DOCSLIB.ORG

Atlas Journal

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Atlas Journal Atlas of Genetics and Cytogenetics in Oncology and Haematology Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Atlas Journal Atlas Journal versus Atlas Database: the accumulation of the issues of the Journal constitutes the body of the Database/Text-Book. TABLE OF CONTENTS Volume 8, Number 2, Apr-Jun 2004 Previous Issue / Next Issue Genes ELKS (12p13.3). Tomoko Nakata, Shiro Minami, Mitsuru Emi. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 136-139. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/ELKSID503.html PAX5 (paired box gene 5) (9p13). Sabine Strehl. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 140-145. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/PAX5ID62.html E2F6 (2p25.1). Matthew Oberley. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 146-152. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/E2F6ID521.html IGF2R (6q25-q27). J Keith Killian. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 153-158. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/IGF2RID380.html RBL2 (retinoblastoma-like 2) (16q12.2). Giuseppe Russo, Antonio Giordano, Pier Paolo Claudio. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 159-163. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/RBL2ID443.html TLX3 (T-cell leukemia, homeobox protein 3) (5q35.1). Roderick AF MacLeod, Stefan Nagel. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 164-170. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2004; 2 I URL : http://AtlasGeneticsOncology.org/Genes/TLX3ID398.html COX6C (cytochrome c oxidase subunit VIc) (8q22.2). Jean-Loup Huret, Sylvie Senon. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 171-174. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/COX6CID251.html NTRK3 (15q25). Stevan Knezevich. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 175-181. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/NTRK3ID433.html PRDM16 (PR domain containing 16) (1p36.3). Jean-Loup Huret, Sylvie Senon. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 182-186. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/PRDM16MEL1ID408.html SNAI2 (SNAIL HOMOLOG 2) (8q11.21). Manuel Sánchez-Martín, Inés González-Herrero, Isidro Sánchez-García.. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 187-192. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Genes/SNAI2ID453.html Leukaemias Castleman's disease. Antonio Cuneo, Gianluigi Castoldi. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 193-196. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/CastlemanID2123.html inv(8)(p11q13). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 197-200. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/inv8p11q13ID1189.html t(7;12)(q36;p13) - updated. Anne RM von Bergh, H Berna Beverloo. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 201-204. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0712ID1177.html t(8;19)(p11;q13). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 205-207. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0819p11q13ID1315.html t(8;9)(p12;q33). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 208-210. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2004; 2 II URL : http://AtlasGeneticsOncology.org/Anomalies/t0809p12q33ID1129.html t(8;22)(p11;q13). Jacques Boyer. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 211-214. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0822p11q13ID1119.html 11q23 rearrangements in childhood acute lymphoblastic leukemia. Susana C Raimondi. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 215-229. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/11q23ChildALLID1321.html t(1;14)(q21;q32) BCL9/IGH; t(1;22)(q21;q11). Jean-Loup Huret. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 230-231. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/t0114q21q32ID1319.html del (13q). Edmond SK Ma, Thomas SK Wan. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 232-238. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/del13qID1310.html NK cell neoplasias. KF Wong. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 239-244. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Anomalies/NKCellNeoplasiaID2125.html Solid Tumours Ovarian tumours: an overview. Lisa Lee-Jones. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 245-255. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/OvarianTumOverviewID5231.html Ovary: Epithelial tumors. Lisa Lee-Jones. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 256-302. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/OvaryEpithTumID5230.html Lung: Non-small cell carcinoma. Jim Heighway, Daniel C Betticher. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 303-309. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Tumors/LungNonSmallCellID5141.html Lung tumors: an overview. Jim Heighway, Daniel C Betticher. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 310-315. [Full Text] [PDF] Atlas Genet Cytogenet Oncol Haematol 2004; 2 III URL : http://AtlasGeneticsOncology.org/Tumors/LungTumOverviewID5030.html Cancer Prone Diseases Deep Insights The vagaries of non-traditional mendelian recessive inheritance in uniparental disomy: AA x Aa = aa !. Eric Engel. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 316-328. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Deep/UniparentDisomyID20046.html Transcription factors. Valentina Guasconi, Hakima Yahi, Slimane Ait-Si-Ali. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 329-333. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Deep/TranscripFactorsID20043.html Case Reports Educational Items Microdeletions and Molecular Genetics. Annick Vogels, Jean-Pierre Fryns. Atlas Genet Cytogenet Oncol Haematol 2004; 8 (2): 334-366. [Full Text] [PDF] URL : http://AtlasGeneticsOncology.org/Educ/MicrodeletionID30059ES.html © Atlas of Genetics and Cytogenetics in Oncology and Haematology X Y 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 NA Home Genes Leukemias Solid Tumours Cancer-Prone Deep Insight Portal Teaching For comments and suggestions or contributions, please contact us [email protected]. Atlas Genet Cytogenet Oncol Haematol 2004; 2 IV Atlas of Genetics and Cytogenetics in Oncology and Haematology ELKS Identity Other rab6-interacting protein 2, ERC1 names Location 12p13.3 DNA/RNA Description at least 21 exons. 500 Kb Transcription 9.0 Kb and other smaller mRNAs ; alternative splicing: at least 5 isoforms (a, b, g, d, e) Protein Description a : 948 amino acids, b: 992 amino acids, g: 720 amino acids, d:1088 amino acids, e:1116 amino acids, containing eight to ten coiled-coil domains. Rich in glutamic acid (E), leucine (L), lysine (K) and serine (S). Mouse homolog of ELKS a subtype binds to RIM (Rab3-interacting molecule) which is presynaptic active zone protein and regulates neurotransmitter release. Mouse homologs of ELKS bind to rab6 which regulate intracellular transport. Expression Ubiquitous, a and b are abundant in the brain. d and e predominate in the testis, thyroid and other tissues. Function unknown Homology CAST or ERC2 Implicated in Disease papillary thyroid carcinoma Hybrid/Mutated 5' ELKS-3' RET in the t(10;12)(q11;p13) Gene Abnormal ELKS-RET Protein Oncogenesis constitutive activation of RET Breakpoints Note Intron 10 of ELKS and intron 11 of the RET. External links Atlas Genet Cytogenet Oncol Haematol 2004; 2 -136- Nomenclature GDB RAB6IP2 Entrez_Gene RAB6IP2 23085 RAB6 interacting protein 2 Cards Atlas ELKSID503 GeneCards RAB6IP2 Ensembl RAB6IP2 CancerGene ELKS Genatlas RAB6IP2 GeneLynx RAB6IP2 eGenome RAB6IP2 euGene 23085 Genomic and cartography RAB6IP2 - 12p13.3 chr12:970665-1472958 + 12p13.33 (hg17- GoldenPath May_2004) Ensembl RAB6IP2 - 12p13.33 [CytoView] NCBI Genes Cyto Gene Seq [Map View - NCBI] OMIM Disease map [OMIM] HomoloGene RAB6IP2 Gene and transcription Genbank X58046 [ SRS ] X58046 [ ENTREZ ] Genbank AB015617 [ SRS ] AB015617 [ ENTREZ ] Genbank AB029004 [ SRS ] AB029004 [ ENTREZ ] Genbank AB053468 [ SRS ] AB053468 [ ENTREZ ] Genbank AB053469 [ SRS ] AB053469 [ ENTREZ ] RefSeq NM_015064 [ SRS ] NM_015064 [ ENTREZ ] RefSeq NM_178037 [ SRS ] NM_178037 [ ENTREZ ] RefSeq NM_178038 [ SRS ] NM_178038 [ ENTREZ ] RefSeq NM_178039 [ SRS ] NM_178039 [ ENTREZ ] RefSeq NM_178040 [ SRS ] NM_178040 [ ENTREZ ] RefSeq NT_086791 [ SRS ] NT_086791 [ ENTREZ ] AceView RAB6IP2 AceView - NCBI TRASER RAB6IP2 Traser - Stanford Unigene Hs.400431 [ SRS ] Hs.400431 [ NCBI ] HS400431 [ spliceNest ] Protein : pattern, domain, 3D structure Polymorphism : SNP, mutations, diseases OMIM 607127 [ map ] GENECLINICS 607127 Atlas Genet Cytogenet Oncol Haematol 2004; 2 -137- SNP RAB6IP2 [dbSNP-NCBI] SNP NM_015064 [SNP-NCI] SNP NM_178037 [SNP-NCI] SNP NM_178038 [SNP-NCI] SNP NM_178039 [SNP-NCI] SNP NM_178040 [SNP-NCI] SNP RAB6IP2 [GeneSNPs - Utah] RAB6IP2 [SNP - CSHL] RAB6IP2] [HGBASE - SRS] General knowledge Family RAB6IP2 [UCSC Family Browser] Browser SOURCE NM_015064 SOURCE NM_178037 SOURCE NM_178038 SOURCE NM_178039 SOURCE NM_178040 SMD Hs.400431 SAGE Hs.400431 Amigo process|protein transport PubGene RAB6IP2 Other databases Probes PubMed PubMed 11 Pubmed reference(s) in LocusLink Bibliography Ret/PTC3 is the most frequent form of gene rearrangement in papillary thyroid
Load more

Recommended publications
  • Supplemental Information
    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
    [Show full text]
  • Mitoxplorer, a Visual Data Mining Platform To
    mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dynamics and mutations Annie Yim, Prasanna Koti, Adrien Bonnard, Fabio Marchiano, Milena Dürrbaum, Cecilia Garcia-Perez, José Villaveces, Salma Gamal, Giovanni Cardone, Fabiana Perocchi, et al. To cite this version: Annie Yim, Prasanna Koti, Adrien Bonnard, Fabio Marchiano, Milena Dürrbaum, et al.. mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dy- namics and mutations. Nucleic Acids Research, Oxford University Press, 2020, 10.1093/nar/gkz1128. hal-02394433 HAL Id: hal-02394433 https://hal-amu.archives-ouvertes.fr/hal-02394433 Submitted on 4 Dec 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License Nucleic Acids Research, 2019 1 doi: 10.1093/nar/gkz1128 Downloaded from https://academic.oup.com/nar/advance-article-abstract/doi/10.1093/nar/gkz1128/5651332 by Bibliothèque de l'université la Méditerranée user on 04 December 2019 mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dynamics and mutations Annie Yim1,†, Prasanna Koti1,†, Adrien Bonnard2, Fabio Marchiano3, Milena Durrbaum¨ 1, Cecilia Garcia-Perez4, Jose Villaveces1, Salma Gamal1, Giovanni Cardone1, Fabiana Perocchi4, Zuzana Storchova1,5 and Bianca H.
    [Show full text]
  • Mouse Cox6c Conditional Knockout Project (CRISPR/Cas9)
    https://www.alphaknockout.com Mouse Cox6c Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Cox6c conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Cox6c gene (NCBI Reference Sequence: NM_053071 ; Ensembl: ENSMUSG00000014313 ) is located on Mouse chromosome 15. 4 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 3 (Transcript: ENSMUST00000014457). Exon 2 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Cox6c gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-97E5 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2 starts from about 100% of the coding region. The knockout of Exon 2 will result in frameshift of the gene. The size of intron 1 for 5'-loxP site insertion: 840 bp, and the size of intron 2 for 3'-loxP site insertion: 1741 bp. The size of effective cKO region: ~617 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 2 3 4 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Homology arm Exon of mouse Cox6c cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats.
    [Show full text]
  • Role of Cytochrome C Oxidase Nuclear-Encoded Subunits in Health and Disease
    Physiol. Res. 69: 947-965, 2020 https://doi.org/10.33549/physiolres.934446 REVIEW Role of Cytochrome c Oxidase Nuclear-Encoded Subunits in Health and Disease Kristýna ČUNÁTOVÁ1, David PAJUELO REGUERA1, Josef HOUŠTĚK1, Tomáš MRÁČEK1, Petr PECINA1 1Department of Bioenergetics, Institute of Physiology, Czech Academy of Sciences, Prague, Czech Republic Received February 2, 2020 Accepted September 13, 2020 Epub Ahead of Print November 2, 2020 Summary [email protected] and Tomáš Mráček, Department of Cytochrome c oxidase (COX), the terminal enzyme of Bioenergetics, Institute of Physiology CAS, Vídeňská 1083, 142 mitochondrial electron transport chain, couples electron transport 20 Prague 4, Czech Republic. E-mail: [email protected] to oxygen with generation of proton gradient indispensable for the production of vast majority of ATP molecules in mammalian Cytochrome c oxidase cells. The review summarizes current knowledge of COX structure and function of nuclear-encoded COX subunits, which may Energy demands of mammalian cells are mainly modulate enzyme activity according to various conditions. covered by ATP synthesis carried out by oxidative Moreover, some nuclear-encoded subunits possess tissue-specific phosphorylation apparatus (OXPHOS) located in the and development-specific isoforms, possibly enabling fine-tuning central bioenergetic organelle, mitochondria. OXPHOS is of COX function in individual tissues. The importance of nuclear- composed of five multi-subunit complexes embedded in encoded subunits is emphasized by recently discovered the inner mitochondrial membrane (IMM). Electron pathogenic mutations in patients with severe mitopathies. In transport from reduced substrates of complexes I and II to addition, proteins substoichiometrically associated with COX were cytochrome c oxidase (COX, complex IV, CIV) is found to contribute to COX activity regulation and stabilization of achieved by increasing redox potential of individual the respiratory supercomplexes.
    [Show full text]
  • Expression Profiling of Substantia Nigra in Parkinson Disease, Progressive Supranuclear Palsy, and Frontotemporal Dementia with Parkinsonism
    ORIGINAL CONTRIBUTION Expression Profiling of Substantia Nigra in Parkinson Disease, Progressive Supranuclear Palsy, and Frontotemporal Dementia With Parkinsonism Michael A. Hauser, PhD; Yi-Ju Li, PhD; Hong Xu, MA; Maher A. Noureddine, PhD; Yujun S. Shao, PhD; Steven R. Gullans, PhD; Clemens R. Scherzer, MD; Roderick V. Jensen, PhD; Adam C. McLaurin, BA; Jason R. Gibson, BA; Burton L. Scott, MD; Rita M. Jewett, RN; Judith E. Stenger, PhD; Donald E. Schmechel, MD; Christine M. Hulette, MD, PhD; Jeffery M. Vance, MD, PhD Background: Parkinson disease (PD) is characterized Results: There were 142 genes that were significantly by loss of dopaminergic neurons in the substantia nigra. differentially expressed between PD cases and controls Genes contributing to rare mendelian forms of PD have and 96 genes that were significantly differentially ex- been identified, but the genes involved in the more com- pressed between the combined progressive supra- mon idiopathic PD are not well understood. nuclear palsy and frontotemporal dementia with parkin- sonism cases and controls. The 12 genes common to all Objectives: To identify genes important to PD patho- 3 disorders may be related to secondary effects. Hierar- genesis using microarrays and to investigate their poten- chical cluster analysis after exclusion of these 12 genes tial to aid in diagnosing parkinsonism. differentiated 4 of the 6 PD cases from progressive su- pranuclear palsy and frontotemporal dementia with par- Design: Microarray expression analysis of postmortem kinsonism. substantia nigra tissue. Conclusions: Four main molecular pathways are al- Patients: Substantia nigra samples from 14 unrelated tered in PD substantia nigra: chaperones, ubiquitina- individuals were analyzed, including 6 with PD, 2 with tion, vesicle trafficking, and nuclear-encoded mitochon- progressive supranuclear palsy, 1 with frontotemporal de- drial genes.
    [Show full text]
  • Unifying the Genomics-Based Classes of Cancer Fusion Gene Partners: Large Cancer Fusion Genes Are Evolutionarily Conserved
    CANCER GENOMICS & PROTEOMICS 9: 389-396 (2012) Unifying the Genomics-based Classes of Cancer Fusion Gene Partners: Large Cancer Fusion Genes Are Evolutionarily Conserved LIBIA M. PAVA, DANIEL T. MORTON, REN CHEN and GEORGE BLANCK Department of Molecular Medicine, Morsani College of Medicine, University of South Florida, Tampa, FL, U.S.A. Abstract. Background: Genes that fuse to cause cancer have fusion of NPM and ALK in anaplastic large-cell lymphoma been studied to determine molecular bases for proliferation, to (3); ABL and BCR in chronic myelogenous leukemia (CML) develop diagnostic tools, and as targets for drugs. To facilitate (4, 5); and C-MYC and IgH in Burkitt’s lymphoma in (6), identification of additional, cancer fusion genes, following among many others. The detection and understanding of the observation of a chromosomal translocation, we have ABL-BCR fusion protein, which stimulates unregulated cell characterized the genomic features of the fusion gene partners. division and leads to leukemia, led to the development of Previous work indicated that cancer fusion gene partners, are Gleevec, a drug able to block the ATP-binding site of the either large or evolutionarily conserved in comparison to the tyrosine kinase domain of ABL-BCR, halting CML (7). This neighboring genes in the region of a chromosomal extraordinary success has led to the hope of designing drugs translocation. These results raised the question of whether targeted against other cancer fusion proteins. large cancer fusion gene partners were also evolutionarily There are about 50,000 unstudied translocations, raising conserved. Methods and Results: We developed two methods the question of whether that information can continue to be for quantifying evolutionary conservation values, allowing the used to facilitate the identification of fusion genes.
    [Show full text]
  • Cytochrome C Oxidase Subunit Vic (COX6C) (NM 004374) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP300374 Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C) Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 8.6 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_004365 Locus ID: 1345 UniProt ID: P09669, A0A024R9B7 RefSeq Size: 921 Cytogenetics: 8q22.2 RefSeq ORF: 225 Summary: Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells.
    [Show full text]
  • Functions of Cytochrome C Oxidase Assembly Factors
    International Journal of Molecular Sciences Review Functions of Cytochrome c Oxidase Assembly Factors Shane A. Watson and Gavin P. McStay * Department of Biological Sciences, Faculty of School of Life Sciences and Education, Staffordshire University, Science Centre, Leek Road, Stoke-on-Trent ST4 2DF, UK; [email protected]ffs.ac.uk * Correspondence: gavin.mcstay@staffs.ac.uk; Tel.: +44-01782-295741 Received: 17 September 2020; Accepted: 23 September 2020; Published: 30 September 2020 Abstract: Cytochrome c oxidase is the terminal complex of eukaryotic oxidative phosphorylation in mitochondria. This process couples the reduction of electron carriers during metabolism to the reduction of molecular oxygen to water and translocation of protons from the internal mitochondrial matrix to the inter-membrane space. The electrochemical gradient formed is used to generate chemical energy in the form of adenosine triphosphate to power vital cellular processes. Cytochrome c oxidase and most oxidative phosphorylation complexes are the product of the nuclear and mitochondrial genomes. This poses a series of topological and temporal steps that must be completed to ensure efficient assembly of the functional enzyme. Many assembly factors have evolved to perform these steps for insertion of protein into the inner mitochondrial membrane, maturation of the polypeptide, incorporation of co-factors and prosthetic groups and to regulate this process. Much of the information about each of these assembly factors has been gleaned from use of the single cell eukaryote Saccharomyces cerevisiae and also mutations responsible for human disease. This review will focus on the assembly factors of cytochrome c oxidase to highlight some of the outstanding questions in the assembly of this vital enzyme complex.
    [Show full text]
  • (COX6C) (NM 004374) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC200374 Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Tagged ORF Clone Tag: Myc-DDK Symbol: COX6C Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC200374 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCCCGAAGTTTTGCCAAAACCTCGGATGCGTGGCCTTCTGGCCAGGCGTCTGCGAAATCATATGG CTGTAGCATTCGTGCTATCCCTGGGGGTTGCAGCTTTGTATAAGTTTCGTGTGGCTGATCAAAGAAAGAA GGCATACGCAGATTTCTACAGAAACTACGATGTCATGAAAGATTTTGAGGAGATGAGGAAGGCTGGTATC TTTCAGAGTGTAAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC200374 protein sequence Red=Cloning site Green=Tags(s) MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI FQSVK myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6388_f07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 Cytochrome C Oxidase subunit
    [Show full text]
  • Constitutional Trisomy 8 Mosaicism As a Model for Epigenetic Studies of Aneuploidy Davidsson Et Al
    Constitutional trisomy 8 mosaicism as a model for epigenetic studies of aneuploidy Davidsson et al. Davidsson et al. Epigenetics & Chromatin 2013, 6:18 http://www.epigeneticsandchromatin.com/content/6/1/18 Davidsson et al. Epigenetics & Chromatin 2013, 6:18 http://www.epigeneticsandchromatin.com/content/6/1/18 RESEARCH Open Access Constitutional trisomy 8 mosaicism as a model for epigenetic studies of aneuploidy Josef Davidsson1*, Srinivas Veerla2 and Bertil Johansson1,3 Abstract Background: To investigate epigenetic patterns associated with aneuploidy we used constitutional trisomy 8 mosaicism (CT8M) as a model, enabling analyses of single cell clones, harboring either trisomy or disomy 8, from the same patient; this circumvents any bias introduced by using cells from unrelated, healthy individuals as controls. We profiled gene and miRNA expression as well as genome-wide and promoter specific DNA methylation and hydroxymethylation patterns in trisomic and disomic fibroblasts, using microarrays and methylated DNA immunoprecipitation. Results: Trisomy 8-positive fibroblasts displayed a characteristic expression and methylation phenotype distinct from disomic fibroblasts, with the majority (65%) of chromosome 8 genes in the trisomic cells being overexpressed. However, 69% of all deregulated genes and non-coding RNAs were not located on this chromosome. Pathway analysis of the deregulated genes revealed that cancer, genetic disorder, and hematopoiesis were top ranked. The trisomy 8-positive cells displayed depletion of 5-hydroxymethylcytosine and global hypomethylation of gene-poor regions on chromosome 8, thus partly mimicking the inactivated X chromosome in females. Conclusions: Trisomy 8 affects genes situated also on other chromosomes which, in cooperation with the observed chromosome 8 gene dosage effect, has an impact on the clinical features of CT8M, as demonstrated by the pathway analysis revealing key features that might explain the increased incidence of hematologic malignancies in CT8M patients.
    [Show full text]
  • Wasin Vol. 9 N. 4 2558.Pmd
    Asian Biomedicine Vol. 9 No. 4 August 2015; 455 - 471 DOI: 10.5372/1905-7415.0904.415 Original article Antiaging phenotype in skeletal muscle after endurance exercise is associated with the oxidative phosphorylation pathway Wasin Laohavinija, Apiwat Mutirangurab,c aFaculty of Medicine, Chulalongkorn University, Bangkok 10330, Thailand bDepartment of Anatomy, Faculty of Medicine, Chulalongkorn University, Bangkok 10330, Thailand cCenter of Excellence in Molecular Genetics of Cancer and Human Diseases, Chulalongkorn University, Bangkok 10330, Thailand Background: Performing regular exercise may be beneficial to delay aging. During aging, numerous biochemical and molecular changes occur in cells, including increased DNA instability, epigenetic alterations, cell-signaling disruptions, decreased protein synthesis, reduced adenosine triphosphate (ATP) production capacity, and diminished oxidative phosphorylation. Objectives: To identify the types of exercise and the molecular mechanisms associated with antiaging phenotypes by comparing the profiles of gene expression in skeletal muscle after various types of exercise and aging. Methods: We used bioinformatics data from skeletal muscles reported in the Gene Expression Omnibus repository and used Connection Up- and Down-Regulation Expression Analysis of Microarrays to identify genes significant in antiaging. The significant genes were mapped to molecular pathways and reviewed for their molecular functions, and their associations with molecular and cellular phenotypes using the Database for Annotation,
    [Show full text]
  • AF0762-COX6C Antibody
    Affinity Biosciences website:www.affbiotech.com order:[email protected] COX6C Antibody Cat.#: AF0762 Concn.: 1mg/ml Mol.Wt.: 32kDa Size: 100ul,200ul Source: Rabbit Clonality: Polyclonal Application: WB 1:500-1:2000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000 *The optimal dilutions should be determined by the end user. Reactivity: Human,Mouse,Rat Purification: The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific). Specificity: COX6C Antibody detects endogenous levels of total COX6C. Immunogen: A synthesized peptide derived from human COX6C, corresponding to a region within the internal amino acids. Uniprot: P09669 Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially- encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12. Storage Condition and Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM Buffer: NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt. Western blot analysis on HuvEc cell lysates using COX6C Antibody,The lane on the left was treated with the antigen- specific peptide.
    [Show full text]