DOCSLIB.ORG

Prostate Cancer Stromal Cells and Lncap Cells Coordinately Activate

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Prostate Cancer Stromal Cells and Lncap Cells Coordinately Activate Endocrine-Related Cancer (2009) 16 1139–1155 Prostate cancer stromal cells and LNCaP cells coordinately activate the androgen receptor through synthesis of testosterone and dihydrotestosterone from dehydroepiandrosterone Atsushi Mizokami, Eitetsu Koh, Kouji Izumi, Kazutaka Narimoto, Masashi Takeda, Seijiro Honma1, Jinlu Dai 2, Evan T Keller 2 and Mikio Namiki Department of Integrative Cancer Therapy and Urology, Kanazawa University Graduate School of Medical Sciences, 13-1 Takaramachi, Kanazawa City 920-8640, Japan 1Teikoku Hormone MFG. Co., 1604 Shimosakunobe, Takatsu-ku, Kawasaki, Kanagawa 213, Japan 2Departments of Urology and Pathology, University of Michigan, Ann Arbor, Michigan, USA (Correspondence should be addressed to A Mizokami; Email: [email protected]) Abstract One of the mechanisms through which advanced prostate cancer (PCa) usually relapses after androgen deprivation therapy (ADT) is the adaptation to residual androgens in PCa tissue. It has been observed that androgen biosynthesis in PCa tissue plays an important role in this adaptation. In the present study, we investigated how stromal cells affect adrenal androgen dehydroepian- drosterone (DHEA) metabolism in androgen-sensitive PCa LNCaP cells. DHEA alone had little effect on prostate-specific antigen (PSA) promoter activity and the proliferation of LNCaP cells. However, the addition of prostate stromal cells or PCa-derived stromal cells (PCaSC) increased DHEA-induced PSA promoter activity via androgen receptor activation in the LNCaP cells. Moreover, PCaSC stimulated the proliferation of LNCaP cells under physiological concentrations of DHEA. Biosynthesis of testosterone or dihydrotestosterone from DHEA in stromal cells and LNCaP cells was involved in this stimulation of LNCaP cell proliferation. Androgen biosynthesis from DHEA depended upon the activity of various steroidogenic enzymes present in stromal cells. Finally, the dual 5a-reductase inhibitor dutasteride appears to function not only as a 5a-reductase inhibitor but also as a 3b-hydroxysteroid dehydrogenase inhibitor in LNCaP cells. Taken together, this coculture assay system provides new insights of coordinate androgen biosynthesis under the microenvironment of PCa cells before and after ADT, and offers a model system for the identification of important steroidogenic enzymes involved in PCa progression and for the development of the corresponding inhibitors of androgen biosynthesis. Endocrine-Related Cancer (2009) 16 1139–1155 Introduction progresses into what is termed an androgen non- Prostate cancer (PCa) is the most common malig- responsive phenotype. nancy and the second leading cause of cancer-related Multiple molecular mechanisms that could account death of men in the United States (Jemal et al. 2008). for the development of resistance to ADT have been Since advanced PCa is initially dependent upon proposed (Feldman & Feldman 2001), which typically androgens, androgen deprivation therapy (ADT) is invoke the androgen receptor (AR) as a key mediator in the first choice for advanced PCa. Unfortunately, after the progression of PCa (Takeda et al. 1996, Taplin & an initial response to ADT, PCa eventually loses Balk 2004). Moreover, alterations of AR itself, which responsiveness to the androgen blockade and are either absent or at low frequency in the original Endocrine-Related Cancer (2009) 16 1139–1155 Downloaded from Bioscientifica.comDOI: 10.1677/ERC-09-0070 at 09/30/2021 05:52:26PM 1351–0088/09/016–001139 q 2009 Society for Endocrinology Printed in Great Britain Online version via http://www.endocrinology-journals.orgvia free access A Mizokami et al.: Acceleration of DHEA activity androgen-dependent state, result in an androgen- expression of AKR1C3 (type 5 17b-HSD) in PCa hypersensitive situation where stimulation of PCa tissue, while Stanbrough et al. (2006) confirmed that growth occurs at castrate levels of androgens (Taplin ADT-resistant PCa and bone marrow metastases & Balk 2004). One of the AR alterations that occur is expressed increased levels of multiple genes respon- AR mutation that results in promiscuous ligand sible for androgen metabolism (HSD3B2, AKR1C3, specificity (Veldscholte et al. 1990). Therefore, in SRD5A1, AKR1C2, AKR1C1, and UGT2B15). These addition to its normal ligands, testosterone and studies provide support for the concept that PCa tissues dihydrotestosterone (DHT), both androstenediol, a can perform local biosynthesis of testosterone and precursor of testosterone, and estradiol can activate DHT resulting in activation of the AR (Labrie 1991). the AR and stimulate the proliferation of LNCaP cells, It remains unclear; however, in which cell types which have a mutated AR (Mizokami et al. 2004, testosterone and DHT are converted from DHEA to Arnold et al. 2005). Testosterone and the more active other androgens in PCa tissue, although the products androgen DHT are important factors in PCa pro- from DHEA and the relevant steroidogenic enzymes gression. These hormones are still present in PCa tissue are definitively present in the prostate. In this study, after ADT. Specifically, when PCa patients are treated we explored the hypothesis that PCa stromal cells with ADT, serum testosterone and DHT decrease to contribute to the biosynthesis of testosterone and less than one-tenth of pretreatment levels (Labrie et al. DHT in PCa. We demonstrated that testosterone 1985). However, testosterone and DHT in PCa tissue and DHT synthesized from DHEA in stromal cells are still present at 20–40% of pretreatment values activated AR in PCa epithelial cells in a paracrine (Labrie et al. 1985, Belanger et al. 1989, Forti et al. fashion and thus contribute to the development of ADT 1989, Mizokami et al. 2004, Nishiyama et al. 2004, resistance in PCa. Titus et al. 2005). These remaining androgens that are still present post-therapy may continue to promote AR activation and account for the observation that Materials and methods combination therapy with a LHRH agonist, to block Isolation of stromal cells from prostate androgen production, and an antiandrogen, to block carcinoma tissue ligand binding to the AR, is more effective for PCa treatment than either therapy alone (Labrie et al. 1985, All studies were approved by the Institutional Review Akaza 2007, Labrie 2007). Board. We obtained informed consent for experimental Testosterone and DHT in PCa tissue after medical or use of all specimens obtained from prostate needle surgical castration are synthesized locally in the biopsy or surgical procedure. The characteristics of prostate from dehydroepiandrosterone (DHEA) of PCa patients are described in Table 1. Stromal cells adrenal origin (Labrie et al. 1985, Belanger et al. were isolated using a modification of a previously 1989, Forti et al. 1989, Mizokami et al. 2004, described method (Krill et al. 1997). Briefly, small Nishiyama et al.2004, Titus et al. 2005). The pieces of PCa tissue were minced with scissors and metabolism from DHEA to DHT in peripheral target washed twice with PBS. The fragments were then tissues depends upon the level of expression of various digested in 0.25% trypsin–EDTA (Invitrogen) for steroidogenic enzymes in the specific cell types of 30 min at 37 8C. After digestion, the dispersed stromal these tissues (Labrie et al. 2005). Adrenal DHEA is cells were cultured in RPMI supplemented with converted to testosterone by 17b-hydroxysteroid 1% penicillin/streptomycin and 10% FCS (Sigma; dehydrogenase (17b-HSD) and 3b-HSD. Testosterone RPMI–10% FCS) on 6 cm dishes. Bone-derived is then converted to DHT by 5a-steroid reductase (SRD5A) in the prostate (Andersson & Russell 1990, Table 1 Characteristics of prostate cancer (PCa) patients on Andersson et al. 1991, Labrie et al. 2005, Luu-The diagnosis et al. 2008). Currently, 2 types of 3b-HSD, 15 types of Stromal PSA (ng/ml) Gleason Stage on 17b-HSDs, and 3 types of SRD5A have been identified cells on diagnosis score diagnosis and localized in various peripheral tissues, including PCaSC-1 4799 5C5 T3a, N0, M1 the prostate, with specific expression patterns in each PCaSC-2 263 4C4 T3b, N0, M0 tissue (Luu-The et al. 2008, Uemura et al. 2008). For PCaSC-5 76.9 4C3 T3a, N0, M1 example, 3b-HSD and type 5 17b-HSD were localized PCaSC-6 46.4 4C4 T3a, N1, M0 in basal cells of alveoli, stromal cells, and endothelial PCaSC-7 648 4C3 T4, N1, M1 C cells of blood vessels of the prostate (Pelletier et al. PCaSC-8 246 4 5 T4, N0, M1 PCaSC-9 180 5C4 T3b, N0, M0 2001). Fung et al. (2006) have observed increased Downloaded from Bioscientifica.com at 09/30/2021 05:52:26PM via free access 1140 www.endocrinology-journals.org Endocrine-Related Cancer (2009) 16 1139–1155 stromal cells 1 (BDSC-1) were obtained from the 11th with 20 nM non-target (NT) siRNA, AR siRNA-1, or rib of a 48-year-old man during left adrenalectomy for AR siRNA-2 (Invitrogen) using RNAiMAX (Invi- pheochromocytoma. BDSC-2 were obtained from the trogen) for 12 h, and LNCaP cells were transfected 11th rib of a 58-year-old man during left nephrour- with pGL3PSAp-5.8 for 12 h. Then after changing the eterectomy for localized ureteral cancer. These bone medium, transfected LNCaP cells were cocultured samples were cut into bone chips and further processed with or without PrSC. Consequently, cells were treated with a bone grinder (Lu et al. 2004). Bone chips were with or without 100 nM DHEA (C) for 24 h. As a then cultured in RPMI–10% FCS like prostate-derived positive control, cells were treated with 0.1 nM DHT stromal cells. for 24 h. For knockdown of AR expression in PrSC by RNA interference, we transfected 3!105 PrSC on a 0 Cell culture and cell proliferation assay 6 cm dish with 50 nM RNAi or AR RNAi (5 -CAUA- GUGACACCCAGAAGCUUCAUC-30; Invitrogen) LNCaP cells were cultured in DMEM including phenol for 48 h with Lipofectamine RNAiMAX. Transfected red–5% FCS (DMEM–5% FCS). Normal prostate- cells were counted, and 5!104 siRNA-transfected derived stromal cells, PrSC, commercially available PrSC were cocultured with 5!104 LNCaP cells (Cambrex, East Rutherford, NJ, USA) were cultured transfected with pGL3PSAp-5.8 12 h before coculture.
Load more

Recommended publications
  • Differential Control of Dntp Biosynthesis and Genome Integrity
    www.nature.com/scientificreports OPEN Diferential control of dNTP biosynthesis and genome integrity maintenance by the dUTPase Received: 6 November 2015 Accepted: 12 June 2017 superfamily enzymes Published online: 20 July 2017 Rita Hirmondo1, Anna Lopata1, Eva Viola Suranyi1,2, Beata G. Vertessy1,2 & Judit Toth1 dUTPase superfamily enzymes generate dUMP, the obligate precursor for de novo dTTP biosynthesis, from either dUTP (monofunctional dUTPase, Dut) or dCTP (bifunctional dCTP deaminase/dUTPase, Dcd:dut). In addition, the elimination of dUTP by these enzymes prevents harmful uracil incorporation into DNA. These two benefcial outcomes have been thought to be related. Here we determined the relationship between dTTP biosynthesis (dTTP/dCTP balance) and the prevention of DNA uracilation in a mycobacterial model that encodes both the Dut and Dcd:dut enzymes, and has no other ways to produce dUMP. We show that, in dut mutant mycobacteria, the dTTP/dCTP balance remained unchanged, but the uracil content of DNA increased in parallel with the in vitro activity-loss of Dut accompanied with a considerable increase in the mutation rate. Conversely, dcd:dut inactivation resulted in perturbed dTTP/dCTP balance and two-fold increased mutation rate, but did not increase the uracil content of DNA. Thus, unexpectedly, the regulation of dNTP balance and the prevention of DNA uracilation are decoupled and separately brought about by the Dcd:dut and Dut enzymes, respectively. Available evidence suggests that the discovered functional separation is conserved in humans and other organisms. Proper control of the intracellular concentration of deoxyribonucleoside-5-triphosphates (dNTPs), the building blocks of DNA, is critically important for efcient and high-fdelity DNA replication and genomic stability1, 2.
    [Show full text]
  • DUT (NM 001948) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221635 DUT (NM_001948) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DUT (NM_001948) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DUT Synonyms: dUTPase Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221635 representing NM_001948 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTGCTCTGAAGAGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCA TGCAGCTCCGCTTTGCCCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGG CTACGACCTGTACAGTGCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATT CAGATAGCGCTCCCTTCTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTA TTGATGTAGGAGCTGGTGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGG CAAAGAAAAGTTTGAAGTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCA GAAATAGAAGAAGTTCAAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGA AT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221635 representing NM_001948 Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag Chromatograms:
    [Show full text]
  • Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA
    INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2327-2334, 2015 Crucial roles of thymidine kinase 1 and deoxyUTPase in incorporating the antineoplastic nucleosides trifluridine and 2'-deoxy-5-fluorouridine into DNA KAzUKI SAKAMoTo, Tatsushi YoKogAwA, HIRoYUKI UENo, KEI ogUcHI, HIRoMI KAzUNo, KEIJI ISHIDA, NozoMU TANAKA, AKIKo oSADA, YUKARI YAMADA, HIRoYUKI oKABE and KENIcHI Matsuo Drug Discovery and Development I, Discovery and Preclinical Research Division, Taiho Pharmaceutical co., Ltd., Tsukuba, Ibaraki 300-2611, Japan Received March 6, 2015; Accepted April 9, 2015 DoI: 10.3892/ijo.2015.2974 Abstract. Trifluridine (FTD) and 2'-deoxy-5-fluorouridine transported into cells by ENT1 and ENT2 and were phosphor- (FdUrd), a derivative of 5-fluorouracil (5-FU), are antitumor ylated by thymidine kinase 1, which showed a higher catalytic agents that inhibit thymidylate synthase activity and their activity for FTD than for FdUrd. deoxyUTPase (DUT) did not nucleotides are incorporated into DNA. However, it is evident recognize dTTP and FTD-triphosphate (F3dTTP), whereas that several differences occur in the underlying antitumor deoxyuridine-triphosphate (dUTP) and FdUrd-triphosphate mechanisms associated with these nucleoside analogues. (FdUTP) were efficiently degraded by DUT. DNA poly- Recently, TAS-102 (composed of FTD and tipiracil hydrochlo- merase α incorporated both F3dTTP and FdUTP into DNA at ride, TPI) was shown to prolong the survival of patients with sites aligned with adenine on the opposite strand. FTD-treated colorectal cancer who received a median of 2 prior therapies, cells showed differing nuclear morphologies compared to including 5-FU. TAS-102 was recently approved for clinical FdUrd-treated cells. These findings indicate that FTD and use in Japan.
    [Show full text]
  • Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization
    electronic reprint Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights Gergely Rona,´ Mary Marfori, Mat´ e´ Borsos, Ildiko´ Scheer, EnikoTak˝ acs,´ Judit Toth,´ Fruzsina Babos, Anna Magyar, Anna Erdei, Zoltan´ Bozoky,´ Laszl´ o´ Buday, Bostjan Kobe and Beata´ G. Vertessy´ Acta Cryst. (2013). D69, 2495–2505 Copyright c International Union of Crystallography Author(s) of this paper may load this reprint on their own web site or institutional repository provided that this cover page is retained. Republication of this article or its storage in electronic databases other than as specified above is not permitted without prior permission in writing from the IUCr. For further information see http://journals.iucr.org/services/authorrights.html Acta Crystallographica Section D: Biological Crystallography welcomes the submission of papers covering any aspect of structural biology, with a particular emphasis on the struc- tures of biological macromolecules and the methods used to determine them. Reports on new protein structures are particularly encouraged, as are structure–function papers that could include crystallographic binding studies, or structural analysis of mutants or other modified forms of a known protein structure. The key criterion is that such papers should present new insights into biology, chemistry or structure. Papers on crystallo- graphic methods should be oriented towards biological crystallography, and may include new approaches to any aspect of structure determination or analysis. Papers on the crys- tallization of biological molecules will be accepted providing that these focus on new methods or other features that are of general importance or applicability.
    [Show full text]
  • Regulation of Human Dutpase Gene Expression and P53-Mediated Transcriptional Repression in Response to Oxaliplatin-Induced DNA Damage Peter M
    78–95 Nucleic Acids Research, 2009, Vol. 37, No. 1 Published online 16 November 2008 doi:10.1093/nar/gkn910 Regulation of human dUTPase gene expression and p53-mediated transcriptional repression in response to oxaliplatin-induced DNA damage Peter M. Wilson1, William Fazzone1, Melissa J. LaBonte1, Heinz-Josef Lenz2 and Robert D. Ladner1,* 1Department of Pathology and 2Division of Medical Oncology, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, CA 90033, USA Received May 19, 2008; Revised October 28, 2008; Accepted October 29, 2008 ABSTRACT INTRODUCTION Deoxyuridine triphosphate nucleotidohydrolase Deoxyuridine triphosphate nucleotidohydrolase (dUT (dUTPase) catalyzes the hydrolysis of dUTP to Pase) is the sole enzyme responsible for the hydrolysis of dUMP and PPi. Although dUTP is a normal intermedi- dUTP to dUMP and pyrophosphate simultaneously pro- ate in DNA synthesis, its accumulation and misincor- viding substrate for thymidylate synthase (TS) and elim- poration into DNA is lethal. Importantly, uracil inating dUTP from the DNA biosynthetic pathway. Although dUTP is a normal intermediate in DNA synth- misincorporation is a mechanism of cytotoxicity esis, its extensive accumulation and misincorporation induced by fluoropyrimidine chemotherapeutic into DNA is lethal in both prokaryotic and eukaryotic agents including 5-fluorouracil (5-FU) and elevated organisms as evidenced from knockout models (1,2). expression of dUTPase is negatively correlated Importantly, uracil misincorporation also represents with clinical response to 5-FU-therapy. In this study a major mechanism of cytotoxicity induced by the we performed the first functional characterization of TS-inhibitor class of chemotherapeutic agents including the dUTPase promoter and demonstrate a role for the fluoropyrimidines 5-fluorouracil (5-FU), fluorodeox- E2F-1 and Sp1 in driving dUTPase expression.
    [Show full text]
  • Targeting Nucleotide Metabolism Enhances the Efficacy of Anthracyclines and Anti-Metabolites in Triple-Negative Breast Cancer
    www.nature.com/npjbcancer ARTICLE OPEN Targeting nucleotide metabolism enhances the efficacy of anthracyclines and anti-metabolites in triple-negative breast cancer Craig Davison1, Roisin Morelli1, Catherine Knowlson1, Melanie McKechnie1, Robbie Carson1, Xanthi Stachtea1, Kylie A. McLaughlin2, Vivien E. Prise2, Kienan Savage 1, Richard H. Wilson3, Karl A. Mulligan2, Peter M. Wilson2, Robert D. Ladner1,5 and ✉ Melissa J. LaBonte 1,4,5 Triple-negative breast cancer (TNBC) remains the most lethal breast cancer subtype with poor response rates to the current chemotherapies and a lack of additional effective treatment options. We have identified deoxyuridine 5′-triphosphate nucleotidohydrolase (dUTPase) as a critical gatekeeper that protects tumour DNA from the genotoxic misincorporation of uracil during treatment with standard chemotherapeutic agents commonly used in the FEC regimen. dUTPase catalyses the hydrolytic dephosphorylation of deoxyuridine triphosphate (dUTP) to deoxyuridine monophosphate (dUMP), providing dUMP for thymidylate synthase as part of the thymidylate biosynthesis pathway and maintaining low intracellular dUTP concentrations. This is crucial as DNA polymerase cannot distinguish between dUTP and deoxythymidylate triphosphate (dTTP), leading to dUTP misincorporation into DNA. Targeting dUTPase and inducing uracil misincorporation during the repair of DNA damage induced by fluoropyrimidines or anthracyclines represents an effective strategy to induce cell lethality. dUTPase inhibition significantly sensitised TNBC cell lines 1234567890():,; to fluoropyrimidines and anthracyclines through imbalanced nucleotide pools and increased DNA damage leading to decreased proliferation and increased cell death. These results suggest that repair of treatment-mediated DNA damage requires dUTPase to prevent uracil misincorporation and that inhibition of dUTPase is a promising strategy to enhance the efficacy of TNBC chemotherapy.
    [Show full text]
  • The Role of a Key Amino Acid Position in Species- Specific Proteinaceous Dutpase Inhibition
    Article The Role of a Key Amino Acid Position in Species- Specific Proteinaceous dUTPase Inhibition András Benedek 1,2,*, Fanni Temesváry-Kis 1, Tamjidmaa Khatanbaatar 1, Ibolya Leveles 1,2, Éva Viola Surányi 1,2, Judit Eszter Szabó 1,2, Lívius Wunderlich 1 and Beáta G. Vértessy 1,2,* 1 Budapest University of Technology and Economics, Department of Applied Biotechnology and Food Science, H -1111 Budapest, Szent Gellért tér 4, Hungary; [email protected] (F.T-K.); [email protected] (T.K.); [email protected] (L.W.) 2 Research Centre for Natural Sciences, Hungarian Academy of Sciences, H-1117 Budapest, Magyar tudósok körútja 2, Hungary; [email protected] (I.L.); [email protected] (É.V.S.); [email protected] (J.E.S.) * Correspondence: [email protected] (A.B.); [email protected] (B.G.V.) Received: 14 May 2019; Accepted: 27 May 2019; Published: 6 June 2019 Abstract: Protein inhibitors of key DNA repair enzymes play an important role in deciphering physiological pathways responsible for genome integrity, and may also be exploited in biomedical research. The staphylococcal repressor StlSaPIbov1 protein was described to be an efficient inhibitor of dUTPase homologues showing a certain degree of species-specificity. In order to provide insight into the inhibition mechanism, in the present study we investigated the interaction of StlSaPIbov1 and Escherichia coli dUTPase. Although we observed a strong interaction of these proteins, unexpectedly the E. coli dUTPase was not inhibited. Seeking a structural explanation for this phenomenon, we identified a key amino acid position where specific mutations sensitized E.
    [Show full text]
  • CRISPR/Cas9-Mediated Knock-Out of Dutpase in Mice Leads to Early Embryonic Lethality
    bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. CRISPR/Cas9-mediated knock-out of dUTPase in mice leads to early embryonic lethality Hajnalka Laura Pálinkás1,2*, Gergely Rácz 1,3, Zoltán Gál4, Orsolya Hoffmann4, Gergely Tihanyi1,3, Elen Gócza4*, László Hiripi4*, Beáta G. Vértessy1,3* *Corresponding authors 1Institute of Enzymology, RCNS, Hungarian Academy of Sciences, Budapest, Hungary 2Doctoral School of Multidisciplinary Medical Science, University of Szeged, Szeged, Hungary 3Department of Applied Biotechnology and Food Sciences, Budapest University of Technology and Economics, Budapest, Hungary 4Department of Animal Biotechnology, Agricultural Biotechnology Institute, National Agricultural Research and Innovation Centre, Gödöllő, Hungary Correspondence and requests for materials should be addressed to Beáta G. Vértessy (email: [email protected]). Correspondence may also be addressed to Hajnalka Laura Pálinkás ([email protected]), Elen Gócza ([email protected]), and László Hiripi ([email protected]). 1 bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Sanitization of nucleotide pools is essential for genome maintenance. Among the enzymes significant in this mechanism, deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) performs cleavage of dUTP into dUMP and inorganic pyrophosphate. By this reaction the enzyme efficiently prevents uracil incorporation into DNA and provides dUMP, the substrate for de novo thymidylate biosynthesis.
    [Show full text]
  • The Relationship Between Dntp Pool Levels and Mutagenesis in an Escherichia Coli NDP Kinase Mutant
    The relationship between dNTP pool levels and mutagenesis in an Escherichia coli NDP kinase mutant Jared Nordman and Andrew Wright* Department of Molecular Biology and Microbiology, Tufts University School of Medicine, 136 Harrison Avenue, Boston, MA 02111 Edited by Jonathan Beckwith, Harvard Medical School, Boston, MA, and approved May 6, 2008 (received for review March 27, 2008) Loss of nucleoside diphosphate kinase (Ndk) function in Escherichia The human genome contains eight Ndk paralogues, Nm23 coli results in an increased frequency of spontaneous mutation and H1–H8, which have been implicated in multiple cellular pro- an imbalance in dNTP pool levels. It is presumed that the imbalance cesses. For example, human NDP kinase (nm23-H1) was initially in dNTP pool levels is responsible for the mutator phenotype of an identified as a suppressor of tumor metastasis by using meta- E. coli ndk mutant. A human homologue of Ndk and potential static melanoma cell lines (17). Nm23-H2 has been shown to suppressor of tumor metastasis, nm23-H2, can complement the cleave DNA in a mechanism similar to that of the AP lyase family mutagenic phenotype of an E. coli ndk mutant. Here, we show that of DNA repair enzymes, and directly regulate expression of the the antimutagenic property of nm23-H2 in E. coli is independent of c-MYC oncogene (18, 19). Mutational loss of NDP kinase dNTP pool levels, indicating that dNTP pool imbalance is not function in Drosophila leads to developmental defects (20). responsible for the mutator phenotype associated with the loss of Interestingly, restoration of NDP kinase enzymatic activity is ndk function.
    [Show full text]
  • Disruption of Nucleocytoplasmic Trafficking As a Cellular Senescence
    www.nature.com/emm ARTICLE OPEN Disruption of nucleocytoplasmic trafficking as a cellular senescence driver Ji-Hwan Park1,14, Sung Jin Ryu2,13,14, Byung Ju Kim3,13,14, Hyun-Ji Cho3, Chi Hyun Park4, Hyo Jei Claudia Choi2, Eun-Jin Jang3, Eun Jae Yang5, Jeong-A Hwang5, Seung-Hwa Woo5, Jun Hyung Lee5, Ji Hwan Park5, Kyung-Mi Choi6, Young-Yon Kwon6, 6 7 3 3 8 9 10 5 ✉ Cheol-Koo Lee , Joon✉ Tae Park , Sung✉ Chun Cho , Yun-Il Lee , Sung✉ Bae Lee , Jeong A. Han , Kyung A. Cho , Min-Sik Kim , Daehee Hwang11 , Young-Sam Lee3,5 and Sang Chul Park3,12 © The Author(s) 2021 Senescent cells exhibit a reduced response to intrinsic and extrinsic stimuli. This diminished reaction may be explained by the disrupted transmission of nuclear signals. However, this hypothesis requires more evidence before it can be accepted as a mechanism of cellular senescence. A proteomic analysis of the cytoplasmic and nuclear fractions obtained from young and senescent cells revealed disruption of nucleocytoplasmic trafficking (NCT) as an essential feature of replicative senescence (RS) at the global level. Blocking NCT either chemically or genetically induced the acquisition of an RS-like senescence phenotype, named nuclear barrier-induced senescence (NBIS). A transcriptome analysis revealed that, among various types of cellular senescence, NBIS exhibited a gene expression pattern most similar to that of RS. Core proteomic and transcriptomic patterns common to both RS and NBIS included upregulation of the endocytosis-lysosome network and downregulation of NCT in senescent cells, patterns also observed in an aging yeast model.
    [Show full text]
  • Uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer
    A Predictive Signature for Oxaliplatin and 5- uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer Qinchuan Wang Zhejiang University https://orcid.org/0000-0002-2370-6714 Xiyong Liu City of Hope National Medical Center Chen Chen Zhejiang University Jida Chen Zhejiang University Beisi Xu Saint Jude Children's Research Hospital Lini Chen Zhejiang University Jichun Zhou Zhejiang University Yasheng Huang Hangzhou Hospital of Traditional Chinese Medicine Wenjun Chen Zhejiang University Rongyue Teng Zhejiang University Wenhe Zhao Zhejiang University Lidan Jin Zhejiang University Jun Shen Zhejiang University Jianguo Shen Zhejiang University Yun Yen ( [email protected] ) Linbo Wang Zhejiang University Page 1/23 Research Keywords: Locally advanced gastric cancer, adjuvant chemotherapy, overall survival, prediction, mutation Posted Date: June 12th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-34678/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/23 Abstract Background: Adjuvantchemotherapy(AC)plays a substantial role in the treatment of locally advanced gastric cancer (LAGC), but the response remains poor. Weaims to improve its ecacy in LAGC. Methods: We identied the expression of eight genes closely associated with platinum and uorouracil metabolism (RRM1, RRM2, RRM2B, POLH, DUT, TYMS, TYMP, MKI67) in the discovery cohort (N=291). And we further validated the ndings in TCGA (N=279) and GEO. Overall survival (OS) was used as an endpoint. Univariate and multivariate Cox models were applied. A multivariate Cox regression model was simulated to predict theOS. Results: In the discovery cohort,the univariate Coxmodelindicated that AC was benecial to high-RRM1, high-DUT, low-RRM2, low-RRM2B, low-POLH, low-KI67, low-TYMS or low-TYMP patients, the results were validated in the TCGA cohort.
    [Show full text]
  • Novel Opportunities for Thymidylate Metabolism As a Therapeutic Target
    3029 Novel opportunities for thymidylate metabolism as a therapeutic target Peter M. Wilson,1 William Fazzone,1 small-molecule inhibitor to dUTPase represents a viable Melissa J. LaBonte,1 Jinxia Deng,2 strategy to improve the clinical efficacy of these mainstay Nouri Neamati,2 and Robert D. Ladner1 chemotherapeutic agents. [Mol Cancer Ther 2008; 7(9):3029–37] 1Department of Pathology, Norris Comprehensive Cancer Center, Keck School of Medicine, and 2Department of Pharmacology and Pharmaceutical Sciences, School of Pharmacy, University of Southern California, Los Angeles, California Introduction The fluoropyrimidine 5-fluorouracil (5-FU) is widely used in the treatment of a range of cancers, including breast Abstract cancers, and cancers of the aerodigestive and gastrointes- For over 40 years, the fluoropyrimidine 5-fluorouracil tinal tract (1). However, 5-FU has had the greatest effect (5-FU) has remained the central agent in therapeutic and is arguably the most successful drug approved to date regimens employed in the treatment of colorectal cancer for the treatment of colorectal cancer. Throughout 50 years and is frequently combined with the DNA-damaging of clinical development, the response rate of advanced agents oxaliplatin and irinotecan, increasing response colorectal cancer chemotherapy using 5-FU and 5-FU-based rates and improving overall survival. However, many combinations has improved from 10% to 15% to 40% to patients will derive little or no benefit from treatment, 50% primarily due to the introduction of efficacious combi- highlighting the need to identify novel therapeutic targets nation partners such as the topoisomerase I inhibitor to improve the efficacy of current 5-FU-based chemother- irinotecan and the platinum agent oxaliplatin and deter- apeutic strategies.
    [Show full text]