DOCSLIB.ORG

Mouse Cox6c Conditional Knockout Project (CRISPR/Cas9)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Mouse Cox6c Conditional Knockout Project (CRISPR/Cas9) https://www.alphaknockout.com Mouse Cox6c Conditional Knockout Project (CRISPR/Cas9) Objective: To create a Cox6c conditional knockout Mouse model (C57BL/6J) by CRISPR/Cas-mediated genome engineering. Strategy summary: The Cox6c gene (NCBI Reference Sequence: NM_053071 ; Ensembl: ENSMUSG00000014313 ) is located on Mouse chromosome 15. 4 exons are identified, with the ATG start codon in exon 2 and the TGA stop codon in exon 3 (Transcript: ENSMUST00000014457). Exon 2 will be selected as conditional knockout region (cKO region). Deletion of this region should result in the loss of function of the Mouse Cox6c gene. To engineer the targeting vector, homologous arms and cKO region will be generated by PCR using BAC clone RP23-97E5 as template. Cas9, gRNA and targeting vector will be co-injected into fertilized eggs for cKO Mouse production. The pups will be genotyped by PCR followed by sequencing analysis. Note: Exon 2 starts from about 100% of the coding region. The knockout of Exon 2 will result in frameshift of the gene. The size of intron 1 for 5'-loxP site insertion: 840 bp, and the size of intron 2 for 3'-loxP site insertion: 1741 bp. The size of effective cKO region: ~617 bp. The cKO region does not have any other known gene. Page 1 of 8 https://www.alphaknockout.com Overview of the Targeting Strategy Wildtype allele gRNA region 5' gRNA region 3' 1 2 3 4 Targeting vector Targeted allele Constitutive KO allele (After Cre recombination) Legends Homology arm Exon of mouse Cox6c cKO region loxP site Page 2 of 8 https://www.alphaknockout.com Overview of the Dot Plot Window size: 10 bp Forward Reverse Complement Sequence 12 Note: The sequence of homologous arms and cKO region is aligned with itself to determine if there are tandem repeats. No significant tandem repeat is found in the dot plot matrix. So this region is suitable for PCR screening or sequencing analysis. Overview of the GC Content Distribution Window size: 300 bp Sequence 12 Summary: Full Length(7117bp) | A(23.94% 1704) | C(22.03% 1568) | T(31.56% 2246) | G(22.47% 1599) Note: The sequence of homologous arms and cKO region is analyzed to determine the GC content. Significant high GC-content regions are found. It may be difficult to construct this targeting vector. Page 3 of 8 https://www.alphaknockout.com BLAT Search Results (up) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr15 - 35937522 35940521 3000 browser details YourSeq 322 215 772 3000 90.9% chr10 - 3333984 3660651 326668 browser details YourSeq 280 168 624 3000 90.2% chr5 - 107648421 108033572 385152 browser details YourSeq 280 313 770 3000 88.3% chr11 + 22350609 22351099 491 browser details YourSeq 274 315 772 3000 89.0% chr3 - 132952417 132952883 467 browser details YourSeq 272 321 775 3000 87.2% chr11 - 62754681 62755164 484 browser details YourSeq 268 307 790 3000 90.9% chr5 + 103157032 103157547 516 browser details YourSeq 259 317 758 3000 88.8% chr4 - 48820969 48821431 463 browser details YourSeq 257 307 772 3000 86.7% chr17 + 69317070 69317590 521 browser details YourSeq 254 318 769 3000 89.0% chr17 - 75773809 75774336 528 browser details YourSeq 253 315 772 3000 86.2% chr2 + 51942778 51943234 457 browser details YourSeq 248 305 772 3000 84.9% chr19 + 6611796 6612240 445 browser details YourSeq 248 315 757 3000 89.5% chr18 + 84895558 84896019 462 browser details YourSeq 247 307 776 3000 84.6% chr6 - 72057513 72057966 454 browser details YourSeq 242 307 772 3000 84.2% chr9 + 48959794 48960215 422 browser details YourSeq 241 315 775 3000 85.1% chr17 + 49341725 49342170 446 browser details YourSeq 239 301 772 3000 82.5% chrX - 150474544 150475000 457 browser details YourSeq 236 307 749 3000 88.4% chr8 - 45158251 45158720 470 browser details YourSeq 236 315 699 3000 89.1% chr6 + 55574717 55575131 415 browser details YourSeq 229 295 772 3000 89.7% chr14 + 37331092 37331647 556 Note: The 3000 bp section upstream of Exon 2 is BLAT searched against the genome. No significant similarity is found. BLAT Search Results (down) QUERY SCORE START END QSIZE IDENTITY CHROM STRAND START END SPAN ----------------------------------------------------------------------------------------------- browser details YourSeq 3000 1 3000 3000 100.0% chr15 - 35933905 35936904 3000 browser details YourSeq 314 1981 2593 3000 90.6% chr17 + 65240191 65240744 554 browser details YourSeq 266 1982 2593 3000 90.9% chr1 + 95506959 95507771 813 browser details YourSeq 265 1980 2323 3000 92.7% chr13 - 60555359 60555719 361 browser details YourSeq 261 1982 2328 3000 91.5% chr5 - 9522110 9522473 364 browser details YourSeq 255 1982 2300 3000 93.6% chr17 + 47012867 47013201 335 browser details YourSeq 255 1982 2300 3000 93.6% chr15 + 91781926 91782260 335 browser details YourSeq 254 1981 2291 3000 94.5% chr13 - 67116017 67116357 341 browser details YourSeq 254 1982 2303 3000 92.6% chr13 + 67734604 67734934 331 browser details YourSeq 252 1988 2302 3000 93.5% chr11 + 47737798 47738127 330 browser details YourSeq 251 1982 2303 3000 92.0% chrX + 53980814 53981151 338 browser details YourSeq 250 1982 2322 3000 88.9% chr7 - 53937982 53938335 354 browser details YourSeq 248 1982 2305 3000 92.5% chr16 - 36110720 36111050 331 browser details YourSeq 247 1981 2303 3000 92.2% chr3 - 48530961 48531287 327 browser details YourSeq 247 1980 2314 3000 90.8% chr10 - 23256416 23256772 357 browser details YourSeq 246 1981 2291 3000 92.5% chr7 - 104013346 104013666 321 browser details YourSeq 245 1982 2303 3000 92.5% chr5 - 110075441 110075997 557 browser details YourSeq 245 1981 2305 3000 93.6% chr17 - 92428690 92429021 332 browser details YourSeq 243 1980 2580 3000 89.2% chr3 - 62589692 62590267 576 browser details YourSeq 240 1982 2323 3000 89.3% chr17 - 61917010 61917368 359 Note: The 3000 bp section downstream of Exon 2 is BLAT searched against the genome. No significant similarity is found. Page 4 of 8 https://www.alphaknockout.com Gene and protein information: Cox6c cytochrome c oxidase subunit 6C [ Mus musculus (house mouse) ] Gene ID: 12864, updated on 12-Aug-2019 Gene summary Official Symbol Cox6c provided by MGI Official Full Name cytochrome c oxidase subunit 6C provided by MGI Primary source MGI:MGI:104614 See related Ensembl:ENSMUSG00000014313 Gene type protein coding RefSeq status VALIDATED Organism Mus musculus Lineage Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae; Murinae; Mus; Mus Expression Ubiquitous expression in heart adult (RPKM 387.4), bladder adult (RPKM 339.2) and 28 other tissues See more Orthologs human all Genomic context Location: 15; 15 B3.1 See Cox6c in Genome Data Viewer Exon count: 4 Annotation release Status Assembly Chr Location 108 current GRCm38.p6 (GCF_000001635.26) 15 NC_000081.6 (35931976..35938246, complement) Build 37.2 previous assembly MGSCv37 (GCF_000001635.18) 15 NC_000081.5 (35861731..35868001, complement) Chromosome 15 - NC_000081.6 Page 5 of 8 https://www.alphaknockout.com Transcript information: This gene has 6 transcripts Gene: Cox6c ENSMUSG00000014313 Description cytochrome c oxidase subunit 6C [Source:MGI Symbol;Acc:MGI:104614] Location Chromosome 15: 35,925,886-35,938,246 reverse strand. GRCm38:CM001008.2 About this gene This gene has 6 transcripts (splice variants), 89 orthologues and is a member of 1 Ensembl protein family. Transcripts Name Transcript ID bp Protein Translation ID Biotype CCDS UniProt Flags Cox6c- ENSMUST00000153512.1 738 76aa ENSMUSP00000123609.1 Protein coding CCDS27424 Q9CPQ1 TSL:2 203 GENCODE basic APPRIS P1 Cox6c- ENSMUST00000156915.2 606 76aa ENSMUSP00000122391.2 Protein coding CCDS27424 Q9CPQ1 TSL:5 205 GENCODE basic APPRIS P1 Cox6c- ENSMUST00000014457.14 503 76aa ENSMUSP00000014457.8 Protein coding CCDS27424 Q9CPQ1 TSL:1 201 GENCODE basic APPRIS P1 Cox6c- ENSMUST00000155638.7 648 10aa ENSMUSP00000121106.1 Nonsense mediated - A0A0G2JDA6 CDS 5' 204 decay incomplete TSL:3 Cox6c- ENSMUST00000127999.1 3038 No - Retained intron - - TSL:1 202 protein Cox6c- ENSMUST00000227231.1 260 No - lncRNA - - - 206 protein Page 6 of 8 https://www.alphaknockout.com 32.36 kb Forward strand 35.92Mb 35.93Mb 35.94Mb Genes Vps13b-201 >protein coding (Comprehensive set... Contigs < AC157521.2 Genes (Comprehensive set... < Cox6c-204nonsense mediated decay < Cox6c-206lncRNA < Cox6c-201protein coding < Cox6c-203protein coding < Cox6c-202retained intron < Cox6c-205protein coding Regulatory Build 35.92Mb 35.93Mb 35.94Mb Reverse strand 32.36 kb Regulation Legend CTCF Enhancer Promoter Promoter Flank Transcription Factor Binding Site Gene Legend Protein Coding Ensembl protein coding merged Ensembl/Havana Non-Protein Coding RNA gene processed transcript Page 7 of 8 https://www.alphaknockout.com Transcript: ENSMUST00000014457 < Cox6c-201protein coding Reverse strand 6.27 kb ENSMUSP00000014... Transmembrane heli... Superfamily Mitochondrial cytochrome c oxidase subunit VIc/VIIs superfamily Pfam Mitochondrial cytochrome c oxidase subunit VIc/VIIs PANTHER PTHR12916:SF0 PTHR12916 Gene3D Mitochondrial cytochrome c oxidase subunit VIc/VIIs superfamily CDD Cytochrome c oxidase subunit 6C All sequence SNPs/i... Sequence variants (dbSNP and all other sources) S Variant Legend synonymous variant Scale bar 0 8 16 24 32 40 48 56 64 76 We wish to acknowledge the following valuable scientific information resources: Ensembl, MGI, NCBI, UCSC. Page 8 of 8.
Load more

Recommended publications
  • Supplemental Information
    Supplemental information Dissection of the genomic structure of the miR-183/96/182 gene. Previously, we showed that the miR-183/96/182 cluster is an intergenic miRNA cluster, located in a ~60-kb interval between the genes encoding nuclear respiratory factor-1 (Nrf1) and ubiquitin-conjugating enzyme E2H (Ube2h) on mouse chr6qA3.3 (1). To start to uncover the genomic structure of the miR- 183/96/182 gene, we first studied genomic features around miR-183/96/182 in the UCSC genome browser (http://genome.UCSC.edu/), and identified two CpG islands 3.4-6.5 kb 5’ of pre-miR-183, the most 5’ miRNA of the cluster (Fig. 1A; Fig. S1 and Seq. S1). A cDNA clone, AK044220, located at 3.2-4.6 kb 5’ to pre-miR-183, encompasses the second CpG island (Fig. 1A; Fig. S1). We hypothesized that this cDNA clone was derived from 5’ exon(s) of the primary transcript of the miR-183/96/182 gene, as CpG islands are often associated with promoters (2). Supporting this hypothesis, multiple expressed sequences detected by gene-trap clones, including clone D016D06 (3, 4), were co-localized with the cDNA clone AK044220 (Fig. 1A; Fig. S1). Clone D016D06, deposited by the German GeneTrap Consortium (GGTC) (http://tikus.gsf.de) (3, 4), was derived from insertion of a retroviral construct, rFlpROSAβgeo in 129S2 ES cells (Fig. 1A and C). The rFlpROSAβgeo construct carries a promoterless reporter gene, the β−geo cassette - an in-frame fusion of the β-galactosidase and neomycin resistance (Neor) gene (5), with a splicing acceptor (SA) immediately upstream, and a polyA signal downstream of the β−geo cassette (Fig.
    [Show full text]
  • Mitoxplorer, a Visual Data Mining Platform To
    mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dynamics and mutations Annie Yim, Prasanna Koti, Adrien Bonnard, Fabio Marchiano, Milena Dürrbaum, Cecilia Garcia-Perez, José Villaveces, Salma Gamal, Giovanni Cardone, Fabiana Perocchi, et al. To cite this version: Annie Yim, Prasanna Koti, Adrien Bonnard, Fabio Marchiano, Milena Dürrbaum, et al.. mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dy- namics and mutations. Nucleic Acids Research, Oxford University Press, 2020, 10.1093/nar/gkz1128. hal-02394433 HAL Id: hal-02394433 https://hal-amu.archives-ouvertes.fr/hal-02394433 Submitted on 4 Dec 2019 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Distributed under a Creative Commons Attribution| 4.0 International License Nucleic Acids Research, 2019 1 doi: 10.1093/nar/gkz1128 Downloaded from https://academic.oup.com/nar/advance-article-abstract/doi/10.1093/nar/gkz1128/5651332 by Bibliothèque de l'université la Méditerranée user on 04 December 2019 mitoXplorer, a visual data mining platform to systematically analyze and visualize mitochondrial expression dynamics and mutations Annie Yim1,†, Prasanna Koti1,†, Adrien Bonnard2, Fabio Marchiano3, Milena Durrbaum¨ 1, Cecilia Garcia-Perez4, Jose Villaveces1, Salma Gamal1, Giovanni Cardone1, Fabiana Perocchi4, Zuzana Storchova1,5 and Bianca H.
    [Show full text]
  • Role of Cytochrome C Oxidase Nuclear-Encoded Subunits in Health and Disease
    Physiol. Res. 69: 947-965, 2020 https://doi.org/10.33549/physiolres.934446 REVIEW Role of Cytochrome c Oxidase Nuclear-Encoded Subunits in Health and Disease Kristýna ČUNÁTOVÁ1, David PAJUELO REGUERA1, Josef HOUŠTĚK1, Tomáš MRÁČEK1, Petr PECINA1 1Department of Bioenergetics, Institute of Physiology, Czech Academy of Sciences, Prague, Czech Republic Received February 2, 2020 Accepted September 13, 2020 Epub Ahead of Print November 2, 2020 Summary [email protected] and Tomáš Mráček, Department of Cytochrome c oxidase (COX), the terminal enzyme of Bioenergetics, Institute of Physiology CAS, Vídeňská 1083, 142 mitochondrial electron transport chain, couples electron transport 20 Prague 4, Czech Republic. E-mail: [email protected] to oxygen with generation of proton gradient indispensable for the production of vast majority of ATP molecules in mammalian Cytochrome c oxidase cells. The review summarizes current knowledge of COX structure and function of nuclear-encoded COX subunits, which may Energy demands of mammalian cells are mainly modulate enzyme activity according to various conditions. covered by ATP synthesis carried out by oxidative Moreover, some nuclear-encoded subunits possess tissue-specific phosphorylation apparatus (OXPHOS) located in the and development-specific isoforms, possibly enabling fine-tuning central bioenergetic organelle, mitochondria. OXPHOS is of COX function in individual tissues. The importance of nuclear- composed of five multi-subunit complexes embedded in encoded subunits is emphasized by recently discovered the inner mitochondrial membrane (IMM). Electron pathogenic mutations in patients with severe mitopathies. In transport from reduced substrates of complexes I and II to addition, proteins substoichiometrically associated with COX were cytochrome c oxidase (COX, complex IV, CIV) is found to contribute to COX activity regulation and stabilization of achieved by increasing redox potential of individual the respiratory supercomplexes.
    [Show full text]
  • Expression Profiling of Substantia Nigra in Parkinson Disease, Progressive Supranuclear Palsy, and Frontotemporal Dementia with Parkinsonism
    ORIGINAL CONTRIBUTION Expression Profiling of Substantia Nigra in Parkinson Disease, Progressive Supranuclear Palsy, and Frontotemporal Dementia With Parkinsonism Michael A. Hauser, PhD; Yi-Ju Li, PhD; Hong Xu, MA; Maher A. Noureddine, PhD; Yujun S. Shao, PhD; Steven R. Gullans, PhD; Clemens R. Scherzer, MD; Roderick V. Jensen, PhD; Adam C. McLaurin, BA; Jason R. Gibson, BA; Burton L. Scott, MD; Rita M. Jewett, RN; Judith E. Stenger, PhD; Donald E. Schmechel, MD; Christine M. Hulette, MD, PhD; Jeffery M. Vance, MD, PhD Background: Parkinson disease (PD) is characterized Results: There were 142 genes that were significantly by loss of dopaminergic neurons in the substantia nigra. differentially expressed between PD cases and controls Genes contributing to rare mendelian forms of PD have and 96 genes that were significantly differentially ex- been identified, but the genes involved in the more com- pressed between the combined progressive supra- mon idiopathic PD are not well understood. nuclear palsy and frontotemporal dementia with parkin- sonism cases and controls. The 12 genes common to all Objectives: To identify genes important to PD patho- 3 disorders may be related to secondary effects. Hierar- genesis using microarrays and to investigate their poten- chical cluster analysis after exclusion of these 12 genes tial to aid in diagnosing parkinsonism. differentiated 4 of the 6 PD cases from progressive su- pranuclear palsy and frontotemporal dementia with par- Design: Microarray expression analysis of postmortem kinsonism. substantia nigra tissue. Conclusions: Four main molecular pathways are al- Patients: Substantia nigra samples from 14 unrelated tered in PD substantia nigra: chaperones, ubiquitina- individuals were analyzed, including 6 with PD, 2 with tion, vesicle trafficking, and nuclear-encoded mitochon- progressive supranuclear palsy, 1 with frontotemporal de- drial genes.
    [Show full text]
  • Unifying the Genomics-Based Classes of Cancer Fusion Gene Partners: Large Cancer Fusion Genes Are Evolutionarily Conserved
    CANCER GENOMICS & PROTEOMICS 9: 389-396 (2012) Unifying the Genomics-based Classes of Cancer Fusion Gene Partners: Large Cancer Fusion Genes Are Evolutionarily Conserved LIBIA M. PAVA, DANIEL T. MORTON, REN CHEN and GEORGE BLANCK Department of Molecular Medicine, Morsani College of Medicine, University of South Florida, Tampa, FL, U.S.A. Abstract. Background: Genes that fuse to cause cancer have fusion of NPM and ALK in anaplastic large-cell lymphoma been studied to determine molecular bases for proliferation, to (3); ABL and BCR in chronic myelogenous leukemia (CML) develop diagnostic tools, and as targets for drugs. To facilitate (4, 5); and C-MYC and IgH in Burkitt’s lymphoma in (6), identification of additional, cancer fusion genes, following among many others. The detection and understanding of the observation of a chromosomal translocation, we have ABL-BCR fusion protein, which stimulates unregulated cell characterized the genomic features of the fusion gene partners. division and leads to leukemia, led to the development of Previous work indicated that cancer fusion gene partners, are Gleevec, a drug able to block the ATP-binding site of the either large or evolutionarily conserved in comparison to the tyrosine kinase domain of ABL-BCR, halting CML (7). This neighboring genes in the region of a chromosomal extraordinary success has led to the hope of designing drugs translocation. These results raised the question of whether targeted against other cancer fusion proteins. large cancer fusion gene partners were also evolutionarily There are about 50,000 unstudied translocations, raising conserved. Methods and Results: We developed two methods the question of whether that information can continue to be for quantifying evolutionary conservation values, allowing the used to facilitate the identification of fusion genes.
    [Show full text]
  • Cytochrome C Oxidase Subunit Vic (COX6C) (NM 004374) Human Recombinant Protein Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TP300374 Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Recombinant Protein Product data: Product Type: Recombinant Proteins Description: Recombinant protein of human cytochrome c oxidase subunit VIc (COX6C) Species: Human Expression Host: HEK293T Tag: C-Myc/DDK Predicted MW: 8.6 kDa Concentration: >50 ug/mL as determined by microplate BCA method Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. Storage: Store at -80°C. Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. RefSeq: NP_004365 Locus ID: 1345 UniProt ID: P09669, A0A024R9B7 RefSeq Size: 921 Cytogenetics: 8q22.2 RefSeq ORF: 225 Summary: Cytochrome c oxidase, the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse subunit VIc. This gene is up-regulated in prostate cancer cells.
    [Show full text]
  • Functions of Cytochrome C Oxidase Assembly Factors
    International Journal of Molecular Sciences Review Functions of Cytochrome c Oxidase Assembly Factors Shane A. Watson and Gavin P. McStay * Department of Biological Sciences, Faculty of School of Life Sciences and Education, Staffordshire University, Science Centre, Leek Road, Stoke-on-Trent ST4 2DF, UK; [email protected]ffs.ac.uk * Correspondence: gavin.mcstay@staffs.ac.uk; Tel.: +44-01782-295741 Received: 17 September 2020; Accepted: 23 September 2020; Published: 30 September 2020 Abstract: Cytochrome c oxidase is the terminal complex of eukaryotic oxidative phosphorylation in mitochondria. This process couples the reduction of electron carriers during metabolism to the reduction of molecular oxygen to water and translocation of protons from the internal mitochondrial matrix to the inter-membrane space. The electrochemical gradient formed is used to generate chemical energy in the form of adenosine triphosphate to power vital cellular processes. Cytochrome c oxidase and most oxidative phosphorylation complexes are the product of the nuclear and mitochondrial genomes. This poses a series of topological and temporal steps that must be completed to ensure efficient assembly of the functional enzyme. Many assembly factors have evolved to perform these steps for insertion of protein into the inner mitochondrial membrane, maturation of the polypeptide, incorporation of co-factors and prosthetic groups and to regulate this process. Much of the information about each of these assembly factors has been gleaned from use of the single cell eukaryote Saccharomyces cerevisiae and also mutations responsible for human disease. This review will focus on the assembly factors of cytochrome c oxidase to highlight some of the outstanding questions in the assembly of this vital enzyme complex.
    [Show full text]
  • (COX6C) (NM 004374) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC200374 Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: Cytochrome C Oxidase subunit VIc (COX6C) (NM_004374) Human Tagged ORF Clone Tag: Myc-DDK Symbol: COX6C Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC200374 ORF sequence Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCTCCCGAAGTTTTGCCAAAACCTCGGATGCGTGGCCTTCTGGCCAGGCGTCTGCGAAATCATATGG CTGTAGCATTCGTGCTATCCCTGGGGGTTGCAGCTTTGTATAAGTTTCGTGTGGCTGATCAAAGAAAGAA GGCATACGCAGATTTCTACAGAAACTACGATGTCATGAAAGATTTTGAGGAGATGAGGAAGGCTGGTATC TTTCAGAGTGTAAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC200374 protein sequence Red=Cloning site Green=Tags(s) MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGI FQSVK myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk6388_f07.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 Cytochrome C Oxidase subunit
    [Show full text]
  • Constitutional Trisomy 8 Mosaicism As a Model for Epigenetic Studies of Aneuploidy Davidsson Et Al
    Constitutional trisomy 8 mosaicism as a model for epigenetic studies of aneuploidy Davidsson et al. Davidsson et al. Epigenetics & Chromatin 2013, 6:18 http://www.epigeneticsandchromatin.com/content/6/1/18 Davidsson et al. Epigenetics & Chromatin 2013, 6:18 http://www.epigeneticsandchromatin.com/content/6/1/18 RESEARCH Open Access Constitutional trisomy 8 mosaicism as a model for epigenetic studies of aneuploidy Josef Davidsson1*, Srinivas Veerla2 and Bertil Johansson1,3 Abstract Background: To investigate epigenetic patterns associated with aneuploidy we used constitutional trisomy 8 mosaicism (CT8M) as a model, enabling analyses of single cell clones, harboring either trisomy or disomy 8, from the same patient; this circumvents any bias introduced by using cells from unrelated, healthy individuals as controls. We profiled gene and miRNA expression as well as genome-wide and promoter specific DNA methylation and hydroxymethylation patterns in trisomic and disomic fibroblasts, using microarrays and methylated DNA immunoprecipitation. Results: Trisomy 8-positive fibroblasts displayed a characteristic expression and methylation phenotype distinct from disomic fibroblasts, with the majority (65%) of chromosome 8 genes in the trisomic cells being overexpressed. However, 69% of all deregulated genes and non-coding RNAs were not located on this chromosome. Pathway analysis of the deregulated genes revealed that cancer, genetic disorder, and hematopoiesis were top ranked. The trisomy 8-positive cells displayed depletion of 5-hydroxymethylcytosine and global hypomethylation of gene-poor regions on chromosome 8, thus partly mimicking the inactivated X chromosome in females. Conclusions: Trisomy 8 affects genes situated also on other chromosomes which, in cooperation with the observed chromosome 8 gene dosage effect, has an impact on the clinical features of CT8M, as demonstrated by the pathway analysis revealing key features that might explain the increased incidence of hematologic malignancies in CT8M patients.
    [Show full text]
  • Wasin Vol. 9 N. 4 2558.Pmd
    Asian Biomedicine Vol. 9 No. 4 August 2015; 455 - 471 DOI: 10.5372/1905-7415.0904.415 Original article Antiaging phenotype in skeletal muscle after endurance exercise is associated with the oxidative phosphorylation pathway Wasin Laohavinija, Apiwat Mutirangurab,c aFaculty of Medicine, Chulalongkorn University, Bangkok 10330, Thailand bDepartment of Anatomy, Faculty of Medicine, Chulalongkorn University, Bangkok 10330, Thailand cCenter of Excellence in Molecular Genetics of Cancer and Human Diseases, Chulalongkorn University, Bangkok 10330, Thailand Background: Performing regular exercise may be beneficial to delay aging. During aging, numerous biochemical and molecular changes occur in cells, including increased DNA instability, epigenetic alterations, cell-signaling disruptions, decreased protein synthesis, reduced adenosine triphosphate (ATP) production capacity, and diminished oxidative phosphorylation. Objectives: To identify the types of exercise and the molecular mechanisms associated with antiaging phenotypes by comparing the profiles of gene expression in skeletal muscle after various types of exercise and aging. Methods: We used bioinformatics data from skeletal muscles reported in the Gene Expression Omnibus repository and used Connection Up- and Down-Regulation Expression Analysis of Microarrays to identify genes significant in antiaging. The significant genes were mapped to molecular pathways and reviewed for their molecular functions, and their associations with molecular and cellular phenotypes using the Database for Annotation,
    [Show full text]
  • AF0762-COX6C Antibody
    Affinity Biosciences website:www.affbiotech.com order:[email protected] COX6C Antibody Cat.#: AF0762 Concn.: 1mg/ml Mol.Wt.: 32kDa Size: 100ul,200ul Source: Rabbit Clonality: Polyclonal Application: WB 1:500-1:2000, IF/ICC 1:100-1:500, ELISA(peptide) 1:20000-1:40000 *The optimal dilutions should be determined by the end user. Reactivity: Human,Mouse,Rat Purification: The antiserum was purified by peptide affinity chromatography using SulfoLink™ Coupling Resin (Thermo Fisher Scientific). Specificity: COX6C Antibody detects endogenous levels of total COX6C. Immunogen: A synthesized peptide derived from human COX6C, corresponding to a region within the internal amino acids. Uniprot: P09669 Description: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially- encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12. Storage Condition and Rabbit IgG in phosphate buffered saline , pH 7.4, 150mM Buffer: NaCl, 0.02% sodium azide and 50% glycerol.Store at -20 °C.Stable for 12 months from date of receipt. Western blot analysis on HuvEc cell lysates using COX6C Antibody,The lane on the left was treated with the antigen- specific peptide.
    [Show full text]
  • Anti-COX6C Monoclonal Antibody, Clone FQS0049 (DCABH-4090) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
    Anti-COX6C monoclonal antibody, clone FQS0049 (DCABH-4090) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Product Overview Rabbit monoclonal to Cytochrome C Oxidase subunit VIc Antigen Description This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport. Immunogen Synthetic peptide (the amino acid sequence is considered to be commercially sensitive) (C terminal) Isotype IgG Source/Host Rabbit Species Reactivity Mouse, Rat, Human Clone FQS0049 Purity Tissue culture supernatant Conjugate Unconjugated Applications WB, IHC-P Positive Control Human fetal heart lysate; HepG2 and A673 cell lysates; Human kidney and stomach tissues. Format Liquid Size 100 μl Buffer Preservative: 0.01% Sodium azide; Constituents: 50% Glycerol, 0.05% BSA Preservative 0.01% Sodium Azide Storage Store at -20℃. Ship Shipped at 4°C. GENE INFORMATION Gene Name COX6C cytochrome c oxidase subunit VIc [ Homo sapiens ] 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Official Symbol COX6C Synonyms COX6C; cytochrome c oxidase subunit VIc; cytochrome c oxidase subunit 6C; cytochrome c oxidase polypeptide VIc; cytochrome c oxidase subunit VIc preprotein; Entrez Gene ID 1345 Protein Refseq NP_004365 UniProt ID A0A024R9B7 Chromosome Location 8q22.2 Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cardiac muscle contraction, organism-specific biosystem; Cardiac muscle contraction, conserved biosystem; Cytochrome c oxidase, organism-specific biosystem; Cytochrome c oxidase, conserved biosystem; Electron Transport Chain, organism-specific biosystem; Function cytochrome-c oxidase activity; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved.
    [Show full text]