume proliferating human cells. A00061-0002 2 ml Catalog Number Volume A00061-0007 7 ml A00095-0002 2 ml A00061-0025 25 ml A00095-0007 7 ml A00095-0025 25 ml IgG; Polyclonal (Ready-To-Use) Species: Rabbit Polyclonal Lambda, Light Chains; Polyclonal (Ready-To-Use) Clone: Polyclonal Species: Rabbit Species Reactivity: Human Immunogen: Lambda light chain isolated from pooled urine of patients with Bence Jones proteinuria. Specificity: This antibody reacts with gamma-chains of human Clone: Polyclonal IgA. Nonspecific antibodies have been removed by solid-phase Isotype: N/A absorption. Species Reactivity: Human Catalog Number Volume Positive Control: Tonsil Specificity: This antibody reacts with free as well as bound A00062-0002 2 ml lambda light chains. Contaminating antibodies have been A00062-0007 7 ml removed by solid phase absorption. A00062-0025 25 ml Catalog Number Volume IgM; Polyclonal (Ready-To-Use) A00065-0002 2 ml Species: Rabbit Polyclonal A00065-0007 7 ml Clone: Polyclonal A00065-0025 25 ml Species Reactivity: Human Lysozyme (Muramidase); Polyclonal (Ready-To- Specificity: This antibody reacts with the m chains of human Use) IgM. Nonspecific antibodies have been removed by solid-phase Species: Rabbit Polyclonal absorption. Clone: Polyclonal Catalog Number Volume Species Reactivity: Human, Baboon, Monkey, Pig, Cat, Dog, Mouse and Rat. A00063-0002 2 ml Positive Control: Tonsil, colon or skin A00063-0007 7 ml A00063-0025 25 ml Specificity: This polyclonal antibody recognizes a protein, identified as lysozyme, also known as muramidase. This antibody Kappa Light Chain; Polyclonal (Ready-To-Use) was adsorbed with human plasma and urine proteins to remove Species: Rabbit Polyclonal the cross-reacting antibodies. Lysozymes synthesized Clone: Polyclonal predominantly in reactive histiocytes rather than in resting, Species Reactivity: Human unstimulated phagocytes. It labels myeloid cells, histiocytes, granulocytes, macrophages, and monocytes. This antibody is Specificity: This antibody reacts with free as well as bound kappa helpful in the identification of myeloid or monocytic nature of light chains. Contaminating antibodies have been removed by acute leukemia. solid phase absorption. Catalog Number Volume Catalog Number Volume A00033-0002 2 ml A00064-0002 2 ml A00033-0007 7 ml A00064-0007 7 ml A00033-0025 25 ml A00064-0025 25 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
151 Antibodies
Myoglobin; Polyclonal (Ready-To-Use) S-100; Polyclonal (Ready-To-Use) Species: Rabbit Polyclonal Species: Rabbit Clone: Polyclonal Immunogen: Recombinant full-length human S100B protein. Species Reactivity: Human Clone: Polyclonal Isotype: IgG Specificity: This antibody reacts with human myoglobin. The Species Reactivity: Human, Mouse, Rat and Cow. Others-not antibody stains strongly with the skeletal and cardiac muscles. known No non-specific staining with other tissues has been observed. Positive Control: Melanoma, Schwannoma or Brain. Catalog Number Volume Specificity: S-100 belongs to the family of calcium binding proteins. S-100A and S-100B proteins are two members of the S- A00066-0002 2 ml 100 family. S-100A is composed of an alpha and beta chain A00066-0007 7 ml whereas S-100B is composed of two beta chains. This antibody is A00066-0025 25 ml specific to an epitope located on the beta-chain (i.e. in S-100A and S-100B) but not on the alpha-chain of S-100 (i.e. in S-100A p40 (DeltaNp63); Polyclonal (Ready-To-Use) and S-100A0). This an body can be used to localize S-100A and Species: Rabbit S-100B in various tissue sections. S-100 protein has been found Clone: Polyclonal in normal melanocytes, Langerhans cells, histiocytes, Isotype: Rabbit IgG chondrocytes, lipocytes, skeletal and cardiac muscle, Schwann Species Reactivity: Human. cells, epithelial and myoepithelial cells of the breast, salivary and Cellular Localization: Nuclear. sweat glands, as well as in glial cells. Neoplasms derived from Specificity: The new marker p40 (DeltaNp63) is highly specific for these cells also express S-100 protein, albeit non-uniformly. A squamous basal cells. large number of well-differentiated tumors of the salivary gland, adipose and cartilaginous tissue, and Schwann cell-derived Catalog Number Volume tumors express S-100 protein. Almost all malignant melanomas A00112-0002 2 ml and cases of histiocytosis X are positive for S-100 protein. A00112-0007 7 ml Catalog Number Volume A00112-0025 25 ml A00036-0002 2 ml PSA (Prostate Specific Antigen); Polyclonal (Ready- A00036-0007 7 ml To-Use) A00036-0025 25 ml Species: Rabbit Polyclonal Ubiquitin; Polyclonal (Ready-To-Use) Clone: Polyclonal MW: 53 kD Species: Rabbit Species Reactivity: Human Clone: Polyclonal Species Reactivity: Human Specificity: The antigen used for immunization has been isolated from human seminal fluid. The antibody is well-suited for Specificity: This antibody detects the presence of intracellular immunohistochemistry. The performance in ELISA has not been ubiquitinated filamentous inclusions in the periphery of senile fully investigated. Primary and metastatic prostatic carcinomas plaques and neurofibrillary tangles in Alzheimer's disease and show positive staining for PSA, while non-prostatic malignancies Lewy bodies in Parkinson's disease. do not stain. Catalog Number Volume Catalog Number Volume A20038 2 ml A00035-0002 2 ml A00038 6 ml A00035-0007 7 ml A00038.0025 25 ml A00035-0025 25 ml Polyclonal Concentrates
p40 (DeltaNp63); Polyclonal (Concentrate) Species: Rabbit Clone: Polyclonal Isotype: Rabbit IgG Species Reactivity: Human. Cellular Localization: Nuclear. Specificity: The new marker p40 (DeltaNp63) is highly specific for squamous basal cells. Catalog Number Volume A00112-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
152 Antibodies
S-100; Polyclonal (Concentrate) Species: Rabbit Immunogen: Recombinant full-length human S100B protein. Clone: Polyclonal Isotype: IgG Species Reactivity: Human, Mouse, Rat and Cow. Others-not known Positive Control: Melanoma, Schwannoma or Brain. Specificity: S-100 belongs to the family of calcium binding proteins. S-100A and S-100B proteins are two members of the S- 100 family. S-100A is composed of an alpha and beta chain whereas S-100B is composed of two beta chains. This antibody is specific to an epitope located on the beta-chain (i.e. in S-100A and S-100B) but not on the alpha-chain of S-100 (i.e. in S-100A and S-100A0). This an body can be used to localize S-100A and S-100B in various tissue sections. S-100 protein has been found in normal melanocytes, Langerhans cells, histiocytes, chondrocytes, lipocytes, skeletal and cardiac muscle, Schwann cells, epithelial and myoepithelial cells of the breast, salivary and sweat glands, as well as in glial cells. Neoplasms derived from these cells also express S-100 protein, albeit non-uniformly. A large number of well-differentiated tumors of the salivary gland, adipose and cartilaginous tissue, and Schwann cell-derived tumors express S-100 protein. Almost all malignant melanomas and cases of histiocytosis X are positive for S-100 protein. Catalog Number Volume A00036-C.1 0.1 ml A00036-C 1 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
153 DNA Ploidy Analysis DNA Ploidy Analysis
Blue Feulgen DNA Ploidy Analysis Staining Kit The Blue Feulgen DNA Ploidy Analysis Staining Kit is a histochemical reagent kit for quantifying the nuclear DNA content in cells. The kit can be used on a variety of specimen types from cytocentrifuge preparations to formalin fixed paraffin embedded tissue sections. A unique formulation eliminates dye precipitation and results in a cleaner stain than conventional Feulgen reagent-based kits. This stain kit is optimized for DNA Ploidy specimens that will be stained then scanned and viewed on image analysis systems.
The basis of the Feulgen staining procedure is the use of an acid hydrolysis step to remove purines from the deoxyribose backbone of the DNA molecule. The newly exposed deoxyribose sugars have an aldehyde group, and this can then be identified by staining with a Schiff reagent (in this case, an aqueous solution of cresyl-violet and sulfurous acid used to test for the presence of aldehydes).
The amount of stain color developed is directly proportional to the amount of DNA present in the stained cells.
Storage: 2-8 deg. C.
Kit Contents: 2 x 500ml Bottles of Ready-To-Use Liquid Stain 10 vials of Decolorizer 10 vials of Rinse Buffer Catalog Number Volume DPK500 1 kit(s) DPK500-5 5 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
154 Histology
CoreDish for Prostate Biopsies Histology Few recommendations concerning how the biopsies should be handled have been published. Performing a large number of biopsies means an increase in the number of containers handled Equipment (Hist.) and consequently a technical overload of the transmission network, which occurs without any financial counterpart. A new approach had to be developed in order to increase productivity.
Simport is proud to offer a multi-compartment container for Blue Base for Dissecting Board prostate biopsies. The CoreDish is in the shape of a dish To make dissecting more confortable, this heavy-duty base is measuring only 15 mm high x 95 mm diameter and is half used to elevate the DissecTable Board to the right height. The prefilled with 10% Neutral Buffered Formalin. The screw on lid bases are stackable and will not move sideways during the incorporates an O-ring in order to make it leakproof and protect dissecting work. The base will also retain excess fluid if necessary. its contents. The CoreDish conforms to OSHA directives. An area for patient information is provided on the label. Each Dimensions: 481 mm x 656 mm x 91 mm (19 1/4 x 26 1/4 x 3 5/8 compartment is clearly identified to allow proper placement and in H) visualization of the prostate biopsy being inserted. Out of eight compartments, six are labeled: Base, Lateral Base, Medial, Catalog Number Volume Lateral Medial, Apex, Lateral Apex. M625 1 ea. Thanks to the CoreDish it is no more necessary to use a multitude Cassettes in QuickLoad Sleeves of individual containers, thereby reducing risks of confusion. The sleeved cassettes are especially made to be used with ThermoFisher printers. Cassettes with tape are to be used with Qty/Cs 10 Leica and Sakura Ink Jet printers. Molded from a special high Catalog Number Volume density acetal polymer, they keep specimens safely submerged M970-D8P-PREFILLED 1 Case(s) and are totally resistant to the chemical action of solvents used in M971-D8P 1 Case(s) histology laboratories. The efficient flow-through slots maximize fluid exchange and ensure proper reagent drainage. CoreDish Prostate Biopsy Container with 10% Catalog Number Volume Formalin M480-11SL-ORANGE 1 ea. Few recommendations concerning how the biopsies should be M480-12SL-AQUA 1 ea. handled have been published. Performing a large number of M480-2SL-WHITE 1 ea. biopsies means an increase in the number of containers handled M480-3SL-PINK 1 ea. and consequently a technical overload of the transmission M480-4SL-GREEN 1 ea. network, which occurs without any financial counterpart. A new M480-5SL-YELLOW 1 ea. approach had to be developed in order to increase productivity. M480-6SL-BLUE 1 ea. M480-9SL-GRAY 1 ea. Simport is proud to offer a multi-compartment container for prostate biopsies. The CoreDish is in the shape of a dish M480-7SL-PEACH 1 ea. measuring only 15 mm high x 95 mm diameter and is half M480-10SL-GRAY 1 ea. prefilled with 10% Neutral Buffered Formalin. The screw on lid M480-8SL-TAN 1 ea. incorporates an O-ring in order to make it leakproof and protect CoreDish for Lower GI Track Biopsies its contents. The CoreDish conforms to OSHA directives. An area for patient information is provided on the label. Each For lower GI track biopsies. Twelve compartments. An area for compartment is clearly identified to allow proper placement and patient information is provided. Ten labeled compartments: visualization of the prostate biopsy being inserted. All twelve Proximal Flexure Colon, Hepatic Flexure Colon, Distal Transverse compartments are labeled: Colon, Ascending Colon, Splenic flexure Colon, Cecum, L Base, R Base, L Lateral Base, R Lateral Base, L Lateral Medial, L Decending Colon, Terminal Ileum, Rectum, Sigmoid Colon. Medial, R Medial, R Lateral Medial, Leakproof seal, thanks to O-ring lid, allows for safe and easy L Lateral Apex, L Apex, R Apex, R Lateral Apex. transport of the specimens from collection to analysis. Thanks to the CoreDish it is no more necessary to use a multitude Made of polystyrene. of individual containers, thereby reducing risks of confusion.
Qty/Cs 10 Made of polystyrene. Catalog Number Volume Qty/Cs 10 M970-D12LGIPREFILLE 1 Case(s) M971-D12LGI 1 Case(s) Catalog Number Volume M970-D12P-PREFILLED 1 Case(s) M971-D12P 1 Case(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
155 Histology
CoreDish Upper GI Tract EasyDip Slide Staining System Upper GI track biopsy container with 10% formalin. For upper GI Finally a user-friendly approach for staining your microscope track biopsies. Eight compartments. An area for patient slides, the EasyDip Slide Staining System has two components: a information is provided. Seven labeled compartments: Gastric square staining jar and a 12 - position vertical slide rack. Jars can Card, Gastric Body, GE Junction, Gastric ATR, Distal Esophage, be loosely joined to each other laterally, therefore making sure Pylorus, Duodeum. Leakproof seal, thanks to O-ring lid, allows for they are kept in the same order when moved around on the lab safe and easy transport of the specimens from collection to counter. As an extra benefit, they are available in 5 different analysis. 10 per case. colors to help better identifying contents or applications.
Made of polystyrene. The staining jar being made of resistant acetal plastic will not Catalog Number Volume break like most glass jars do. It will resist most staining agents including alcohol and xylene (but not phenol, iodine or ferric M970-D8UGI-PREFILLE 1 Case(s) chloride ). The wide stable base offers greater stability while the M971-D8UGI 1 Case(s) inside is recessed, allowing for a smaller reagent volume of only 80 ml. Easy to clean and no metals to corrode. Ideal for special Dissecting Board stains, frozen sections and special processes. Will resist A new and unique approach makes this dissecting board more temperatures between -170 C and +121 C. Autoclavable. convenient than any other found on the market today. It is no Dimensions: 64 x 76 x 92 mm H (2 1/2 x 3 x 3 5/8 in. H). more necessary to buy different sizes as this board offers a large surface on one side and two smaller ones on the other side. Each case indudes 5 jars (one of each color) and 1 rack M905- 12DGY. Made of heavy-duty stain resistant thick polyethylene, it will last Catalog Number Volume for years to come without changing shape, bending or swelling. Will not dull fine surgical blades. In order to contain fluids, a M900-12G-GREEN 1 Case(s) drain groove is carved all around the edge of the DissecTable. M900-12Y-YELLOW 1 Case(s) M900-12B-BLUE 1 Case(s) On one side, you will find a large cutting area including M900-12P-PINK 1 Case(s) dimensional scales in inches and centimeters, along with a 60 x M900-12W-WHITE 1 Case(s) 80 mm grid made of 48 x 10 mm squares. Six dimensional circles M900-12AS-ASSORTED 1 Case(s) are also printed from 1/8 to 5/8 in. and 4 to 14 mm in diameter. Flip it over and the other side offers two cutting boards half the EASYDIP Stainless Steel Holder size with the same dimensional features printed on each one of Made of Stainless Steel. Will hold up to 6 Jars. them. All corners have rubber feet giving more stability to the working surface. Catalog Number Volume M906 1 ea. Dimensions: 575 mm x 400 mm x 12.5 mm (23 x 16 x 1/2 in H) Catalog Number Volume Embedding Cassettes M620 1 ea. Disposable plastic tissue cassettes are suitable for holding and identifying tissue samples in processing, embedding, and Dissecting Board Jr. sectioning procedures. The cassettes fit securely in microtome chuck adapters. They are molded from a high density polymer A smaller DissecTable is also available with the same features that is totally resistant to the chemical action of histological and benefits as the M620. Perfect for smaller counter area. solvents. These cassettes are designed to accept standard metal lids (cat.# M481) and will keep specimens in complete safety Dimensions: 330.2 mm x 279.4 mm x 12.5 mm (13 x 11 x 1/2 in during processing. The slanted writing surface accepts markings H) easily, permitting sample identification throughout all stages of Catalog Number Volume embedding and long afterwards when in archives. They are M618 1 ea. available in 11 colors. Each case contains 3 dispenser boxes of 500 cassettes. Catalog Number Volume M480-3-PINK 1 ea. M480-10-LILAC 1 ea. M480-11-ORANGE 1 ea. M480-8-TAN 1 ea. M480-2-WHITE 1 ea. M480-6-BLUE 1 ea. M480-9-GRAY 1 ea. M480-12-AQUA 1 ea. M480-4-GREEN 1 ea. M480-7-PEACH 1 ea. M480-5-YELLOW 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
156 Histology
Heat Extractor with Plastic Knob Slide Master Catalog Number Volume (An Innovative Immunohistochemistry Humidity Chamber) IMS006 1 ea. ScyTek Laboratories, Inc. proudly introduces SlideMaster. A Heat Extractor, Stainless Steel, Small humidity chamber designed by a histotechnologist that eliminates the majority of individual slide handling. Catalog Number Volume SlideMaster has three different parts: A humidity chamber, two IMS007 1 ea. individual slide holders with white contrast bars, and a waste receptacle. It has been designed so that all three components Manual Staining System (12 Wells) are compact and easy to use. A maximum of 20 slides can be used per unit. The Manual Staining System (12 Wells) includes one (1) Stainless This is how it works. A hydrophobic barrier (PAP Pen, Catalog Steel base tray and twelve (12) interchangable plastic wells. Each #LP0001) is drawn around the tissue section and slides are put in well comes with a lid to reduce evaporation of reagents between a special slide holder that secures them into place. Drops of staining. Designed for use with Slide Racks IMS002 or IMS003 antibody are placed on the slides and incubated. After (Sold Seperately). incubation, the individual slide holders can be tilted and secured Catalog Number Volume at a 45 degree angle. All 20 slides are rinsed off in one easy IMS001 1 ea. motion and the buffer (PBS-Tween 20, Catalog # ABA125 or TBS- Tween 20, Catalog # TBS125) drains into the waste receptacle. Metal Lid for M480 Cassette Slides are gently blotted (tissue paper) at the bottom portion of the hydrophobic barrier, which draws off any remaining liquid on Metal Lid for M480 Cassette. the tissue. The slide holders are then placed back in the Qty/Pk 25 horizontal position and incubation and rinse steps are repeated Catalog Number Volume in the same fashion. M481 1 ea. For chromogen development, the SlideMaster unit has a contrast Slide Holder Stainless Steel Rack (for 30 Slides) bar that changes the background from black to white. The black background produces high contrast so that the tissues mounted Stainless Steel Slide Holder is ideal for use in routine and special glass slides can be easily seen, and the white background stain procedures. Rack holds 30 slides and is designed for use produces high contrast and allows the technician to monitor the with the Stainless Steel Dish with Cover catalog# IMS004 (sold chromogen development. Slides are then rinsed and serperately). counterstained and are then ready for coverslipping. Catalog Number Volume SlideMaster is very easy to use. It is light weight and durable. IMS005 1 ea. By making the hydrophobic barrier around the tissue section as small as possible, the total volume of antibody reagent can be significantly reduced per slide. Instead of using 100-200 microliters of antibodies per tissue section usually 50 microliters will completely cover small tissues and 100 microliters will cover larger tissues. With this method, slide staining is much more efficient, more consistent, drying-out of slides is minimized, and the cost of reagents is reduced. Catalog Number Volume E00001 1 ea. Slide Rack (24 Slides), Plastic Basket with Metal Handle Slide Rack (24 Slides) is designed for use with Manual Staining System (12 Wells) catalog# IMS001 (Sold Seperately). The rack consists of a plastic basket with a durable metal handle. Catalog Number Volume IMS002 1 ea. Slide Rack (for 24 Slides), Stainless Steel Slide Rack (24 Slides) is designed for use with Manual Staining System (12 Wells) catalog# IMS001 (Sold Seperately). The rack consists of a stainless steel basket and handle. Catalog Number Volume IMS003 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
157 Histology
Slidefile Storage System 100 Positions Vertical Slide Staining Rack Dark Gray Each SlideFile Storage System includes a slide box and a The EasyDip Slide Staining Rack will hold up to 12 microscope removable tray. A tinted hinged cover makes the contents of the slides with dimensions such as 75 x 25 mm, (3 x 1 in.) and even box easy to see at a glance.The base is available in five different 76 x 26 mm and with a thickness of 1.0 and 1.2 mm. The slides fit colors to help in slide classification and to minimize the possibility into individual slots for free passage and rapid drainage of of sample mix-up. staining fluids. Since they are placed vertically in the rack and not horizontally, their writing area will not be stained by the fluid, The key to the SlideFile System is a removable tray inside the allowing their removal without the use of forceps. The lid storage box having a hundred individual numbered slots. All completely covers the EasyDip Slide Staining Jar to minimize spill slides are stored upright for easier insertion and removal. Simply and evaporation. A handle is permanently attached to the rack tilt them forward and backward with one finger to easily and for easy insertion and removal of slides without your fingers rapidly pick up the slide you need. A unique feature with this touching the solution. Available in dark gray only. Will resist system is to be able to read bar codes without having to remove temperatures between -170 C and +121 C. Autoclavable. the slides from the box. Dimensions: 60 x 64 x 97 mm H (2 1/4 x 2 1/2 x 3 3/4 in. H). Catalog Number Volume For space saving purposes, you can double the amount of slides simply by storing two slides per slot. For maximum storage M905-12DGY 1 Case(s) space, simply remove the tray and line up 400 slides in 3 rows for long term storage. Will resist temperatures between -80 C and +80 C. Not autoclavable. Fixing Fluids
Dimensions: 82 x 245 x 86 mm H (3 1/4 x 9 5/8 x 3 3/8 in. H) Catalog Number Volume M700-100W-WHITE 1 Case(s) Bouin's Fluid Bouin's Fluid is a fixative useful for several routine procedures. It Stain Tray Slide Staining System contains formaldehyde and picric acid for both cytoplasmic and Made of ABS Plastic chromatin fixation and facilitates excellent H&E staining. Is has also been recommended for any general fixation procedures and Another user friendly approach to immunohistochemistry may be used as a substitute for Zenker's Fluid. It is also used as a staining. This tray is also suitable not only for routine staining post-fixation step that is critical for the bright coloration requiring a humid chamber but is also ideal for Hematology, demonstrated with Trichrome special stain procedures. Cytology and Microbiology laboratories. Manipulation is made Catalog Number Volume safe and easy by using only one hand. BNF125 125 ml The StainTray has a black base made of tough ABS plastic withstanding a wide range of chemicals (Avoid chlorinated BNF500 500 ml hydrocarbons). It will accept up to 20 slides on four plastic rails BNF999 1000 ml covered with a polymer strip to perfectly hold slides even if tray BNF3800 1 Gal. is held at an angle. When humidity is needed, wells between rails will hold up to one ml of water securely without splashing. Formalin (10% Neutral Buffered) Middle wells will hold up to 2 ml each. Rails are raised not only to Formalin (10% Neutral Buffered) is one of the most widely used avoid water touching the slides but to make them more easily fixatives for the prevention of tissue degradation. Proper fixation retrieveable. The base will also hold excess stain solution is critical for histopathologic procedures and evaluation. This dripping from the slides. Four rubber feet ensure greater base reagent contains formaldehyde and phosphate buffers in an stability. Units are stackable for space saving purposes. aqueous solution. Catalog Number Volume Two covers are available: A clear one (M920-1) allowing for visual examination. Made of FRN125 125 ml PETG with a temperature range of -20 C to +60 C. FRN500 500 ml A black lid (M920-2) for fluorescent work. Made of ABS with a FRN999 1000 ml temperature range of -80 C to +80 C. FRN3800 1 Gal.
Dimensions with cover: 38 W x 24 D x 4.5 H cm (15 W x 9 3/8 D x Mer/Cure (Stabilized Iodine Solution) 1 3/4 H in.) Is a single component reagent for the rapid removal of mercury Catalog Number Volume crystals from tissue sections fixed with mercury containing fluids M920-1 1 Clear (ie. B5, or Zenker's). M920-2 1 Black Catalog Number Volume MSI500 500 ml Stainless Steel Dish with Cover (for 30 Slide Holder) Stainless Steel Dish with Cover is ideal for use in routine and Zinc Formalin Solution special stain procedures. Zinc Formalin is a tissue fixative for routine procedures. Catalog Number Volume Catalog Number Volume IMS004 1 ea. ZFN500 500 ml ZFN999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
158 Histology
Differentiating Solution (Acid Alcohol) - 95% Transport Media May be used in the removal of excess hematoxylin stain. Reagents contain 3% (v/v) hydrochloric acid in alcohol. Catalog Number Volume DSN500 500 ml CytoPort, Cytology Transport Media DSN999 1000 ml This reagent is intended for use as a transport media for mammalian cells for subsequent testing. Samples may be Hematoxylin, For Automation transported at room temperature. Produces a crisp blue nuclei. Hematoxylin, For Automation has Catalog Number Volume been specifically formulated for situations in which a lighter blue nuclei is desired (IHC, etc.). This reagent is ideal for use with CTM500 500 ml autostainers. CTM999 1000 ml Catalog Number Volume Michel's Transport Fluid HAQ500 500 ml Michel's Transport Fluid is intended for use as a transport media HAQ999 1000 ml of specimens (such as renal biopsies and lymph nodes) for immunofluorescence studies. Samples may remain in media for Hematoxylin, Mayer's (Lillie's Modification) up to 5 days at room temperature. This reagent is not a fixative Produces a crisp dark blue nuclei. A traditional formulation that and is not suitable for transporting live cells for flow cytometry. results in an excellent quality stain that is more intense than our Prior to processing, specimens should be washed in 3 changes of Hematoxylin, For Automation (catalog# HAQ999). For optimal Michel's Transport Wash Buffer (cat.# MTW) for 10 minutes each. results, use in combination with Bluing Reagent (catalog# Catalog Number Volume BRT999). MTF500 500 ml Catalog Number Volume MTF999 1000 ml HMM125 125 ml MTF-10000 10 L HMM500 500 ml MTF-20000 20 L HMM999 1000 ml HMM3800 1 Gal. Michel's Transport Wash Buffer This reagent is intended for use as a wash buffer for Michel's Hematoxylin, Weigert's Iron Kit Transport Fluid. Michel's Transport Fluid is intended for use as a Weigert's Iron Hematoxylin is intended to be used with various transport media of specimens (such as renal biopsies and lymph special stain kits. Product is supplied as a two component (equal nodes) for immunofluorescence studies. Samples may remain in volumes of parts A and B) system that is mixed prior to use and media for up to 5 days at room temperature. This reagent is not results in black/blue nuclei. a fixative and is not suitable for transporting live cells for flow Catalog Number Volume cytometry. Prior to processing, specimens should be washed in 3 changes of Michel's Transport Wash Buffer for 10 minutes each. HWI-1 250 ml Catalog Number Volume HWI-2 1000 ml HWI-3 2000 ml MTW500 500 ml MTW999 1000 ml Methylene Blue Solution MTW-10000 10 L Methylene Blue Solution has been optimized in our research MTW-20000 20 L laboratories to give outstanding results when used in various procedures such as the Ziehl-Neelsen, Fite's, and Gram stain. Nuclear Stains The stain is also suggested for use in staining a variety of bacteria (Corynebacterium diphtheria, Haemophilus influenzae, Neisseria, etc.) and leukocytes. This reagent produces dark blue nuclei with very light blue cytoplasm.
Bluing Reagent Nuclei: Dark Blue Cytoplasm: Light Blue Is a pH-controlled solution for complete, effective bluing of Corynebacterium Diphtheria: Blue Granules hematoxylin in histological and cytological procedures. Escherichia Coli: Blue Rods Catalog Number Volume Streptococcus Pyogenes: Blue Cocci BRT500 500 ml Catalog Number Volume BRT999 1000 ml MBS125 125 ml BRT3800 1 Gal. MBS500 500 ml MBS999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
159 Histology
Nuclear Fast Red Solution (Enhanced Stability) Eosin Y Solution (Modified Alcoholic) Nuclear Fast Red is a stain with histological applications. The Eosin Y Solution (Modified Alcoholic) is intended for use in reagent has improved stability over current formulations histology and cytology applications. This newly formulated Eosin allowing storage at temperatures ranging from 2-30 Centigrade. provides the benefits of a traditional alcoholic formula with Current formulations tend to precipitate in cold temperatures significant improvements in usability. Advantages include lower such as experienced during winter shipping. In addition, most evaporation rate, better color patterns, reduced tendency to spill formulations develop a small amount of precipitate over over container, hands, and countertops, and improved surface extended periods of time. This advanced formulation eliminates tension to remain on tissue section. problems associated with exposure to cold and aging. Cytoplasm: Light Pink Nuclei: Red Collagen: Pink Cytoplasm: Pale Pink Muscle: Pink/Rose Catalog Number Volume Erythrocytes: Pink/Red NFS125 125 ml Catalog Number Volume NFS500 500 ml EYB500 500 ml NFS999 1000 ml EYB999 1000 ml NFS3800 1 Gal. EYB3800 1 Gal. Eosin-Phloxine Solution Cytoplasmic Stains Eosin-Phloxine Solution is intended for use in the histological demonstration of cytoplasm. The addition of Phloxine to Eosin results in more vibrant staining than with Eosin alone. When used correctly, Eosin-Phloxine various shades of pink can be Eosin Y Solution (Alcoholic) obtained to aid in visualization of tissue components. Eosin Y Solution is intended for use in the histological Cytoplasm: Pink to Red demonstration of cytoplasm and is commonly used as a Erythrocytes: Pink to Red counterstain for Hematoxylin. When used correctly, various Alcoholic Hyalin: Pink shades of pink can be obtained to aid in visualization of tissue Catalog Number Volume components. Erythrocytes, collagen, and the cytoplasm of muscle or epithelial cells will stain with different shades of pink. EPN500 500 ml EPN999 1000 ml Cytoplasm: Pink to Red EPN3800 1 Gal. Erythrocytes: Pink to Red Nuclei: Black/Blue (Hematoxylin) OG-6 Solution Catalog Number Volume OG-6 is a cytologic stain routinely used in diagnostic cytology to aid in the identification and classification of exfoliative cells. The EYA500 500 ml stain is used for examining exfoliative cells of vaginal, cervical, EYA999 1000 ml sputum, as well as other body secretions. Commonly used in EYA3800 1 Gal. combination with hematoxylin. Eosin Y Solution (Aqueous) Catalog Number Volume Eosin Y Solution (Aqueous) is intended for use in the histological OGA500 500 ml demonstration of cytoplasm and is commonly used as a OGA999 1000 ml counterstain for Hematoxylin. When used correctly, various OGA3800 1 Gal. shades of pink can be obtained to aid in visualization of tissue components. Erythrocytes, collagen, and the cytoplasm of muscle or epithelial cells will stain with different shades of pink.
Cytoplasm: Pink to Red Erythrocytes Pink to Red Nuclei: Black/Blue (Hematoxylin) Catalog Number Volume EYQ500 500 ml EYQ999 1000 ml EYQ3800 1 Gal.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
160 Histology
Alcian Blue (pH 2.5) Staining Kit Special Stains The Alcian Blue (pH 2.5) Stain Kit is intended for use in the histological visualization of sulfated and carboxylated acid mucopolysaccharides and sulfated and carboxylated sialomucins Special Stain Kits (glycoproteins).
Acidic Sulfated Mucosubstances: Blue Hyaluronic Acid: Blue Acid Fast Bacteria (AFB) Stain Kit Sialomucins: Blue The Acid Fast Bacteria (AFB) Stain Kit is intended for use in the Nuclei: Red histological visualization of Acid Fast Bacteria and Tubercle Background: Pink Bacilli. This kit is a rapid 15-minute procedure. The lipoid capsule of the acid-fast organism takes up carbol fuchsin and Control: Intestine or Colon. resists decolorization. Contents: Alcian Blue Solution (pH 2.5), 250ml Acid Fast Organisms: Bright Red Acetic Acid Solution, 500ml Background: Light Green Nuclear Fast Red, 250 ml Catalog Number Volume Catalog Number Volume FAB-2 30 ml ea. AFR-2 30 ml ea. FAB-1 125 ml ea. AFR-1 250 ml ea. FAB-500 500 ml ea. Amyloid Stain Kit (Congo Red) Alcian Blue - PAS Stain Kit The Amyloid Stain Kit (Congo Red) is intended for use in the The Alcian Blue - PAS Stain Kit is intended for use in the histological visualization of amyloid in tissue sections. simultaneous histological visualization of sulfated and Examination under a polarizing microscope results in green carboxylated acid mucopolysaccharides, sulfated and birefringence of amyloid. carboxylated sialomucins (glycoproteins) and neutral mucins. Amyloid: Red to Pink Acidic Sulfated Mucosubstances: Blue Erythrocytes: Light Orange Hyaluronic Acid: Blue Eosinophil Granules: Orange to Red Sialomucins: Blue Nuclei: Blue Neutral Mucins: Magenta Catalog Number Volume Mixtures of Acidic and Neutral Mucins: Blue - Mauve AMY-2 1 kit(s) depending on dominant entity. AMY-1 1 kit(s) Catalog Number Volume APS-2 100 Slides Bielshowsky's Stain Kit (Modified) APS-1 1 kit(s) The Bielschowsky's Stain Kit (Modified) is designed for histological visualization of nerve fibers, neurofibrillary tangles Alcian Blue (pH 1.0) Stain Kit and senile plaques in Alzheimer's disease. The Alcian Blue (pH 1.0) Stain Kit is intended for use in the histological visualization of strongly sulfated mucosubstances. Axons: Black Neurofibrillary Tangles: Black Strongly Sulfated Mucosubstances: Blue Senile Plaques: Black Nuclei: Red Nuclei: Dark Brown Background: Pink Background: Yellow to Light Brown Catalog Number Volume Catalog Number Volume AFT-2 1 kit(s) BSK-1 1 kit(s) AFT-1 1 kit(s) Calcium Stain Kit (Modified Von Kossa) The Calcium Stain Kit (Modified Von Kossa) is intended for use in the histological visualization of calcium deposits in paraffin sections.
Calcium in mass deposits: Black Calcium in dispersed deposits: Gray Nuclei: Red Cytoplasm: Light Pink Catalog Number Volume CVK-2 1 kit(s) CVK-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
161 Histology
Colloidal Iron Stain Kit Fontana-Masson Stain Kit (For Argentaffin Cells The Colloidal Iron Stain Kit is designed for the histological and Melanin) visualization of acid mucopolysaccharides. The Fontana-Masson Stain Kit is intended for use in the histological visualization of Argentaffin cells and Melanin in Acid Mucopolysaccharides: Bright Blue paraffin or frozen sections. Collagen: Shades of Red Catalog Number Volume Argentaffin Cells: Black Melanin: Black CIK-2 100 Slides Nuclei: Red CIK-1 1 kit(s) Cytoplasm: Light Pink Copper Stain Kit Catalog Number Volume The Copper Stain Kit is intended for the demonstration of copper FMS-2 1 kit(s) deposits in tissue sections. FMS-1 1 kit(s)
Copper Deposits: Light Brown to Red Giemsa Stain Kit (May-Grunwald) Nuclei: Blue The Giemsa Stain Kit (May-Grunwald) is intended for use in the Catalog Number Volume visualization of cells present in hematopoietic tissues and certain microorganisms. This kit may be used on formalin-fixed, paraffin- CSK-2 1 kit(s) embedded sections. CSK-1 1 kit(s) Elastic Stain Kit (Modified Verhoff's) Nuclei: Blue/Violet Cytoplasm: Light Blue The Elastic Stain Kit is intended for use in histological Collagen: Pale Pink demonstration of elastin in tissue sections. Demonstration of Muscle Fibers: Pale Pink elastic tissue is useful in cases of emphysema (atrophy of elastic Erythrocytes: Gray, Yellow or Pink tissue), arteriosclerosis (thinning and loss of elastic fibers) and Rickettsia: Reddish-Purple various other vascular diseases. Helicobacter Pylori: Blue Mast Cells: Dark Blue with Red Granules Elastic fibers: Black to Blue/Black Catalog Number Volume Nuclei: Blue to Black Collagen: Red GMG-2 100 Slides Muscle & Other: Yellow GMG-1 1 kit(s) Catalog Number Volume GMS Stain Kit ETS-2 1 kit(s) The Modified Gomori Methenamine-Silver Nitrate Stain (GMS ETS-1 1 kit(s) Stain Kit) is intended for use in the histologic visualization of Eosinophil - Mast Cell Stain Kit fungi, basement membrane and some opportunistic organisms such as Pneumocystis carinii. The Eosinophil - Mast Cell Stain Kit is intended for simultaneous Catalog Number Volume visualization of eosinophils and mast cells. KAA-1 125 ml ea. Mast Cells: Bright Blue KAA-500 500 ml ea. Eosinophils: Bright Red KAA-1000 1000 ml ea. Nuclei: Blue Gram Stain Kit Catalog Number Volume The Gram Stain Kit is intended for the demonstration and CEM-2 1 kit(s) differentiation of Gram-positive and Gram-negative bacteria. CEM-1 1 kit(s) Fite's Stain Kit Gram Positive Bacteria: Blue Gram Negative Bacteria: Red The Fite's Stain Kit (For Leprosy) is intended for use in the Other Tissue: Yellow histological visualization of mycobacterium leprae (leprosy) and Nuclei: Red Nocardia. Catalog Number Volume Lepra bacillus: Red GSK-2 30 ml ea. Nocardia: Red GSK-1 125 ml ea. Background: Blue GSK-500 500 ml ea. Catalog Number Volume FLS-1 125 ml ea. FLS-500 500 ml ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
162 Histology
Gram Stain Kit (Modified Brown & Brenn) Hematoxylin and Eosin Stain Kit The Gram Stain Kit (Modified Brown & Brenn) is intended for the The Hematoxylin and Eosin Stain Kit is intended for use in demonstration and differentiation of Gram-positive and Gram- histology and cytology applications. Included in this kit is a newly negative bacteria. formulated Eosin that provides the benefits of a traditional alcoholic formula with significant improvements in usability. Gram Posi ve Bacteria: Blue Advantages include lower evaporation rate, better color Gram Nega ve Bacteria: Red patterns, reduced tendency to spill over container, hands, and Background: Yellow countertops, and improved surface tension to remain on tissue Nuclei: Red section. Our Hematoxylin produces crisp, intense blue nuclei Catalog Number Volume providing optimal contrast to the Eosin stained cytoplasm. BBS-2 30 ml ea. Cytoplasm: Light Pink BBS-1 125 ml ea. Collagen: Pink BBS-500 500 ml ea. Muscle: Pink/Rose Erythrocytes: Pink/Red H. Pylori Rapid Stain (1-Step) Nuclei: Blue The H. Pylori Rapid Stain (1-Step) is a single component reagent Catalog Number Volume that has been developed to identify helicobacter pylori in a HAE-2 100 Slides procedure that requires less than 10 minutes to complete. HAE-1 1 kit(s) Procedure is effective for fresh, frozen, and paraffin embedded sections. Helicobacter Pylori has been shown to be the causative Herovici's Stain Kit organism in some gastric ulcers. The Herovici stain kit is intended to differentiate between young H. Pylori: Dark Blue/Purple and mature collagen. Young collagen and reticulin stain blue and Cytoplasm: Pink to Red Mature collagen stains red. Weigert's Iron Hematoxylin is Background: Violet provided to stain nuclei blue to black. Nuclei: Blue Catalog Number Volume Catalog Number Volume HSK-1 1 kit(s) HPS030 30 ml HPS500 500 ml Iron Stain Kit HPS999 1000 ml The Iron Stain Kit is intended for use in the detection of ferric iron in tissues, blood smears, or bone marrow smears. Ferric H. Pylori Rapid Stain Kit iron is normally found in small amounts in bone marrow and the The H. Pylori Rapid Stain Kit is designed for demonstrating spleen. Abnormally large deposits may be seen in Helicobactor Pylori infected tissue. Kit may be used on formalin hemochromatosis and hemosiderosis. This product is based on fixed, paraffin-embedded tissue. The Warthin-Starry Stain Kit the Prussian Blue reaction in which ionic iron reacts with acid (WSS-1) is a more sensitive system for H. Pylori and is suggested ferrocyanide producing a blue color. for cases where total H. Pylori count is low. Tissue Sections: Results: Helicobactor Pylori: Blue Iron: Bright Blue Mucin: Yellow Nuclei: Red Background: Light Blue Background: Pink Catalog Number Volume Catalog Number Volume AYH-2 100 Slides IRN-2 100 Slides AYH-1 1 kit(s) IRN-1 1 kit(s) Jones Stain Kit (For Basement Membrane) The Jones Stain Kit is intended for use in histological demonstration of the basement membrane and reticular fibers. This procedure is ideal for staining renal glomerular basement membranes. The main function of the basement membrane and reticular fibers is to provide anchorage and support. They are normally found throughout the body, particularly in the kidney, spleen, and lung.
Basement Membrane: Black Reticulum Fibers: Black Nuclei: Red Cytoplasm: Light Pink Catalog Number Volume JSK-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
163 Histology
Luxol Fast Blue Stain Kit Orcein Stain Kit (For Hepatitis B and Elastic Fibers) The Luxol Fast Blue Stain Kit is designed for staining The Orcein Stain may be used in histology procedures for the myelin/myelinated axons and Nissil substance on formalin fixed, visualization of Hepatitis B surface Antigen (HBsAg), elastic fibers, paraffin-embedded tissue. This product is used for identifying and copper associated proteins. HBsAg appears as irregular the basic neuronal structure in brain or spinal cord sections. shaped aggregates in the cytoplasmic region of the cells. This Catalog Number Volume reagent may be used on formalin-fixed, paraffin-embedded sections. LBC-2 1 kit(s) LBC-1 1 kit(s) HBsAg: Dark Red/Brown Elastic Fibers: Dark Red/Brown Movat Pentachrome Stain Kit (Modified Russell- Copper Assoc. Proteins: Dark Red/Brown Movat) Background: Light Reddish/Purple The Movat Pentachrome Stain Kit (Modified Movat) is intended Catalog Number Volume for use in histological demonstration of collagen, elastin, muscle, HBK-2 1 kit(s) mucin and fibrin in tissue sections. This procedure is particularly HBK-1 1 kit(s) useful when studying the heart, blood vessels and various vascular diseases. Papanicolaou (PAP) Stain Kit Elas c Fibers: Black to Blue/Black The Papanicolaou (PAP) Stain Kit is designed to differentiate Nuclei: Blue/Black between a variety of cells in vaginal smears for detection of Collagen: Yellow vaginal, uterine and cervical cancer. In addition, this procedure is Re cular Fibers: Yellow valuable for staining a variety of other bodily secretions and cell Mucin: Bright Blue smears. The procedure was developed in the early 1940's by Fibrin: Bright Red George Papanicolaou. Muscle: Red Nuclei: Blue Catalog Number Volume High Keratin Cells: Orange MPS-2 1 kit(s) Superficial Cells: Pink MPS-1 1 kit(s) Erythrocytes: Dark Pink Parabasal Cells: Blue/Green Mucicarmine Stain Kit (Modified Southgate's) Intermediate Cells: Blue/Green Mucicarmine Stain Kit (Modified Southgate's) is intended for use Metaplastic Cells: May contain both Blue/Green and Pink. in the histological visualization of acid mucopolysacharides in Catalog Number Volume tissue sections. This product is useful in distinguishing mucin PAP-2 1 kit(s) negative undifferentiated squamous cell lesions from mucin PAP-1 500 ml ea. positive adenocarcinomas. In addition, this product will stain the mucopolysaccharide capsule of Cryptococcus neoformans. PAP-3 1000 ml ea. Periodic Acid Schiff (PAS) Diastase Stain Kit Mucin: Pink/Red Capsule of Cryptococcus: Red The Periodic Acid Schiff (PAS) Diastase Stain Kit is intended for Nuclei: Black/Blue use in histological demonstration of lymphocytes and Other tissue components: Yellow mucopolysaccharides. The α-Amylase digestion step acts on glycogen to break it into smaller sugars that are then washed off Catalog Number Volume the tissue section allowing visual comparison of digested and SMS-2 100 Slides undigested slides. The PAS reaction in tissue sections is useful for SMS-1 1 kit(s) the demonstration of mucopolysaccharides.
Oil Red O Stain Kit (For Fat) PAS Posi ve Material: Magenta Oil Red O Stain Kit (For Fat) is intended for use in the histological Nuclei: Blue visualization of fat cells and neutral fat. This kit may be used Catalog Number Volume ONLY on frozen tissue sections, fresh smears, or touch preps. PAD-2 1 kit(s) Fat Cells: Red PAD-1 1 kit(s) Neutral Fat: Red Nuclei: Blue Catalog Number Volume ORK-2 100 Slides ORK-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
164 Histology
Periodic Acid Schiff (PAS) for Fungus Stain Kit Picro-Sirius Red Stain Kit (For Cardiac Muscle) The Periodic Acid Schiff (PAS) for Fungus Stain Kit is intended for The Picro-Sirius Red Stain Kit (For Cardiac Muscle) is intended for use in histological demonstration of fungal organisms in tissue use in the histological visualization of thin septa and collagen sections. The PAS reaction is also useful in the demonstration of fibers. This modification of the Picro-Sirius Red stain eliminates lymphocytes and mucopolysaccharides. The staining patterns of the yellow cytoplasmic staining that can obscure thin collagenous the lymphocytes are helpful in making therapeutic decisions in septa. Using this procedure easily allows viewing of collagenous established cases of lymphocytic leukemia. septa as thin as 0.2-0.5 microns. The PSR stain may be viewed using standard light microscopy or polarized light resulting in Fungal Organisms: Magenta birefringence of the collagen fibers. PAS Positive Material: Magenta Nuclei: Geen/Blue Light Microscopy Catalog Number Volume Collagen: Red Septa: Red PASF-2 1 kit(s) Cytoplasm: Colorless to Slightly Yellow PASF-1 1 kit(s) Polarized Light Microscopy Periodic Acid Schiff (PAS) Stain Kit Collagen Fibers: Yellow-Orange and Green Birefringence The Periodic Acid Schiff (PAS) Stain Kit is intended for use in Catalog Number Volume histological demonstration of lymphocytes and mucopolysaccharides. The staining pattern of the lymphocytes SRC-1 1 kit(s) are helpful in making therapeutic decisions in established cases Picro-Sirius Red Stain Kit (For Collagen) of lymphocytic leukemia. The PAS reaction in tissue sections is useful for the demonstration of mucopolysaccharides. PAS The Picro-Sirius Red Stain Kit (For Collagen) is intended for use in staining may also be used for the demonstration of fungal the histological visualization of collagen I and III fibers in addition organisms in tissue sections. to muscle in tissue sections. The PSR stain may be viewed using standard light microscopy or polarized light resulting in PAS Positive Material: Magenta birefringence of the collagen fibers. Nuclei: Black/Blue Light Microscopy Catalog Number Volume Collagen: Red PAS-2 30 ml ea. Muscle Fibers: Yellow PAS-1 1 kit(s) Cytoplasm: Yellow PAS-500 500 ml ea. Polarized Light Microscopy Periodic Acid Schiff (PAS) with Light Green Stain Kit Collagen Fibers: Yellow-Orange and Green Birefringence The Periodic Acid Schiff (PAS) Stain Kit is intended for use in Catalog Number Volume histological demonstration of lymphocytes and PSR-2 1 kit(s) mucopolysaccharides. The staining pattern of the lymphocytes PSR-1 1 kit(s) are helpful in making therapeutic decisions in established cases of lymphocytic leukemia. The PAS reaction in tissue sections is Pneumocystis Stain Kit useful for the demonstration of mucopolysaccharides. PAS staining may also be used for the demonstration of fungal The Pneumocystis Stain Kit is intended for use in the histological organisms in tissue sections. visualization of Pneumocystis carinii in cytology smears and paraffin tissue sections. Pneumocystis carinii is an opportunistic PAS Positive Material: Magenta pathogen that causes severe pulmonary disease in humans, Nuclei: Black/Blue dogs, rats, mice and other vertebrate species with acquired, induced, or inherited immune deficiency syndromes. In addition, Catalog Number Volume this procedure will demonstrate Actinomyces and related PASL-2 1 kit(s) species, Nocardia asteroids, and certain encapsulated bacteria. PASL-1 1 kit(s) Pneumocystis carinii: Violet / Purple Connective Tissue: Blue / Green Erythrocytes: Yellow Mucin: Rose / Purple Cartilage: Rose / Purple Catalog Number Volume PCS-2 100 Slides PCS-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
165 Histology
PTAH Stain Kit (Phosphotungstic Acid Hematoxylin) Steiner Stain Kit (For Spirochetes) This kit is designed to demonstrate many collagen, fibrin, muscle The Steiner Stain Kit (For Spirochetes) is designed for striations, cilia and glial fibers without using Zenker's Fixative as a demonstrating Fungi, Helicobacter Pylori, Legionella mordant. pneumophila, and Spirochete infected tissue. Kit may be used on formalin fixed, paraffin-embedded tissue sections. Muscle Striations, Fibrin: Blue to Purple Glial Fibers, Cilia: Blue to Purple Spirochetes: Black to Brown Nuclei: Blue to Purple Helicobactor Pylori: Black to Brown Collagen, Elastic Fibers: Light Orange/Salmon to Brownish/Red Fungi: Black to Brown Catalog Number Volume Legionella pneumophila: Black to Brown Background: Yellow to Tan PTA-2 1 kit(s) PTA-1 1 kit(s) Catalog Number Volume SSK-1 1 kit(s) Quick-Dip Differential Stain Kit Sudan Black B Stain Kit (For Fat) The Quick-Dip Differential Stain Kit provides three reagents for rapid staining of blood smears. Methanol is used to quickly fix The Sudan Black B kit is intended for use in the histological smears, followed by differential staining with buffered xanthene visualization of fat cells and neutral fat. This kit may be used and thiazine dyes. ONLY on frozen tissue sections, fresh smears, or touch preps as xylenes and alcohols will dissolve fat deposits. Expected Results: Catalog Number Volume Neutrophils: Violet nuclei with dark violet granules and pink cytoplasmic granules. SBK-1 1 kit(s) Eosinophils: Violet nuclei with dark violet granules and bright Trichrome Stain Kit (Modified Gomori's) red cytoplasmic granules. Monocytes: Violet nuclei with light blue cytoplasm. The Trichrome Stain Kit (Modified Gomori's) is intended for use Lymphocytes: Violet nuclei with dark violet granules and light in the histological visualization of collagenous connective tissue blue cytoplasm. fibers in tissue sections. The Gomori Trichrome is a more Basophils: Violet nuclei with light blue cytoplasm. simplified procedure than other more traditional trichromes. Erythrocytes: Pink to yellowish-red. Additionally, this procedure is useful in the assessment of the degree of fibrosis in liver biopsies. Catalog Number Volume QDK-1 500 ml ea. Collagen: Blue QDK-GL 1 Gal. Muscle Fibers: Red Nuclei: Black/Blue Reticulum Stain Kit Catalog Number Volume The Reticulum Stain Kit is intended for use in histological TRG-2 100 Slides demonstration of reticular fibers. The main function of reticular fibers is to provide support. They are normally found throughout TRG-1 1 kit(s) the body, particularly in liver, lymph node, spleen and kidney. TRG-500 500 ml ea. Ammoniacal silver stains are the most commonly used methods for demonstration of reticular fibers. Trichrome Stain Kit (Modified Masson's) The Trichrome Stain Kit (Modified Masson's) is intended for use Re culum: Black in histology laboratories for the staining and subsequent Nuclei: Green visualization of collagenous connective tissue fibers in tissue Catalog Number Volume sections. This Trichrome Special Stain kit may be used on formalin-fixed, paraffin-embedded sections. GRT-2 1 kit(s) GRT-1 1 kit(s) Collagen: Blue Muscle Fibers: Red Reticulum Stain Kit (Modified Gomori's) Nuclei: Black/Blue The Reticulum Stain Kit (Modified Gomori's) is intended for use in Catalog Number Volume histological demonstration of reticular fibers. The main function of reticular fibers is to provide support. They are normally found TRM-2 30 ml ea. throughout the body, particularly in liver, lymph node, spleen TRM-1 125 ml ea. and kidney. Ammoniacal silver stains are the most commonly TRM-500 500 ml ea. used methods for demonstration of reticular fibers. Twort's Counterstain Kit Reticulum: Gray/Black The Twort's Counterstain Kit is intended for use in histology Nuclei: Pink/Red procedures such as the Gram Stain to provide contrast for easier Catalog Number Volume visualization of various cell components in tissue sections.
GRS-2 100 Slides Nuclei: Red GRS-1 1 kit(s) Cytoplasm: Light Green Catalog Number Volume TCK-1 1 kit(s) ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
166 Histology
Twort's Gram Stain Kit Acetic Acid Solution (0.5%) The Twort's Gram Stain Kit is designed for positive and negative Acetic Acid 0.5% in DI/Distilled water. gram bacteria differentiation in formalin fixed paraffin Catalog Number Volume embedded tissues. Gram negative bacteria stain pink to red, gram positive stain blue, and the background is stained light AAD125 125 ml green. AAD250 250 ml AAD500 500 ml Gram Posi ve Bacteria: Blue AAD999 1000 ml Nuclei and Gram Nega ve Bacteria:Red Background:Light Green Acetic Acid Solution (1%) Catalog Number Volume Acetic Acid 1.0% in deionized and distilled water. TGS-1 1 kit(s) Catalog Number Volume AAE125 125 ml Warthin-Starry Stain Kit AAE500 500 ml The Warthin-Starry Stain Kit is intended for use in the AAE999 1000 ml visualization of Spirochetes, Helicobacter pylori, Legionella pneumophila, and Cat Scratch Fever bacteria. This kit may be Acetic Acid Solution (12%) used on formalin-fixed, paraffin-embedded sections. Acetic Acid 12% in deionized/distilled water. Helicobacter pylori: Black Catalog Number Volume Legionella pneumophila: Black AAK500 500 ml Spirochetes: Black AAK999 1000 ml Cat Scratch Fever Bacteria: Black Klebsiella: Brown/Black Acetic Acid Solution (3%) Nuclei: Brown Acetic Acid Solution (3%) in deionized and distilled water. Background: Yellow Catalog Number Volume Catalog Number Volume AAG500 500 ml WSS-1 1 kit(s) AAG999 1000 ml Wright-Giemsa Stain Kit AAG3800 1 Gal. Wright-Giemsa Stain Kit is intended to be used for differential Acetic Alcohol Solution (2%) staining of blood smears, bone marrow and blood parasites. Acetic Acid 2% in ACS reagent grade ethyl alcohol. Erythrocytes: Pink-Tan Catalog Number Volume Leukocytes: Blue-Purple AAF250 250 ml Neutrophils: Light Purple granules in cytoplasm. AAF500 500 ml Eosinophils: Bright Red-Red-Orange granules in cytoplasm. AAF999 1000 ml Basophils: Deep Purple granules in cytoplasm. Platelets: Violet-Purple granules in light blue cytoplasm. Acid Alcohol Solution (0.5%) Catalog Number Volume Catalog Number Volume WGK-2 1 kit(s) AAL500 500 ml WGK-1 1 kit(s) AAL999 1000 ml Special Stain Individual Acid Alcohol Solution (1%) Reagents Used in Fite's Stain Kit (Catalog# FLS-1) Catalog Number Volume AAM500 500 ml AAM999 1000 ml Acetate Buffer Solution, pH 8.0 Used in the Microwave Copper Stain. Alcian Blue Solution, pH 1.0 Catalog Number Volume Alcian Blue Solution, pH 1.0 is intended for use in the histological SAB500 500 ml visualization of strongly sulfated mucosubstances. SAB999 1000 ml Strongly Sulfated Mucosubstances: Blue Catalog Number Volume ANA250 250 ml ANA500 500 ml ANA999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
167 Histology
Alcian Blue Solution, pH 2.5 Borax Solution Application: For demonstration of the acid muco polysaccharides. Component of GMS Stain Kit (catalog # KAA-1) Catalog Number Volume Results: Acid mucins are colored blue. BOR015 15 ml Control: Intestine BOR125 125 ml BOR500 500 ml Catalog Number Volume BOR999 1000 ml ANC030 30 ml ANC250 250 ml Bouin's Fluid ANC500 500 ml Bouin's Fluid is a fixative useful for several routine procedures. It ANC999 1000 ml contains formaldehyde and picric acid for both cytoplasmic and ANC3800 1 Gal. chromatin fixation and facilitates excellent H&E staining. Is has also been recommended for any general fixation procedures and Alcian Yellow Solution may be used as a substitute for Zenker's Fluid. It is also used as a Used in Alcian Yellow for H. Pylori. post-fixation step that is critical for the bright coloration demonstrated with Trichrome special stain procedures. Catalog Number Volume Catalog Number Volume ANY125 125 ml ANY500 500 ml BNF125 125 ml ANY999 1000 ml BNF500 500 ml ANY3800 1 Gal. BNF999 1000 ml BNF3800 1 Gal. Alcohol, Reagent (70%) Brilliant Cresyl Blue (0.3%, Alcoholic) Catalog Number Volume Brilliant Cresyl Blue (0.3%, alcoholic) is a supravital hematology EAS500 500 ml stain for counting reticulocytes in peripheral blood smears. The EAS999 1000 ml number of reticulocytes in the blood is a simple measure of Alpha Amylase Solution (1%) erythropoietic performance. Reticulocytes are immature erythrocytes that contain nuclear remnants of basophilic Component used in the Periodic Acid Schiff (PAS) Diastase Stain ribonucleoproteins which decreases as the reticulocyte matures. Kit (Cat# PAD-1). When stained, reticulocytes appear to contain dark blue granules Catalog Number Volume or filaments.
AAS250 250 ml Reticulocytes: Blue/Green with Dark Blue Granules. AAS500 500 ml Erythrocytes: Blue/Green AAS999 1000 ml Leukocytes: Light Blue Aniline Blue Solution Catalog Number Volume BCA500 500 ml Stains connective tissue and basement membranes. Used in Masson's Trichrome staining procedure (Cat# TRM-1). BCA999 1000 ml BCA3800 1 Gal. Catalog Number Volume ABP125 125 ml Brilliant Cresyl Blue (1.5% in 0.85% Saline) ABP500 500 ml Brilliant Cresyl Blue (1.5% in 0.85% Saline) is a supravital ABP999 1000 ml hematology stain for counting reticulocytes in peripheral blood smears. The number of reticulocytes in the blood is a simple Astra Blue Solution measure of erythropoietic performance. Reticulocytes are Astra Blue Solution is designed to stain mast cells bright blue. immature erythrocytes that contain nuclear remnants of basophilic ribonucleoproteins which decreases as the reticulocyte Catalog Number Volume matures. When stained, reticulocytes appear to contain dark AST125 125 ml blue granules or filaments. AST500 500 ml Reticulocytes: Blue/Green with Dark Blue Granules. Biebrich Scarlet/Acid Fuchsin Solution Erythrocytes: Blue/Green Used in Masson's Trichrome. Leukocytes: Light Blue Catalog Number Volume Catalog Number Volume BSU125 125 ml BCS500 500 ml BSU500 500 ml BCS999 1000 ml BSU999 1000 ml BCS3800 1 Gal.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
168 Histology
Carbol Fuchsin (Kinyoun's) Cresyl Echt Violet (1.0%, Aqueous) The Carbol Fuchsin Solution (Kinyoun's) is intended for use in the Cresyl Vilet Acetat (1.0%, aqueous) is designed for staining Nissil histological visualization of Acid Fast Bacteria and Tubercle substance in neurons on farmalin fixed, paraffin-embedded Bacilli. This reagent is a rapid 2-5 minute procedure. The lipoid tissue. Nissl granules are purple, nuclei of neuroglia and capsule of the acid-fast organism takes up carbol fuchsin and endothelial cells are slighly bluer than Nissl granules. resists decolorization. Nissil Substance: Violet Acid Fast Organisms: Bright Red Neurolgia Nuclei: Violet to Dark Blue Catalog Number Volume Catalog Number Volume CFK500 500 ml CEB500 500 ml CFK999 1000 ml CEB999 1000 ml Carbol Fuchsin Counterstain Cresyl Echt Violet Solution (0.1%) Carbol Fuchsin Counterstain is a component of the Gram Stain Cresyl Echt Violet Solution (0.1%) is designed for staining Nissil Kit, catalog # GSK-1. substance in neurons on formalin fixed, paraffin-embedded Catalog Number Volume tissue. Nissl granules are purple, nuclei of neuroglia and endothelial cells are slightly bluer than Nissl granules. CFX125 125 ml CFX500 500 ml Catalog Number Volume CFX999 1000 ml CEA125 125 ml CEA500 500 ml Carbol Fuchsin Solution CEA999 1000 ml A modified Ziehl-Neelson formulation used for staining acid fast bacteria. This stain is a rapid 15-minute procedure. The lipoid Crystal Violet Solution capsule of the acid-fast organism takes up carbol fuchsin and Stains Nissel granules and basophilia. resists decolorization. Catalog Number Volume Acid Fast Organisms: Bright Red CVA500 500 ml CVA999 1000 ml Catalog Number Volume CFZ125 125 ml Differentiating Solution (For Orcein Stain) CFZ500 500 ml Catalog Number Volume CFZ999 1000 ml DSA125 125 ml Carbol Gentian Violet DSA500 500 ml Stains acid fast bacteria. EA-50 Stain Solution Catalog Number Volume EA-50 is a cytologic stain routinely used in diagnostic cytology to CGV500 500 ml aid in the identification and classification of exfoliative cells. The CGV999 1000 ml stain is used for examining exfoliative cells of vaginal, cervical, sputum, as well as other body secretions. Commonly used in Chromic Acid Solution combination with hematoxylin. Component of GMS Stain Kit (catalog # KAA-1) Results: Catalog Number Volume CHR125 125 ml Nuclei: Blue CHR500 500 ml Cytoplasm: Various shades of Pink or Green. CHR999 1000 ml Catalog Number Volume Colloidal Iron Stock Solution EAC500 500 ml EAC999 1000 ml Used in the Colloidal Iron staining procedure. EAC3800 1 Gal. Catalog Number Volume CIS125 125 ml CIS500 500 ml CIS999 1000 ml Congo Red Solution Amyloid stain. Catalog Number Volume CRA500 500 ml CRA999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
169 Histology
EA-65 Stain Solution Ferric Chloride (2%) Differentiating Solution EA-65 is a cytologic stain routinely used in diagnostic cytology to Catalog Number Volume aid in the identification and classification of exfoliative cells. EA- FCB125 125 ml 65 is recommended for specimens with large amounts of mucus. FCB500 500 ml The stain is used for examining exfoliative cells of vaginal, cervical, sputum, as well as other body secretions. Commonly FCB999 1000 ml used in combination with hematoxylin. Formalin Solution (20%) Results: Used in the Reticulum Stain Kit (Cat# GRS-1). Catalog Number Volume Nuclei: Blue Cytoplasm: Various shades of Pink or Green. FRL125 125 ml FRL500 500 ml Catalog Number Volume FRL999 1000 ml EAD500 500 ml EAD999 1000 ml Gelatin (4%), Acidulated EAD3800 1 Gal. Component of the Warthin-Starry Stain Kit. Eosin Y Solution (Modified Alcoholic) Catalog Number Volume Eosin Y Solution (Modified Alcoholic) is intended for use in GSA125 125 ml histology and cytology applications. This newly formulated Eosin Gentian Violet Solution provides the benefits of a traditional alcoholic formula with significant improvements in usability. Advantages include lower Gentian Violet Solution is the component of the Gram Stain Kit evaporation rate, better color patterns, reduced tendency to spill (catalog# GSK-1) that results in blue staining of the Gram Positive over container, hands, and countertops, and improved surface Bacteria. Gentian Violet is intended for the demonstration and tension to remain on tissue section. differentiation of Gram-positive and Gram-negative bacteria. Catalog Number Volume Cytoplasm: Light Pink Collagen: Pink GVS125 125 ml Muscle: Pink/Rose GVS500 500 ml Erythrocytes: Pink/Red GVS999 1000 ml Catalog Number Volume Giemsa Stock Solution EYB500 500 ml Component of the Giemsa Stain Kit (May Grunwald) for blood EYB999 1000 ml smears. EYB3800 1 Gal. Catalog Number Volume Fast Green Solution GGS125 125 ml Stains collagen and reticular fibers. Manufactured using certified GGS500 500 ml Fast Green FCF and is provided as a single component, Ready-To- GGS999 1000 ml Use reagent. Gold Chloride Solution (0.1%) Catalog Number Volume Used in Gomori's Reticular stain and Gordon & Sweet's Reticular FGN125 125 ml stain. FGN500 500 ml FGN999 1000 ml Catalog Number Volume GCS125 125 ml Ferric Ammonium Sulfate Solution (2%) GCS500 500 ml Catalog Number Volume GCS999 1000 ml FAS125 125 ml Gold Chloride Solution (0.2%) FAS500 500 ml Used in a variety of staining procedures. FAS999 1000 ml Catalog Number Volume Ferric Ammonium Sulfate Solution (3%) GCB125 125 ml Catalog Number Volume GCB500 500 ml GCB999 1000 ml FAT125 125 ml Ferric Chloride (10%, Aqueous) Gram's Decolorizer Solution Component used in the Gram Stain Kit. Catalog Number Volume Catalog Number Volume FCC125 125 ml FCC500 500 ml GDS125 125 ml FCC999 1000 ml GDS500 500 ml GDS999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
170 Histology
Gum Mastic Solution (2.5%) Herovici's Stain Solution B Catalog Number Volume Part B of Herovici's stain. Mix equal parts with part A for working Herovici's solution. Differentiates between young (blue) and GUM125 125 ml mature collegen (red). Also stains erythrocytes yellow. GUM500 500 ml Catalog Number Volume H. Pylori Rapid Stain (1-Step) HVB125 125 ml The H. Pylori Rapid Stain (1-Step) is a single component reagent HVB500 500 ml that has been developed to identify helicobacter pylori in a HVB999 1000 ml procedure that requires less than 10 minutes to complete. Procedure is effective for fresh, frozen, and paraffin embedded Hydrochloric Acid (1N) sections. Helicobacter Pylori has been shown to be the causative Hydrochloric Acid (1N) manufactured using deionized/distilled organism in some gastric ulcers. water.
H. Pylori: Dark Blue/Purple Catalog Number Volume Cytoplasm: Pink to Red HQA125 125 ml Background: Violet HQA500 500 ml Nuclei: Blue HQA999 1000 ml Catalog Number Volume Hydrochloric Acid Solution (2%) HPS030 30 ml HPS500 500 ml Hydrochloric Acid (2%) manufactured using deionized/distilled HPS999 1000 ml water. A component of the Iron Stain Kit (cat# IRN-1) Catalog Number Volume Hematoxylin Solution (5%) HQB500 500 ml Catalog Number Volume HQB999 1000 ml HSV250 250 ml HQB3800 1 Gal. HSV500 500 ml Hydroquinone (1.5gm) HSV999 1000 ml Used in a variety of stain procedures. Hematoxylin, Weigert's Iron (Part A) Catalog Number Volume Component of Hematoxylin, Weigert's Iron Kit. HFS001.5 1.5 gm Catalog Number Volume Hydroquinone Solution (0.1%), Acidulated HWI-A-125 125 ml HWI-A-250 250 ml Component of the Warthin-Starry Stain Kit. Catalog Number Volume Hematoxylin, Weigert's Iron (Part B) HSA030 30 ml Component of Hematoxylin, Weigert's Iron Kit. Catalog Number Volume Jenner Stock Solution HWI-B-125 125 ml For Research Use Only. HWI-B-250 250 ml Jenner Stock Solution is intended to be used for differential Hematoxylin, Weigert's Iron Kit staining of blood smears, bone marrow and blood parasites. This reagent is used in combination with Phosphate Buffer Solution Weigert's Iron Hematoxylin is intended to be used with various pH 6.8 (cat# PBM) to make a working solution. special stain kits. Product is supplied as a two component (equal volumes of parts A and B) system that is mixed prior to use and Blood Smear Expected Results results in black/blue nuclei. Neutrophils: Violet nuclei with dark violet granules and pink Catalog Number Volume cytoplasmic granules HWI-1 250 ml Eosinophils: Violet nuclei with dark violet granules and bright red cytoplasmic granules. HWI-2 1000 ml Monocytes: Violet nuclei with light blue cytoplasm. HWI-3 2000 ml Lymphocytes: Violet nuclei with dark violet granules and light Herovici's Stain Solution A blue cytoplasm. Basophils: Violet nuclei with light blue cytoplasm. Part A of Herovici's stain. Mix equal parts with part B for working Erythrocytes: Pink to yellowish-red. Herovici's solution. Differentiates between young (blue) and Catalog Number Volume mature collegen (red). Also stains erythrocytes yellow. JSS500 500 ml Catalog Number Volume JSS999 1000 ml HVA125 125 lbs HVA500 125 ml HVA999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
171 Histology
Light Green S.F. Yellowish Solution May-Grunwald Stock Solution Light Green S.F. Yellowish Solution is intended for use in Component of the Giemsa Stain Kit (May-Grunwald) for blood histological applications as a general counterstain. When used smears. correctly, various shades of green can be obtained to aid in Catalog Number Volume visualization of tissue components. MAY125 125 ml Cytoplasm: Light Green MAY500 500 ml Nuclei: Light Green/Blue MAY999 1000 ml Catalog Number Volume Metanil Yellow (Aqueous Solution) LGB500 500 ml Cytoplasmic counterstain. LGB999 1000 ml Catalog Number Volume Light Green Solution MYQ500 500 ml Light Green Solution is intended for use in histological MYQ999 1000 ml applications as a general counterstain. When used correctly, MYQ-10000 10 L various shades of green can be obtained to aid in visualization of tissue components. Methenamine Solution Catalog Number Volume Component of GMS Stain Kit (catalog # KAA-1). Used in a variety of Special Stain procedures. LGA030 30 ml LGA125 125 ml Catalog Number Volume LGA500 500 ml MET125 125 ml LGA999 1000 ml MET500 500 ml LGA3800 1 Gal. MET999 1000 ml Light Green Solution (0.1%) Methylene Blue Solution Light Green Solution (0.1%) is intended for use in histological Methylene Blue Solution has been optimized in our research applications as a counterstain for Grocott's Silver Stain in laboratories to give outstanding results when used in various addition to other procedures. When used correctly, various procedures such as the Ziehl-Neelsen, Fite's, and Gram stain. shades of green can be obtained to aid in visualization of tissue The stain is also suggested for use in staining a variety of bacteria components. (Corynebacterium diphtheria, Haemophilus influenzae, Neisseria, etc.) and leukocytes. This reagent produces dark blue nuclei with Cytoplasm: Light Green very light blue cytoplasm. Nuclei: Light Green/Blue Catalog Number Volume Nuclei: Dark Blue Cytoplasm: Light Blue LGD125 125 ml Corynebacterium Diphtheria: Blue Granules LGD500 500 ml Escherichia Coli: Blue Rods LGD999 1000 ml Streptococcus Pyogenes: Blue Cocci Lithium Carbonate Solution (0.05%) Catalog Number Volume MBS125 125 ml Catalog Number Volume MBS500 500 ml LCQ500 500 ml MBS999 1000 ml LCQ999 1000 ml Mucicarmine Solution (Southgate's) Lugol's Iodine Solution Mucicarmine Solution (Southgate's) is a component of the Catalog Number Volume Mucicarmine Stain Kit (Catalog# SMS-1) and is intended for use LIS125 125 ml in the histological visualization of acid mucopolysacharides in LIS500 500 ml tissue sections. Mucicarmine Solution is the component responsible for staining Mucin red. This product is useful in LIS999 1000 ml distinguishing mucin negative undifferentiated squamous cell Luxol Fast Blue Solution lesions from mucin positive adenocarcinomas. In addition, this product will stain the mucopolysaccharide capsule of Stains myelinated nerve fibers. Catalog Number Volume Catalog Number Volume SMG125 125 ml LFB125 125 ml SMG500 500 ml LFB500 500 ml SMG999 1000 ml LFB999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
172 Histology
Naphthol Yellow S Solution Orcein Solution Naphthol Yellow S Solution is a component of the Pneumocystis Orcein Solution may be used in histology procedures for the Stain Kit (Catalog# PCS-1) which is intended for use in the visualization of Hepatitis B surface Antigen (HBsAg), elastic fibers, histological visualization of Pneumocystis carinii in cytology and copper associated proteins. HBsAg appears as irregular smears, and paraffin or frozen tissue sections. Naphthol Yellow S shaped aggregates in the cytoplasmic region of the cells. This Solution is the component responsible for staining the reagent may be used on formalin-fixed, paraffin-embedded or Erythrocytes yellow. frozen sections. Catalog Number Volume HBsAg: Dark Brown/Purple NYS125 125 ml Elastic Fibers: Dark Brown/Purple NYS500 500 ml Copper Assoc. Proteins: Dark Purple NYS999 1000 ml Background: Light Reddish/Purple Nuclear Fast Red Solution (Enhanced Stability) Catalog Number Volume OAA125 125 ml Nuclear Fast Red is a stain with histological applications. The reagent has improved stability over current formulations OAA500 500 ml allowing storage at temperatures ranging from 2-30 Centigrade. OAA999 1000 ml Current formulations tend to precipitate in cold temperatures such as experienced during winter shipping. In addition, most Oxalic Acid Solution (2.0%) formulations develop a small amount of precipitate over Catalog Number Volume extended periods of time. This advanced formulation eliminates OQB125 125 ml problems associated with exposure to cold and aging. OQB500 500 ml Nuclei: Red OQB999 1000 ml Cytoplasm: Pale Pink Oxidizer Solution (For Steiner's Silver Stain) Catalog Number Volume Component used in Steiner's Silver Stain. NFS125 125 ml Catalog Number Volume NFS500 500 ml NFS999 1000 ml SOS125 125 ml NFS3800 1 Gal. SOS500 500 ml OG-6 Solution Periodic Acid Solution (0.5%) OG-6 is a cytologic stain routinely used in diagnostic cytology to Catalog Number Volume aid in the identification and classification of exfoliative cells. The PAA500 500 ml stain is used for examining exfoliative cells of vaginal, cervical, PAA999 1000 ml sputum, as well as other body secretions. Commonly used in combination with hematoxylin. Periodic Acid Solution (1%) Catalog Number Volume Periodic Acid Solution is a component of the Periodic Acid Schiff's OGA500 500 ml procedure that is intended for use in histological demonstration OGA999 1000 ml of lymphocytes and mucopolysaccharides. The staining pattern OGA3800 1 Gal. of the lymphocytes are helpful in making therapeutic decisions in established cases of lymphocytic leukemia. The PAS reaction in Oil Red O Solution tissue sections is useful for the demonstration of mucopolysaccharides. PAS staining may also be used for the Oil Red O Solution is a component of the Oil Red O Stain Kit (For demonstration of fungal organisms in tissue sections. Fat) (Catalog# ORK-1) intended for use in the histological visualization of fat cells and neutral fat. This kit may be used PAS Positive Material: Magenta ONLY on frozen tissue sections, fresh smears, or touch preps. Nuclei: Black/Blue (Hematoxylin) Catalog Number Volume Catalog Number Volume ORG125 125 ml PAQ250 250 ml ORG500 500 ml PAQ500 500 ml ORG999 1000 ml PAQ999 1000 ml PAQ3800 1 Gal. Phosphate Buffer Solution, pH 6.8 Ready-to-Use solution used in the Giemsa Stain Kit. Catalog Number Volume PBM500 500 ml PBM999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
173 Histology
Phosphomolybdic Acid Solution (0.2%) Potassium Hydroxide Solution (10%) Component of the Picro-Sirius Red Stain Kit (For Cardiac Muscle). Used in Reticulum Stain Kit (Cat# GRS-1). Catalog Number Volume Catalog Number Volume PQA250 250 ml PHC500 500 ml PQA500 500 ml PHC999 1000 ml PQA999 1000 ml Potassium Hydroxide Solution (3M) Phosphomolybdic/Phosphotungstic Acid Solution Catalog Number Volume Used in Masson's Trichrome stain. PHA500 500 ml Catalog Number Volume PHA999 1000 ml PPA125 125 ml PPA500 500 ml Potassium Metabisulfite Solution (3%) PPA999 1000 ml Used in Reticulum Stain Kit (Cat# GRS-1) Catalog Number Volume Phosphotungstic Acid Hematoxylin Solution PMS125 125 ml This reagent is used in the P.T.A.H. Stain Kit for Microwave to PMS500 500 ml demonstrate collagen, fibrin, muscle striations, cilia and glial PMS999 1000 ml fibers. Catalog Number Volume Potassium Permanganate Solution (0.5%) HPA125 125 ml Used in the Reticulum Stain Kit (Cat# GRS-1) HPA500 500 ml Catalog Number Volume HPA999 1000 ml PPD250 250 ml Phosphotungstic Acid Solution (5.0%) PPD500 500 ml PPD999 1000 ml Catalog Number Volume PGC250 250 ml Potassium Permanganate Solution (1.0%) PGC500 500 ml Catalog Number Volume PGC999 1000 ml PPE125 125 ml Picric Acid - Acetone Solution (0.1%) PPE500 500 ml PPE999 1000 ml Component used in the Gram Stain Kit (Modified Brown & Brenn). Catalog Number Volume Potassium Permanganate Solution (5%) PAB125 125 ml Catalog Number Volume PAB500 500 ml PPG030 30 ml PAB999 1000 ml PPG125 125 ml Picro-Sirius Red Solution Propylene Glycol Catalog Number Volume Catalog Number Volume SRS250 250 ml PRG500 500 ml SRS500 500 ml PRG999 1000 ml SRS999 1000 ml PRG3800 1 Gal. Potassium Ferrocyanide Solution (3%) Rhodanine Solution (Stock) Used in the Colloidal Iron staining procedure. Used in the Microwave Copper Stain (Catalog# CSK-1). Catalog Number Volume Catalog Number Volume PFD125 125 ml RSS030 30 ml PFD500 500 ml RSS125 125 ml PFD999 1000 ml Potassium Ferrocyanide Solution (5%) Used in Iron Stain Kit. Catalog Number Volume PFB500 500 ml PFB999 1000 ml PFB3800 1 Gal.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
174 Histology
Safranin O Solution (For Gram Staining) Silver Nitrate Solution (10%) Safranin O Solution (For Gram Staining) has been specially Used in various staining procedures. formulated to help visualize gram negative bacteria when using Catalog Number Volume ScyTek's Brown & Brenn Gram stain kit. (BBS-1, BBS-2). Gram negative bacteria stain pink to red. SNX009 9 ml SNX065 65 ml Catalog Number Volume SNX125 125 ml SOG125 125 ml SNX500 500 ml SOG250 250 ml SOG500 500 ml Silver Nitrate Solution (2%), Acidulated SOG999 1000 ml Component of Warthin-Starry Stain Kit. Safranin O Solution (For Staining Nuclei) Catalog Number Volume Safranin O has several uses in histology and cytology but is SNA030 30 ml commonly known for counterstaining nuclei red. This formula contains acetic acid providing a lower pH that reduces non- Silver Nitrate Solution (5%) nucleic background and cytoplasmic staining. This solution is not Reagent used in various staining procedures. suitable for bacterial (gram) or cartilage staining. Catalog Number Volume
Nuclei: Red SNV125 125 ml Background: Light Red to Pink SNV500 500 ml Catalog Number Volume Sodium Bisulfite Solution SOH250 250 ml Component of GMS Stain Kit (catalog # KAA-1) SOH500 500 ml SOH999 1000 ml Catalog Number Volume SBC125 125 ml Schiff's Solution SBC500 500 ml Schiff's Solution is a component of the Periodic Acid Schiff's SBC999 1000 ml procedure that is intended for use in histological demonstration of lymphocytes and mucopolysaccharides. The staining pattern Sodium Hydroxide Solution (3.0%) of the lymphocytes are helpful in making therapeutic decisions in Catalog Number Volume established cases of lymphocytic leukemia. The PAS reaction in SHC125 125 ml tissue sections is useful for the demonstration of mucopolysaccharides. PAS staining may also be used for the SHC500 500 ml demonstration of fungal organisms in tissue sections. SHC999 1000 ml SHC3800 1 Gal. PAS Positive Material: Magenta Nuclei: Black/Blue (Hematoxylin) Sodium Metabisulfite Solution (5%) Catalog Number Volume Sodium Metabisulfite Solution (5%) is a component used in the H. Pylori Rapid Stain Kit (Cat# AYH-1). SRF250 250 ml SRF500 500 ml Catalog Number Volume SRF999 1000 ml SME125 125 ml SRF3800 1 Gal. SME500 500 ml SME999 1000 ml Silver Nitrate Solution (0.2%) SME3800 1 Gal. Component of the various special stain procedures. Sodium Thiosulfate Solution (5%) Catalog Number Volume SNS125 125 ml Catalog Number Volume SNS500 500 ml STB125 125 ml SNS999 1000 ml STB500 500 ml STB999 1000 ml Silver Nitrate Solution (0.5%), Acidulated SpiroPrep Component of Warthin-Starry Stain Kit. Component of the Warthin-Starry Stain Kit. Catalog Number Volume SNB125 125 ml Catalog Number Volume SSE125 125 ml Silver Nitrate Solution (1%) SSE500 500 ml Component of Steiner's Silver Stain Kit (cat# SSK-1) SSE999 1000 ml Catalog Number Volume SNY125 125 ml SNY500 500 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
175 Histology
Sudan Black B Solution (in Propylene Glycol) Twort's Counterstain Kit Sudan Black B (in Propylene Glycol) is intended for use in the The Twort's Counterstain Kit is intended for use in histology histological visualization of fat cells and neutral fat. The product procedures such as the Gram Stain to provide contrast for easier is intended for use on frozen tissue sections, fresh smears, or visualization of various cell components in tissue sections. touch preps. Catalog Number Volume Nuclei: Red Cytoplasm: Light Green SBG125 125 ml SBG500 500 ml Catalog Number Volume SBG999 1000 ml TCK-1 1 kit(s) Sulfuric Acid Solution (1N) Van Gieson's Solution Sulfuric Acid Solution (1N) manufactured using The Van Gieson's Solution is intended for use in the histological deionized/distilled water. visualization of collagen in tissue sections. This reagent is used in Used in the Reticulum Stain Kit (Cat# GRS-1) many special stain procedures including the Colloidal Iron Stain Kit and the Elastic Stain Kit (Modified Verhoff's). Catalog Number Volume SAQ125 125 ml Collagen: Red SAQ500 500 ml Muscle Fibers: Yellow SAQ999 1000 ml Cytoplasm: Yellow Tartrazine Solution Catalog Number Volume VGS125 125 ml Tartrazine Solution is intended for use as a general counterstain VGS500 500 ml in a variety of procedures such as Mucicarmine and Gram stain. VGS999 1000 ml Tartrazine provides a light yellow background to aid in the visualization of other stains. Wright-Giemsa Solution Catalog Number Volume The Wright-Giemsa Solution is intended for differential staining TZQ125 125 ml of blood smears and blood parasites. Use in conjuction with TZQ500 500 ml Phosphate Buffer Solution pH 6.8 (cat.# PBM) TZQ999 1000 ml Catalog Number Volume Toluidine Blue Solution (1%, Aqueous) WGS500 500 ml WGS999 1000 ml Toluidine Blue Solution is designed for metachromatic staining of WGS3800 1 Gal. acidic substances. Catalog Number Volume Xylene - Peanut Oil Solution TQF125 125 ml Used in Fite's Acid-Fast stain for leprosy organisms. TQF500 500 ml Catalog Number Volume TQF999 1000 ml TQF3800 1 Gal. XPO125 125 ml XPO500 500 ml Trichrome Stain (Blue) XPO999 1000 ml Trichrome Stain (Blue) is a stain with histological applications Zinc Chloride Solution (10%) resulting in muscle fibers staining red, and collagen a bright blue. Component of the P.T.A.H. Stain Kit for Microwave (Cat# PTA-1). Catalog Number Volume Catalog Number Volume TGB125 125 ml TGB500 500 ml ZCS500 500 ml TGB999 1000 ml ZCS999 1000 ml Trichrome Stain Solution (Green) Zinc Formalin Solution The Trichrome Stain Solution (Green) is a component of the Zinc Formalin is a tissue fixative for routine procedures. Trichrome Stain Kit (Modified Gomori's) and is intended for use Catalog Number Volume in the histological visualization of collagenous connective tissue ZFN500 500 ml fibers in tissue sections. ZFN999 1000 ml Collagen: Green Muscle Fibers: Red Nuclei: Black/Blue (Hematoxylin) Catalog Number Volume TGG125 125 ml TGG500 500 ml TGG999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
176 Histology Special Stain Control Slides Melanin Control Slides Melanin Control Slides - Human Skin, Melanin Catalog Number Volume Acid Fast Bacteria Control Slides HCS1014-25 25 Slides Acid Fasct Bacteria Control Slides - Mouse Lung, Mycobacterium Mucin Control Slides Gordonae Mucin Control Slides - Human Intestine, Goblet Cells Catalog Number Volume Catalog Number Volume HCS1001-25 25 Slides HCS1015-25 25 Slides Alcian Blue Control Slides PAS Control Slides Alcian Blue Control Slides - Human Umbilical Cord, Acid Mucopolysacaries PAS Control Slides - Human Liver, Glycogen Catalog Number Volume Catalog Number Volume HCS1002-25 25 Slides HCS1016-25 25 Slides Amoeba Control Slides PAS w/Digestion Control Slides Amoeba Control Slides - Human Intestine PAS with Digestion Control Slides - Human Liver, Absence of Glycogen Catalog Number Volume Catalog Number Volume HCS1003-25 25 Slides HCS1017-25 25 Slides Amyloid Control Slides PTAH Control Slides Amyloid Control Slides - Human Heart, Amyloid Deposits PTAH Control Slides - Human Muscle, Straited Muscles Catalog Number Volume Catalog Number Volume HCS1004-25 25 Slides HCS1018-25 25 Slides Argyrophil Control Slides Reticulum Control Slides Argyrophil Control Slides - Human Tumor, Argyrophil Reticulum Control Slides - Human Liver, Reticulum Fibers Catalog Number Volume Catalog Number Volume HCS1006-25 25 Slides HCS1019-25 25 Slides Elastic Control Slides Spirochete Control Slides Elastic Control Slides - Human Skins, Elastic Fibers Spirochete Control Slides - Rabbit Testis, Treponema Palidrum Catalog Number Volume Catalog Number Volume HCS1008-25 25 Slides HCS1020-25 25 Slides Fites Control Slides Trichrome Control Slides Fites Control Slides - Mouse Lung, Nocardia Trichrome Control Slides - Normal Liver, Connective Tissue Catalog Number Volume Catalog Number Volume HCS1009-25 25 Slides HCS1021-25 25 Slides Gram Control Slides Gram Control Slides - Mouse Lung, Staphylococcus Aureus/E. Coli Catalog Number Volume HCS1011-25 25 Slides Helicobacter Control Slides Helicobacter Control Slides - Mouse Intestine, Helicobactor Pylori Catalog Number Volume HCS1012-25 25 Slides Iron Control Slides Iron Control Slides - Human Liver, Iron Granules Catalog Number Volume HCS1013-25 25 Slides
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
177 Histology
Slide Master Slide Master (Hist.) (An Innovative Immunohistochemistry Humidity Chamber)
ScyTek Laboratories, Inc. proudly introduces SlideMaster. A humidity chamber designed by a histotechnologist that EasyDip Slide Staining System eliminates the majority of individual slide handling. SlideMaster has three different parts: A humidity chamber, two Finally a user-friendly approach for staining your microscope individual slide holders with white contrast bars, and a waste slides, the EasyDip Slide Staining System has two components: a receptacle. It has been designed so that all three components square staining jar and a 12 - position vertical slide rack. Jars can are compact and easy to use. A maximum of 20 slides can be be loosely joined to each other laterally, therefore making sure used per unit. they are kept in the same order when moved around on the lab This is how it works. A hydrophobic barrier (PAP Pen, Catalog counter. As an extra benefit, they are available in 5 different #LP0001) is drawn around the tissue section and slides are put in colors to help better identifying contents or applications. a special slide holder that secures them into place. Drops of antibody are placed on the slides and incubated. After The staining jar being made of resistant acetal plastic will not incubation, the individual slide holders can be tilted and secured break like most glass jars do. It will resist most staining agents at a 45 degree angle. All 20 slides are rinsed off in one easy including alcohol and xylene (but not phenol, iodine or ferric motion and the buffer (PBS-Tween 20, Catalog # ABA125 or TBS- chloride ). The wide stable base offers greater stability while the Tween 20, Catalog # TBS125) drains into the waste receptacle. inside is recessed, allowing for a smaller reagent volume of only Slides are gently blotted (tissue paper) at the bottom portion of 80 ml. Easy to clean and no metals to corrode. Ideal for special the hydrophobic barrier, which draws off any remaining liquid on stains, frozen sections and special processes. Will resist the tissue. The slide holders are then placed back in the temperatures between -170 C and +121 C. Autoclavable. horizontal position and incubation and rinse steps are repeated Dimensions: 64 x 76 x 92 mm H (2 1/2 x 3 x 3 5/8 in. H). in the same fashion.
Each case indudes 5 jars (one of each color) and 1 rack M905- For chromogen development, the SlideMaster unit has a contrast 12DGY. bar that changes the background from black to white. The black Catalog Number Volume background produces high contrast so that the tissues mounted glass slides can be easily seen, and the white background M900-12G-GREEN 1 Case(s) produces high contrast and allows the technician to monitor the M900-12B-BLUE 1 Case(s) chromogen development. Slides are then rinsed and M900-12W-WHITE 1 Case(s) counterstained and are then ready for coverslipping. M900-12Y-YELLOW 1 Case(s) SlideMaster is very easy to use. It is light weight and durable. M900-12P-PINK 1 Case(s) M900-12AS-ASSORTED 1 Case(s) By making the hydrophobic barrier around the tissue section as small as possible, the total volume of antibody reagent can be EASYDIP Stainless Steel Holder significantly reduced per slide. Instead of using 100-200 Made of Stainless Steel. Will hold up to 6 Jars. microliters of antibodies per tissue section usually 50 microliters will completely cover small tissues and 100 microliters will cover Catalog Number Volume larger tissues. With this method, slide staining is much more M906 1 ea. efficient, more consistent, drying-out of slides is minimized, and the cost of reagents is reduced. Catalog Number Volume E00001 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
178 Histology
Slidefile Storage System 100 Positions Vertical Slide Staining Rack Dark Gray Each SlideFile Storage System includes a slide box and a The EasyDip Slide Staining Rack will hold up to 12 microscope removable tray. A tinted hinged cover makes the contents of the slides with dimensions such as 75 x 25 mm, (3 x 1 in.) and even box easy to see at a glance.The base is available in five different 76 x 26 mm and with a thickness of 1.0 and 1.2 mm. The slides fit colors to help in slide classification and to minimize the possibility into individual slots for free passage and rapid drainage of of sample mix-up. staining fluids. Since they are placed vertically in the rack and not horizontally, their writing area will not be stained by the fluid, The key to the SlideFile System is a removable tray inside the allowing their removal without the use of forceps. The lid storage box having a hundred individual numbered slots. All completely covers the EasyDip Slide Staining Jar to minimize spill slides are stored upright for easier insertion and removal. Simply and evaporation. A handle is permanently attached to the rack tilt them forward and backward with one finger to easily and for easy insertion and removal of slides without your fingers rapidly pick up the slide you need. A unique feature with this touching the solution. Available in dark gray only. Will resist system is to be able to read bar codes without having to remove temperatures between -170 C and +121 C. Autoclavable. the slides from the box. Dimensions: 60 x 64 x 97 mm H (2 1/4 x 2 1/2 x 3 3/4 in. H). Catalog Number Volume For space saving purposes, you can double the amount of slides simply by storing two slides per slot. For maximum storage M905-12DGY 1 Case(s) space, simply remove the tray and line up 400 slides in 3 rows for long term storage. Will resist temperatures between -80 C and +80 C. Not autoclavable. Ancillary (Hist.)
Dimensions: 82 x 245 x 86 mm H (3 1/4 x 9 5/8 x 3 3/8 in. H) Catalog Number Volume M700-100W-WHITE 1 Case(s) Methanol For various laboratory procedures. Stain Tray Slide Staining System Catalog Number Volume Made of ABS Plastic MTH500 500 ml Another user friendly approach to immunohistochemistry MTH999 1000 ml staining. This tray is also suitable not only for routine staining MTH3800 1 Gal. requiring a humid chamber but is also ideal for Hematology, Cytology and Microbiology laboratories. Manipulation is made Wash Solution Concentrate (50X) safe and easy by using only one hand. Wash Solution Concentrate (50x) is designed to provide optimal The StainTray has a black base made of tough ABS plastic rinsing of routine or special stains between steps. In addition, withstanding a wide range of chemicals (Avoid chlorinated this reagent can be used as a dilution buffer for most aqueous hydrocarbons). It will accept up to 20 slides on four plastic rails stains. This product is compatible with hand staining procedures covered with a polymer strip to perfectly hold slides even if tray and most automated systems. is held at an angle. When humidity is needed, wells between rails Catalog Number Volume will hold up to one ml of water securely without splashing. Middle wells will hold up to 2 ml each. Rails are raised not only to WSC999 1000 ml avoid water touching the slides but to make them more easily retrieveable. The base will also hold excess stain solution Water, Deionized/Distilled dripping from the slides. Four rubber feet ensure greater base Water for use in laboratory procedures has been deionized, stability. Units are stackable for space saving purposes. distilled and filtered at 0.2 micrometer for critical assays. Catalog Number Volume Two covers are available: A clear one (M920-1) allowing for visual examination. Made of DDH999 1000 ml PETG with a temperature range of -20 C to +60 C. DDH3800 1 Gal. A black lid (M920-2) for fluorescent work. Made of ABS with a DDH-20000 20 L temperature range of -80 C to +80 C.
Dimensions with cover: 38 W x 24 D x 4.5 H cm (15 W x 9 3/8 D x Mounting Media (H & C) 1 3/4 H in.) Catalog Number Volume Aqueous Mount M920-1 1 Clear M920-2 1 Black Is formulated for coverslipping sections stained with alcohol soluble chromogens, such as Fast-Red or AEC. Available in convenient dropper top bottles. Coverslips can be removed by soaking in water. No heating is required before use. Catalog Number Volume AMT030 30 ml AMT060 60 ml AMT500 500 ml AMT999 1000 ml ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
179 Histology
Aqueous Mount (Low Viscosity) Permanent Mounting Media (Aqueous) Is formulated for coverslipping sections stained with alcohol AEC and Fast Red are two of the most commonly used soluble chromogens, such as Fast-Red or AEC. Available in chromogens for peroxidase and alkaline phosphatase based convenient dropper top bottles. Coverslips can be removed by immunostaining systems respectively. However, slides stained soaking in water. No heating is required before use. Flows more with these chromogens cannot be stored permanently. freely than AMT. Permanent Mounting Medium (Aqueous) has been designed to Catalog Number Volume overcome this limitation. This product is an aqueous mounting medium with a very high refractive index, which when applied to AML030 30 ml the stained tissue sections can store the tissue specimens AML060 60 ml permanently without fading of the chromogens. Because of the AML500 500 ml superior refractive index, tissues mounted in this medium look AML999 1000 ml like dehydrated specimens. No coverslipping is required. However, if coverslipping is desired, dry slides can be post Buffered Glycerol Mounting Media mounted using an organic based mounting medium. Advantages Buffered Glycerol Mounting Media is a non-drying formulation of this product include: no coverslip, no exposure to the organic that is useful in a variety of procedures, such as fumes, permanent storage of slides and high resolution of tissue immunofluorescence, immunohistochemistry, special stains, etc. specimens. This reagent is compatible with AEC, DAB, Fast Red, Coverslips may be easily removed by soaking in water. BCIP/NBT, BCIP/INT and fluorescent dyes like FITC and No heating is required before use. phycobiliproteins. High pH ensures increased stability of Contains no Anti-Fade components. fluorescence. pH 8.0 Catalog Number Volume Catalog Number Volume PMT030 30 ml GMM003 3 ml GMM030 30 ml Miscellaneous (H & C) GMM500 500 ml GMM999 1000 ml FluoreGuard Mounting Medium KP Marker Plus FluoreGuard Mounting Medium is a water-soluble medium Klinipath KP Marker Plus is a solvent resistant marking pen for designed for semi-permanent coverslipping of fluorescent slide permanent writing on glass slides, cassettes and other items in preparations. FluoreGuard dries to a semi-rigid layer which the laboratory. One box contains 12 pens. eliminates tissue damage due to moving coverslips and facilitates Catalog Number Volume long term storage. KPM-1 12 Pen(s) Catalog Number Volume FMM030 30 ml PAP Pen FMM060 60 ml This marking pen has been designed to provide a thin film-like FMM500 500 ml barrier when a circle is drawn around the specimen on a slide. FMM999 1000 ml This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen FluoreGuard Mounting Medium (Hard Set) contains a special formulation which is insoluble in alcohol and FluoreGuard Mounting Medium (Hard Set) is a water-soluble acetone. It can be removed, if desired, by xylene after the medium designed for semi-permanent coverslipping of staining procedure is completed. fluorescent slide preparations. FluoreGuard dries to a semi-rigid Catalog Number Volume layer which eliminates tissue damage due to moving coverslips LP0001 1 ea. and facilitates long term storage. Catalog Number Volume PAP Pen-Mini FMH030 30 ml This marking pen has been designed to provide a thin film-like FMH060 60 ml barrier when a circle is drawn around the specimen on a slide. FMH500 500 ml This barrier creates the proper surface tension to hold an FMH999 1000 ml antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed. Catalog Number Volume LP0002 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
180 Cytology
EA-65 Stain Solution Cytology EA-65 is a cytologic stain routinely used in diagnostic cytology to aid in the identification and classification of exfoliative cells. EA- 65 is recommended for specimens with large amounts of mucus. Kits (Cyt.) The stain is used for examining exfoliative cells of vaginal, cervical, sputum, as well as other body secretions. Commonly used in combination with hematoxylin.
Results: Papanicolaou (PAP) Stain Kit The Papanicolaou (PAP) Stain Kit is designed to differentiate Nuclei: Blue between a variety of cells in vaginal smears for detection of Cytoplasm: Various shades of Pink or Green. vaginal, uterine and cervical cancer. In addition, this procedure is Catalog Number Volume valuable for staining a variety of other bodily secretions and cell EAD500 500 ml smears. The procedure was developed in the early 1940's by EAD999 1000 ml George Papanicolaou. EAD3800 1 Gal. Nuclei: Blue Eosin Y Solution (Alcoholic) High Keratin Cells: Orange Superficial Cells: Pink Eosin Y Solution is intended for use in the histological Erythrocytes: Dark Pink demonstration of cytoplasm and is commonly used as a Parabasal Cells: Blue/Green counterstain for Hematoxylin. When used correctly, various Intermediate Cells: Blue/Green shades of pink can be obtained to aid in visualization of tissue Metaplastic Cells: May contain both Blue/Green and Pink. components. Erythrocytes, collagen, and the cytoplasm of muscle or epithelial cells will stain with different shades of pink. Catalog Number Volume PAP-2 1 kit(s) Cytoplasm: Pink to Red PAP-1 500 ml ea. Erythrocytes: Pink to Red PAP-3 1000 ml ea. Nuclei: Black/Blue (Hematoxylin) Catalog Number Volume Individual Reagents (Cyt.) EYA500 500 ml EYA999 1000 ml EYA3800 1 Gal. Eosin Y Solution (Aqueous) Bluing Reagent Eosin Y Solution (Aqueous) is intended for use in the histological Is a pH-controlled solution for complete, effective bluing of demonstration of cytoplasm and is commonly used as a hematoxylin in histological and cytological procedures. counterstain for Hematoxylin. When used correctly, various Catalog Number Volume shades of pink can be obtained to aid in visualization of tissue components. Erythrocytes, collagen, and the cytoplasm of BRT500 500 ml muscle or epithelial cells will stain with different shades of pink. BRT999 1000 ml BRT3800 1 Gal. Cytoplasm: Pink to Red Erythrocytes Pink to Red EA-50 Stain Solution Nuclei: Black/Blue (Hematoxylin) EA-50 is a cytologic stain routinely used in diagnostic cytology to Catalog Number Volume aid in the identification and classification of exfoliative cells. The EYQ500 500 ml stain is used for examining exfoliative cells of vaginal, cervical, EYQ999 1000 ml sputum, as well as other body secretions. Commonly used in combination with hematoxylin. EYQ3800 1 Gal.
Results:
Nuclei: Blue Cytoplasm: Various shades of Pink or Green. Catalog Number Volume EAC500 500 ml EAC999 1000 ml EAC3800 1 Gal.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
181 Cytology
Eosin Y Solution (Modified Alcoholic) OG-6 Solution Eosin Y Solution (Modified Alcoholic) is intended for use in OG-6 is a cytologic stain routinely used in diagnostic cytology to histology and cytology applications. This newly formulated Eosin aid in the identification and classification of exfoliative cells. The provides the benefits of a traditional alcoholic formula with stain is used for examining exfoliative cells of vaginal, cervical, significant improvements in usability. Advantages include lower sputum, as well as other body secretions. Commonly used in evaporation rate, better color patterns, reduced tendency to spill combination with hematoxylin. over container, hands, and countertops, and improved surface Catalog Number Volume tension to remain on tissue section. OGA500 500 ml Cytoplasm: Light Pink OGA999 1000 ml Collagen: Pink OGA3800 1 Gal. Muscle: Pink/Rose Erythrocytes: Pink/Red Water, Deionized/Distilled Catalog Number Volume Water for use in laboratory procedures has been deionized, distilled and filtered at 0.2 micrometer for critical assays. EYB500 500 ml EYB999 1000 ml Catalog Number Volume EYB3800 1 Gal. DDH999 1000 ml DDH3800 1 Gal. Eosin-Phloxine Solution DDH-20000 20 L Eosin-Phloxine Solution is intended for use in the histological demonstration of cytoplasm. The addition of Phloxine to Eosin results in more vibrant staining than with Eosin alone. When Transport Media (Cyt.) used correctly, Eosin-Phloxine various shades of pink can be obtained to aid in visualization of tissue components.
Cytoplasm: Pink to Red Erythrocytes: Pink to Red CytoPort, Cytology Transport Media Alcoholic Hyalin: Pink This reagent is intended for use as a transport media for Catalog Number Volume mammalian cells for subsequent testing. Samples may be transported at room temperature. EPN500 500 ml EPN999 1000 ml Catalog Number Volume EPN3800 1 Gal. CTM500 500 ml CTM999 1000 ml Hematoxylin, Mayer's (Lillie's Modification) Produces a crisp dark blue nuclei. A traditional formulation that results in an excellent quality stain that is more intense than our Ancillary (Cyt.) Hematoxylin, For Automation (catalog# HAQ999). For optimal results, use in combination with Bluing Reagent (catalog# BRT999). Catalog Number Volume KP Marker Plus HMM125 125 ml Klinipath KP Marker Plus is a solvent resistant marking pen for HMM500 500 ml permanent writing on glass slides, cassettes and other items in HMM999 1000 ml the laboratory. One box contains 12 pens. HMM3800 1 Gal. Catalog Number Volume Hematoxylin, Weigert's Iron Kit KPM-1 12 Pen(s) Weigert's Iron Hematoxylin is intended to be used with various PAP Pen special stain kits. Product is supplied as a two component (equal This marking pen has been designed to provide a thin film-like volumes of parts A and B) system that is mixed prior to use and results in black/blue nuclei. barrier when a circle is drawn around the specimen on a slide. This barrier creates the proper surface tension to hold an Catalog Number Volume antibody solution within the target area on the slide. PAP Pen HWI-1 250 ml contains a special formulation which is insoluble in alcohol and HWI-2 1000 ml acetone. It can be removed, if desired, by xylene after the HWI-3 2000 ml staining procedure is completed. Catalog Number Volume LP0001 1 ea.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
182 Cytology
PAP Pen-Mini This marking pen has been designed to provide a thin film-like barrier when a circle is drawn around the specimen on a slide. This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed. Catalog Number Volume LP0002 1 ea. Wash Solution Concentrate (50X) Wash Solution Concentrate (50x) is designed to provide optimal rinsing of routine or special stains between steps. In addition, this reagent can be used as a dilution buffer for most aqueous stains. This product is compatible with hand staining procedures and most automated systems. Catalog Number Volume WSC999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
183 Hematology Hematology Individual Reagents (Hem.) Kits (Hem.) Brilliant Cresyl Blue (0.3%, Alcoholic) Brilliant Cresyl Blue (0.3%, alcoholic) is a supravital hematology stain for counting reticulocytes in peripheral blood smears. The Giemsa Stain Kit (May-Grunwald) number of reticulocytes in the blood is a simple measure of erythropoietic performance. Reticulocytes are immature The Giemsa Stain Kit (May-Grunwald) is intended for use in the erythrocytes that contain nuclear remnants of basophilic visualization of cells present in hematopoietic tissues and certain ribonucleoproteins which decreases as the reticulocyte matures. microorganisms. This kit may be used on formalin-fixed, paraffin- When stained, reticulocytes appear to contain dark blue granules embedded sections. or filaments. Nuclei: Blue/Violet Reticulocytes: Blue/Green with Dark Blue Granules. Cytoplasm: Light Blue Erythrocytes: Blue/Green Collagen: Pale Pink Leukocytes: Light Blue Muscle Fibers: Pale Pink Erythrocytes: Gray, Yellow or Pink Catalog Number Volume Rickettsia: Reddish-Purple BCA500 500 ml Helicobacter Pylori: Blue BCA999 1000 ml Mast Cells: Dark Blue with Red Granules BCA3800 1 Gal. Catalog Number Volume GMG-2 100 Slides Brilliant Cresyl Blue (1.5% in 0.85% Saline) GMG-1 1 kit(s) Brilliant Cresyl Blue (1.5% in 0.85% Saline) is a supravital hematology stain for counting reticulocytes in peripheral blood Quick-Dip Differential Stain Kit smears. The number of reticulocytes in the blood is a simple The Quick-Dip Differential Stain Kit provides three reagents for measure of erythropoietic performance. Reticulocytes are rapid staining of blood smears. Methanol is used to quickly fix immature erythrocytes that contain nuclear remnants of smears, followed by differential staining with buffered xanthene basophilic ribonucleoproteins which decreases as the reticulocyte and thiazine dyes. matures. When stained, reticulocytes appear to contain dark blue granules or filaments. Expected Results: Neutrophils: Violet nuclei with dark violet granules and pink Reticulocytes: Blue/Green with Dark Blue Granules. cytoplasmic granules. Erythrocytes: Blue/Green Eosinophils: Violet nuclei with dark violet granules and bright Leukocytes: Light Blue red cytoplasmic granules. Catalog Number Volume Monocytes: Violet nuclei with light blue cytoplasm. BCS500 500 ml
Lymphocytes: Violet nuclei with dark violet granules and light BCS999 1000 ml blue cytoplasm. BCS3800 1 Gal. Basophils: Violet nuclei with light blue cytoplasm. Erythrocytes: Pink to yellowish-red. Giemsa Stock Solution Catalog Number Volume Component of the Giemsa Stain Kit (May Grunwald) for blood QDK-1 500 ml ea. smears. QDK-GL 1 Gal. Catalog Number Volume Wright-Giemsa Stain Kit GGS125 125 ml GGS500 500 ml Wright-Giemsa Stain Kit is intended to be used for differential GGS999 1000 ml staining of blood smears, bone marrow and blood parasites.
Erythrocytes: Pink-Tan Leukocytes: Blue-Purple Neutrophils: Light Purple granules in cytoplasm. Eosinophils: Bright Red-Red-Orange granules in cytoplasm. Basophils: Deep Purple granules in cytoplasm. Platelets: Violet-Purple granules in light blue cytoplasm. Catalog Number Volume WGK-2 1 kit(s) WGK-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
184 Hematology
Jenner Stock Solution For Research Use Only. Ancillary (Hem.)
Jenner Stock Solution is intended to be used for differential staining of blood smears, bone marrow and blood parasites. This reagent is used in combination with Phosphate Buffer Solution Wash Solution Concentrate (50X) pH 6.8 (cat# PBM) to make a working solution. Wash Solution Concentrate (50x) is designed to provide optimal Blood Smear Expected Results rinsing of routine or special stains between steps. In addition, Neutrophils: Violet nuclei with dark violet granules and pink this reagent can be used as a dilution buffer for most aqueous cytoplasmic granules stains. This product is compatible with hand staining procedures Eosinophils: Violet nuclei with dark violet granules and bright red and most automated systems. cytoplasmic granules. Catalog Number Volume Monocytes: Violet nuclei with light blue cytoplasm. WSC999 1000 ml Lymphocytes: Violet nuclei with dark violet granules and light blue cytoplasm. Basophils: Violet nuclei with light blue cytoplasm. Erythrocytes: Pink to yellowish-red. Catalog Number Volume JSS500 500 ml JSS999 1000 ml May-Grunwald Stock Solution Component of the Giemsa Stain Kit (May-Grunwald) for blood smears. Catalog Number Volume MAY125 125 ml MAY500 500 ml MAY999 1000 ml Methanol For various laboratory procedures. Catalog Number Volume MTH500 500 ml MTH999 1000 ml MTH3800 1 Gal. Phosphate Buffer Solution, pH 6.8 Ready-to-Use solution used in the Giemsa Stain Kit. Catalog Number Volume PBM500 500 ml PBM999 1000 ml Water, Deionized/Distilled Water for use in laboratory procedures has been deionized, distilled and filtered at 0.2 micrometer for critical assays. Catalog Number Volume DDH999 1000 ml DDH3800 1 Gal. DDH-20000 20 L Wright-Giemsa Solution The Wright-Giemsa Solution is intended for differential staining of blood smears and blood parasites. Use in conjuction with Phosphate Buffer Solution pH 6.8 (cat.# PBM) Catalog Number Volume WGS500 500 ml WGS999 1000 ml WGS3800 1 Gal.
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
185 Microbiology
Gram Stain Kit Microbiology The Gram Stain Kit is intended for the demonstration and differentiation of Gram-positive and Gram-negative bacteria.
Kits (Mic.) Gram Positive Bacteria: Blue Gram Negative Bacteria: Red Other Tissue: Yellow Nuclei: Red Catalog Number Volume Acid Fast Bacteria (AFB) Stain Kit GSK-2 30 ml ea. The Acid Fast Bacteria (AFB) Stain Kit is intended for use in the GSK-1 125 ml ea. histological visualization of Acid Fast Bacteria and Tubercle GSK-500 500 ml ea. Bacilli. This kit is a rapid 15-minute procedure. The lipoid capsule of the acid-fast organism takes up carbol fuchsin and Gram Stain Kit (Modified Brown & Brenn) resists decolorization. The Gram Stain Kit (Modified Brown & Brenn) is intended for the Acid Fast Organisms: Bright Red demonstration and differentiation of Gram-positive and Gram- Background: Light Green negative bacteria. Catalog Number Volume Gram Posi ve Bacteria: Blue FAB-2 30 ml ea. Gram Nega ve Bacteria: Red FAB-1 125 ml ea. Background: Yellow FAB-500 500 ml ea. Nuclei: Red Catalog Number Volume Fite's Stain Kit BBS-2 30 ml ea. The Fite's Stain Kit (For Leprosy) is intended for use in the BBS-1 125 ml ea. histological visualization of mycobacterium leprae (leprosy) and BBS-500 500 ml ea. Nocardia. H. Pylori Rapid Stain Kit Lepra bacillus: Red Nocardia: Red The H. Pylori Rapid Stain Kit is designed for demonstrating Background: Blue Helicobactor Pylori infected tissue. Kit may be used on formalin fixed, paraffin-embedded tissue. The Warthin-Starry Stain Kit Catalog Number Volume (WSS-1) is a more sensitive system for H. Pylori and is suggested FLS-1 125 ml ea. for cases where total H. Pylori count is low. FLS-500 500 ml ea. Results: Giemsa Stain Kit (May-Grunwald) Helicobactor Pylori: Blue The Giemsa Stain Kit (May-Grunwald) is intended for use in the Mucin: Yellow visualization of cells present in hematopoietic tissues and certain Background: Light Blue microorganisms. This kit may be used on formalin-fixed, paraffin- Catalog Number Volume embedded sections. AYH-2 100 Slides AYH-1 1 kit(s) Nuclei: Blue/Violet Cytoplasm: Light Blue Mucicarmine Stain Kit (Modified Southgate's) Collagen: Pale Pink Muscle Fibers: Pale Pink Mucicarmine Stain Kit (Modified Southgate's) is intended for use Erythrocytes: Gray, Yellow or Pink in the histological visualization of acid mucopolysacharides in Rickettsia: Reddish-Purple tissue sections. This product is useful in distinguishing mucin Helicobacter Pylori: Blue negative undifferentiated squamous cell lesions from mucin Mast Cells: Dark Blue with Red Granules positive adenocarcinomas. In addition, this product will stain the mucopolysaccharide capsule of Cryptococcus neoformans. Catalog Number Volume GMG-2 100 Slides Mucin: Pink/Red GMG-1 1 kit(s) Capsule of Cryptococcus: Red Nuclei: Black/Blue GMS Stain Kit Other tissue components: Yellow The Modified Gomori Methenamine-Silver Nitrate Stain (GMS Catalog Number Volume Stain Kit) is intended for use in the histologic visualization of SMS-2 100 Slides fungi, basement membrane and some opportunistic organisms SMS-1 1 kit(s) such as Pneumocystis carinii. Catalog Number Volume KAA-1 125 ml ea. KAA-500 500 ml ea. KAA-1000 1000 ml ea. ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
186 Microbiology
Orcein Stain Kit (For Hepatitis B and Elastic Fibers) Quick-Dip Differential Stain Kit The Orcein Stain may be used in histology procedures for the The Quick-Dip Differential Stain Kit provides three reagents for visualization of Hepatitis B surface Antigen (HBsAg), elastic fibers, rapid staining of blood smears. Methanol is used to quickly fix and copper associated proteins. HBsAg appears as irregular smears, followed by differential staining with buffered xanthene shaped aggregates in the cytoplasmic region of the cells. This and thiazine dyes. reagent may be used on formalin-fixed, paraffin-embedded sections. Expected Results: Neutrophils: Violet nuclei with dark violet granules and pink HBsAg: Dark Red/Brown cytoplasmic granules. Elastic Fibers: Dark Red/Brown Eosinophils: Violet nuclei with dark violet granules and bright Copper Assoc. Proteins: Dark Red/Brown red cytoplasmic granules. Background: Light Reddish/Purple Monocytes: Violet nuclei with light blue cytoplasm. Catalog Number Volume Lymphocytes: Violet nuclei with dark violet granules and light blue cytoplasm. HBK-2 1 kit(s) Basophils: Violet nuclei with light blue cytoplasm. HBK-1 1 kit(s) Erythrocytes: Pink to yellowish-red. Periodic Acid Schiff (PAS) for Fungus Stain Kit Catalog Number Volume The Periodic Acid Schiff (PAS) for Fungus Stain Kit is intended for QDK-1 500 ml ea. use in histological demonstration of fungal organisms in tissue QDK-GL 1 Gal. sections. The PAS reaction is also useful in the demonstration of lymphocytes and mucopolysaccharides. The staining patterns of Steiner Stain Kit (For Spirochetes) the lymphocytes are helpful in making therapeutic decisions in The Steiner Stain Kit (For Spirochetes) is designed for established cases of lymphocytic leukemia. demonstrating Fungi, Helicobacter Pylori, Legionella pneumophila, and Spirochete infected tissue. Kit may be used on Fungal Organisms: Magenta formalin fixed, paraffin-embedded tissue sections. PAS Positive Material: Magenta Nuclei: Geen/Blue Spirochetes: Black to Brown Catalog Number Volume Helicobactor Pylori: Black to Brown Fungi: Black to Brown PASF-2 1 kit(s) Legionella pneumophila: Black to Brown PASF-1 1 kit(s) Background: Yellow to Tan Pneumocystis Stain Kit Catalog Number Volume The Pneumocystis Stain Kit is intended for use in the histological SSK-1 1 kit(s) visualization of Pneumocystis carinii in cytology smears and Twort's Counterstain Kit paraffin tissue sections. Pneumocystis carinii is an opportunistic pathogen that causes severe pulmonary disease in humans, The Twort's Counterstain Kit is intended for use in histology dogs, rats, mice and other vertebrate species with acquired, procedures such as the Gram Stain to provide contrast for easier induced, or inherited immune deficiency syndromes. In addition, visualization of various cell components in tissue sections. this procedure will demonstrate Actinomyces and related species, Nocardia asteroids, and certain encapsulated bacteria. Nuclei: Red Cytoplasm: Light Green Pneumocystis carinii: Violet / Purple Catalog Number Volume Connective Tissue: Blue / Green TCK-1 1 kit(s) Erythrocytes: Yellow Mucin: Rose / Purple Twort's Gram Stain Kit Cartilage: Rose / Purple The Twort's Gram Stain Kit is designed for positive and negative Catalog Number Volume gram bacteria differentiation in formalin fixed paraffin PCS-2 100 Slides embedded tissues. Gram negative bacteria stain pink to red, PCS-1 1 kit(s) gram positive stain blue, and the background is stained light green.
Gram Posi ve Bacteria:Blue Nuclei and Gram Nega ve Bacteria:Red Background:Light Green Catalog Number Volume TGS-1 1 kit(s)
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
187 Microbiology
Warthin-Starry Stain Kit Carbol Fuchsin Counterstain The Warthin-Starry Stain Kit is intended for use in the Carbol Fuchsin Counterstain is a component of the Gram Stain visualization of Spirochetes, Helicobacter pylori, Legionella Kit, catalog # GSK-1. pneumophila, and Cat Scratch Fever bacteria. This kit may be Catalog Number Volume used on formalin-fixed, paraffin-embedded sections. CFX125 125 ml Helicobacter pylori: Black CFX500 500 ml Legionella pneumophila: Black CFX999 1000 ml Spirochetes: Black Cat Scratch Fever Bacteria: Black Carbol Fuchsin Solution Klebsiella: Brown/Black A modified Ziehl-Neelson formulation used for staining acid fast Nuclei: Brown bacteria. This stain is a rapid 15-minute procedure. The lipoid Background: Yellow capsule of the acid-fast organism takes up carbol fuchsin and Catalog Number Volume resists decolorization. WSS-1 1 kit(s) Acid Fast Organisms: Bright Red Wright-Giemsa Stain Kit Catalog Number Volume Wright-Giemsa Stain Kit is intended to be used for differential CFZ125 125 ml staining of blood smears, bone marrow and blood parasites. CFZ500 500 ml CFZ999 1000 ml Erythrocytes: Pink-Tan Leukocytes: Blue-Purple Gentian Violet Solution Neutrophils: Light Purple granules in cytoplasm. Gentian Violet Solution is the component of the Gram Stain Kit Eosinophils: Bright Red-Red-Orange granules in cytoplasm. (catalog# GSK-1) that results in blue staining of the Gram Positive Basophils: Deep Purple granules in cytoplasm. Bacteria. Gentian Violet is intended for the demonstration and Platelets: Violet-Purple granules in light blue cytoplasm. differentiation of Gram-positive and Gram-negative bacteria. Catalog Number Volume Catalog Number Volume WGK-2 1 kit(s) GVS125 125 ml WGK-1 1 kit(s) GVS500 500 ml GVS999 1000 ml Individual Reagents (Mic.) Gram's Decolorizer Solution Component used in the Gram Stain Kit. Catalog Number Volume Alcian Yellow Solution GDS125 125 ml GDS500 500 ml Used in Alcian Yellow for H. Pylori. GDS999 1000 ml Catalog Number Volume ANY125 125 ml H. Pylori Rapid Stain (1-Step) ANY500 500 ml The H. Pylori Rapid Stain (1-Step) is a single component reagent ANY999 1000 ml that has been developed to identify helicobacter pylori in a ANY3800 1 Gal. procedure that requires less than 10 minutes to complete. Procedure is effective for fresh, frozen, and paraffin embedded Carbol Fuchsin (Kinyoun's) sections. Helicobacter Pylori has been shown to be the causative organism in some gastric ulcers. The Carbol Fuchsin Solution (Kinyoun's) is intended for use in the histological visualization of Acid Fast Bacteria and Tubercle H. Pylori: Dark Blue/Purple Bacilli. This reagent is a rapid 2-5 minute procedure. The lipoid Cytoplasm: Pink to Red capsule of the acid-fast organism takes up carbol fuchsin and Background: Violet resists decolorization. Nuclei: Blue Acid Fast Organisms: Bright Red Catalog Number Volume Catalog Number Volume HPS030 30 ml HPS500 500 ml CFK500 500 ml HPS999 1000 ml CFK999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
188 Microbiology
Light Green Solution Safranin O Solution (For Gram Staining) Light Green Solution is intended for use in histological Safranin O Solution (For Gram Staining) has been specially applications as a general counterstain. When used correctly, formulated to help visualize gram negative bacteria when using various shades of green can be obtained to aid in visualization of ScyTek's Brown & Brenn Gram stain kit. (BBS-1, BBS-2). Gram tissue components. negative bacteria stain pink to red. Catalog Number Volume Catalog Number Volume LGA030 30 ml SOG125 125 ml LGA125 125 ml SOG250 250 ml LGA500 500 ml SOG500 500 ml LGA999 1000 ml SOG999 1000 ml LGA3800 1 Gal. Safranin O Solution (For Staining Nuclei) Lugol's Iodine Solution Safranin O has several uses in histology and cytology but is Catalog Number Volume commonly known for counterstaining nuclei red. This formula contains acetic acid providing a lower pH that reduces non- LIS125 125 ml nucleic background and cytoplasmic staining. This solution is not LIS500 500 ml suitable for bacterial (gram) or cartilage staining. LIS999 1000 ml Nuclei: Red Methylene Blue Solution Background: Light Red to Pink Methylene Blue Solution has been optimized in our research Catalog Number Volume laboratories to give outstanding results when used in various procedures such as the Ziehl-Neelsen, Fite's, and Gram stain. SOH250 250 ml The stain is also suggested for use in staining a variety of bacteria SOH500 500 ml (Corynebacterium diphtheria, Haemophilus influenzae, Neisseria, SOH999 1000 ml etc.) and leukocytes. This reagent produces dark blue nuclei with very light blue cytoplasm. SpiroPrep Component of the Warthin-Starry Stain Kit. Nuclei: Dark Blue Catalog Number Volume Cytoplasm: Light Blue Corynebacterium Diphtheria: Blue Granules SSE125 125 ml Escherichia Coli: Blue Rods SSE500 500 ml Streptococcus Pyogenes: Blue Cocci SSE999 1000 ml Catalog Number Volume Water, Deionized/Distilled MBS125 125 ml Water for use in laboratory procedures has been deionized, MBS500 500 ml distilled and filtered at 0.2 micrometer for critical assays. MBS999 1000 ml Catalog Number Volume Mucicarmine Solution (Southgate's) DDH999 1000 ml Mucicarmine Solution (Southgate's) is a component of the DDH3800 1 Gal. Mucicarmine Stain Kit (Catalog# SMS-1) and is intended for use DDH-20000 20 L in the histological visualization of acid mucopolysacharides in tissue sections. Mucicarmine Solution is the component responsible for staining Mucin red. This product is useful in Ancillary (Mic.) distinguishing mucin negative undifferentiated squamous cell lesions from mucin positive adenocarcinomas. In addition, this product will stain the mucopolysaccharide capsule of Catalog Number Volume KP Marker Plus SMG125 125 ml Klinipath KP Marker Plus is a solvent resistant marking pen for SMG500 500 ml permanent writing on glass slides, cassettes and other items in SMG999 1000 ml the laboratory. One box contains 12 pens. Picric Acid - Acetone Solution (0.1%) Catalog Number Volume Component used in the Gram Stain Kit (Modified Brown & Brenn). KPM-1 12 Pen(s) Catalog Number Volume PAB125 125 ml PAB500 500 ml PAB999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
189 Microbiology
PAP Pen This marking pen has been designed to provide a thin film-like barrier when a circle is drawn around the specimen on a slide. This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed. Catalog Number Volume LP0001 1 ea. PAP Pen-Mini This marking pen has been designed to provide a thin film-like barrier when a circle is drawn around the specimen on a slide. This barrier creates the proper surface tension to hold an antibody solution within the target area on the slide. PAP Pen contains a special formulation which is insoluble in alcohol and acetone. It can be removed, if desired, by xylene after the staining procedure is completed. Catalog Number Volume LP0002 1 ea. Wash Solution Concentrate (50X) Wash Solution Concentrate (50x) is designed to provide optimal rinsing of routine or special stains between steps. In addition, this reagent can be used as a dilution buffer for most aqueous stains. This product is compatible with hand staining procedures and most automated systems. Catalog Number Volume WSC999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
190 Buffers
Phosphate Buffered Saline (10x) pH 7.4 Buffers ScyTek Phosphate Buffered Saline (10x) pH 7.4 is an optimal formulation of pH stabilizers and salts designed to effectively remove excess material from the microtiter plate wells without disrupting the ELISA binding reaction. By maintaining the proper buffering environment, unbound components can be washed Acetate Buffer Solution, pH 8.0 away without suppressing antigen-antibody binding interactions, thereby reducing nonspecific background and increasing the Used in the Microwave Copper Stain. specific signal. Our Wash buffers do not contain hazardous Catalog Number Volume preservatives such as Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience SAB500 500 ml wash buffer is offered in a wide variety of formulations to meet SAB999 1000 ml the needs of your specific ELISA application. This product can be Citrate Buffer (10x) pH 6.0 customized to met the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. Citrate Buffer (10X) HIER Solution (pH 6.0) is a unique citrate Catalog Number Volume buffer designed to significantly enhance immunohistochemical staining with many commercially available primary antibodies. PBD500 500 ml Diluted 1:10 with deionized or distilled water, this product is easy PBD999 1000 ml to use and highly effective. PBD010 10 L Catalog Number Volume PBD-20000 20 L CBB125 125 ml Phosphate Buffered Saline (25x) pH 7.6 CBB500 500 ml ScyTek Phosphate Buffered Saline (25x) pH of 7.6 is an optimal CBB999 1000 ml formulation of pH stabilizers and salts designed to effectively Citrate Plus (10x) HIER Solution remove excess material from the microtiter plate wells without disrupting the ELISA binding reaction. By maintaining the proper This is a unique citrate buffer designed to significantly enhance buffering environment, unbound components can be washed immunohistochemical staining with many commercially available away without suppressing antigen-antibody binding interactions, primary antibodies. Diluted 1:10 with deionized or distilled thereby reducing nonspecific background and increasing the water, this product is easy to use and highly effective. Citrate specific signal. Our Wash buffers do not contain hazardous Plus (10X) can be used in a vegetable steamer, autoclave, or preservatives such as Azide or Mercury that may interfere with pressure cooker. However, for optimal results we recommend antibody-antigen binding interactions. For your convenience the autoclave or pressure cooker. wash buffer is offered in a wide variety of formulations to meet pH 6.5 ±0.5 the needs of your specific ELISA application. This product can be Catalog Number Volume customized to meet the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. CPL500 500 ml CPL999 1000 ml Catalog Number Volume PBS125 125 ml EDTA - Saline Buffer (10X Concentrate); pH 8.0 PBS500 500 ml EDTA Buffer (10X) HIER Solution (pH 8.0) is a unique buffer PBS999 1000 ml designed to significantly enhance immunohistochemical staining PBS010 10 L with many commercially available primary antibodies. Diluted PBS-20000 20 L 1:10 with deionized or distilled water, this product is easy to use and highly effective. Catalog Number Volume ETA500 500 ml ETA999 1000 ml Phosphate Buffer Solution, pH 6.8 Ready-to-Use solution used in the Giemsa Stain Kit. Catalog Number Volume PBM500 500 ml PBM999 1000 ml
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
191 Buffers
Phosphate Buffered Saline plus Tween 20 (10x) pH Tris Buffered Saline (10x) pH 7.5 7.4 ScyTek Tris Buffered Saline (10x) pH of 7.5 is an optimal ScyTek Phosphate Buffered Saline + Tween 20 (10x) pH of 7.4 is formulation of pH stabilizers, salts and detergents designed to an optimal formulation of pH stabilizers, salts and detergents effectively remove excess material from the microtiter plate designed to effectively remove excess material from the wells without disrupting the ELISA binding reaction. By microtiter plate wells without disrupting the ELISA binding maintaining the proper buffering environment, unbound reaction. By maintaining the proper buffering environment, components can be washed away without suppressing antigen- unbound components can be washed away without suppressing antibody binding interactions, thereby reducing nonspecific antigen-antibody binding interactions, thereby reducing background and increasing the specific signal. Our Wash buffers nonspecific background and increasing the specific signal. Our do not contain hazardous preservatives such as Azide or Mercury Wash buffers do not contain hazardous preservatives such as that may interfere with antibody-antigen binding interactions. Azide or Mercury that may interfere with antibody-antigen For your convenience wash buffer is offered in a wide variety of binding interactions. For your convenience wash buffer is formulations to meet the needs of your specific ELISA offered in a wide variety of formulations to meet the needs of application. This product can be customized to meet the specific your specific ELISA application. This product can be customized needs of your assay. Inquire about custom vialing, labeling, kit to meet the specific needs of your assay. Inquire about custom assembly and drop shipping. vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBD500 500 ml PBE500 500 ml TBD999 1000 ml PBE999 1000 ml TBD010 10 L PBE010 10 L TBD-20000 20 L PBE-20000 20 L Tris Buffered Saline (25x) pH 7.4 Phosphate Buffered Saline plus Tween 20 (20x) pH ScyTek Tris Buffered Saline (25x) pH of 7.4 is an optimal 7.6 formulation of pH stabilizers, salts and detergents designed to ScyTek Wash buffer formulations are an optimal formulation of effectively remove excess material from the microtiter plate pH stabilizers, salts and detergents designed to effectively wells without disrupting the ELISA binding reaction. By remove excess material from the microtiter plate wells without maintaining the proper buffering environment, unbound disrupting the ELISA binding reaction. By maintaining the proper components can be washed away without suppressing antigen- buffering environment, unbound components can be washed antibody binding interactions, thereby reducing nonspecific away without suppressing antigen-antibody binding interactions, background and increasing the specific signal. Our Wash buffers thereby reducing nonspecific background and increasing the do not contain hazardous preservatives such as Azide or Mercury specific signal. Our Wash buffers do not contain hazardous that may interfere with antibody-antigen binding interactions. preservatives such as Azide or Mercury that may interfere with For your convenience wash buffer is offered in a wide variety of antibody-antigen binding interactions. For your convenience formulations to meet the needs of your specific ELISA wash buffer is offered in a wide variety of formulations to meet application. This product can be customized to met the specific the needs of your specific ELISA application. This product can be needs of your assay. Inquire about custom vialing, labeling, kit customized to meet the specific needs of your assay. Inquire assembly and drop shipping. about custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume Catalog Number Volume TBS500 500 ml PBT500 500 ml TBS999 1000 ml PBT999 1000 ml TBS010 10 L PBT010 10 L TBS-20000 20 L PBT-20000 20 L SSPE Buffer (20x) pH 7.4 Diluted solution contains Sodium Chloride: 0.15 M; Sodium Phosphate: 0.010 M; EDTA: 0.001 M. Catalog Number Volume SPE-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
192 Buffers
Tris Buffered Saline plus Tween 20 (10x) pH 7.5 ScyTek Tris Buffered Saline + Tween 20 (10x) pH of 7.5 is an optimal formulation of pH stabilizers, salts and detergents designed to effectively remove excess material from the microtiter plate wells without disrupting the ELISA binding reaction. By maintaining the proper buffering environment, unbound components can be washed away without suppressing antigen-antibody binding interactions, thereby reducing nonspecific background and increasing the specific signal. Our Wash buffers do not contain hazardous preservatives such as Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience wash buffer is offered in a wide variety of formulations to meet the needs of your specific ELISA application. This product can be customized to meet the specific needs of your assay. Inquire about custom vialing, labeling, kit assembly and drop shipping. Catalog Number Volume TBE500 500 ml TBE999 1000 ml TBE010 10 L TBE-20000 20 L Tris Buffered Saline plus Tween 20 (20x Concentrate) pH 7.4 ScyTek Tris Buffered Saline + Tween 20 (20x Concentrate) pH of 7.4 is an optimal formulation of pH stabilizers, salts and detergents designed to effectively remove excess material from the tissue sample or microtiter plate wells without disrupting the antibody binding reaction. By maintaining the proper buffering environment, unbound components can be washed away without suppressing antigen-antibody binding interactions, thereby reducing nonspecific background and increasing the specific signal. Our Wash buffers do not contain hazardous preservatives such as Azide or Mercury that may interfere with antibody-antigen binding interactions. For your convenience wash buffer is offered in a wide variety of formulations to meet the needs of your specific ELISA application. Catalog Number Volume TBT500 500 ml TBT999 1000 ml TBT010 10 L TBT-20000 20 L
ScyTek Laboratories, Inc. - Telephone 800-729-8350 - Fax 435-755-0015 - [email protected] - www.scytek.com
193