This issue: Skiing In Austria | Boogie Nights | Green Academy | Best Of Beauty
March 2012 Vol 2 No 2
Out Of Africa Offering help to schools
New Look @ Victory Best facilities in New Build Best Of Business Our students set up shop The Big Freeze Raising money for charity
www.ormistonvictoryacademy.co.uk March 2012 Victory Flag: Vol 2 No. 2
Principal Points P3
News in Brief P4
Costessey News P5
New Look @ Victory P6 - 7
The Real Business Challenge P8 - 9
ISSUE Business at Victory P 10 - 11
Aid to Africa/Books for Africa P12
Working With Bayer P13
Steps To Stardom P14
Living The Dream P15
YOUR Victory In The Media P17 school in Costessey. As I have said from Freezing For Charity P18 - 19 Principal Points the beginning, I want Victory to be the Visit By the Lord Lieutenant P20 - 21 We have a very full ÀDJVKLSVFKRRORIWKH(DVWHUQ5HJLRQ IN It is only right that we share what we Elizabeth Truss MP Visit P22 agenda this year, working are doing well with others. Norman Lamb MP Visit P23 hard to build on the It always comes back academic success of last Yvonne Mason Visit P24 to our students. year as well as the many Mathematics Matters P24 - 25 We transformed many hours developing our Victory hits the slopes P26 - 27 young lives last year, New Build plans. Boogie Nights P28 - 29 ,¶PFRQ¿GHQWRIPRUH Green Academy Update P30 - 32 Put simply, we want the best education for our students with the best facilities. this year. Kids' Lit Quiz P33 With this in mind, I have agreed to New opportunities, new horizons, QHZKRSHLQGLI¿FXOWWLPHV Best of Beauty P34 - 35 support the new Sir Isaac Newton
Funds For The Tots P36 Free School, a maths and science sixth- Thank you to everyone for your form school in Norwich. It will open brilliant support. Reach For The Stars P37 up enormous possibilities with top
Intercollege Cross - Country teaching for our talented maths and and Rugby Results P38 - 39 science students. Our aim is to get them Rachel de Souza into the best universities. I am also very Executive Principal Kicking To Victory P40 keen on sharing our best practice with Victory Academy other schools, both in Norfolk and wider [email protected] Letters to the Editor D¿HOG:HDUHEXLOGLQJDYHU\VSHFLDO tw: @victoryoak Victory Flag welcomes Letters to the Editor. No more than 150 words and the Editor reserves the right to adjust the length. Letters to: The Queen’s [email protected] and marked Letters to the Editor. representative in
Victory Flag is printed on matt coated paper and is 100% recycled Norfolk met Words by Geoff Howe. Photography by Dave Goulding, Geoff Howe and Helen Gage. students and toured www.ormistontrust.org www.ormistoneducation.co.uk the Academy. Pages 20 – 21 Designed by 'RAPHICS s 7ALLSCAPES s $ 0HOTOGRAPHY
.co.uk
2 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 3 March 2012 Victory Flag: Vol 2 No. 2 NEWS IN BRIEF COSTESSEY NEWS KEEP IN TOUCH LADIES CLUB GET-TOGETHER Follow the Principal’s Blog on www.ormistonvictoryacademy.co.uk #OSTESSEY -ETHODIST #HURCH ,ADIES #LUB RAISED a FOR Costessey Baptist Church will be holding a Coffee Morning and our Twitter account at @victoryoak GREEN POWER charity with a concert at their last meeting in December. on March 7. They meet fortnightly on Tuesdays, 7.45pm. Telephone and Facebook at www.facebook.com/ormistonvictoryacademy The Eco council has submitted a bid for solar PV panels to be installed at the COSTESSEY DAY CENTRE ROCK SUCCESS Academy. The centre is looking for people to join the new What an amazing performance by our team at Rock Challenge 2012. Under the GREEN FINGERS -ANAGEMENT #OMMITTEE FROM !PRIL ! VOLUNTEER DRIVER IS eagle eye of Ms Driver, they won four awards at Stevenage - community, best set Easton College Gardening Club meets on the third ALSO NEEDED FOR &RIDAYS #ALL !LLAN "EDFORD design, lighting and Spirit of Rock Challenge. Well done everybody involved in our 4HURSDAY OF THE MONTH AT PM AT THE #OLLEGE 3PORTS AND entry – students, staff and supporters. #ONFERENCE #ENTRE #ALL 3TEPHEN !USTIN ON BRIC A BRAC The 1st Costessey Boys’ and Girls’ Brigade Companies will TOP JOB THE COSTESSEY SOCIETY be holding a Jumble and Bric a Brac Sale on Saturday, Kirsty Warnes, Year 10, has been successful in winning work placement at *ULIE "ARTON WILL GIVE AN ILLUSTRATED TALK TO 4RINIDAD 4OBAGO March 10, 2.15pm at Costessey Baptist Church Hall. Call the John Innes Centre against tough competition across Norfolk. She spent JUDO CLUB Terns, Tropical Birds, Trogons and Turtles on Friday, March Christmas Eve completing the application form. PM AT THE #OSTESSEY #ENTRE #ALL -RS "ROWN ON We are starting a Judo Club for students after school on Thursdays. FREE CHECK Norfolk Fire and Rescue Service is offering a free Home Fire NORFOLK SCHOLARS A lot of interest has been shown by TH students already. 4 COSTESSEY BROWNIES 3AFETY #HECK AND SMOKE DETECTOR lT #ALL 3EVEN OF LAST YEARS 9EAR ! ,EVEL STUDENTS HAVE RECEIVED THE PRESTIGIOUS The pack still has places available. It meets at the scout hut .ORFOLK 3CHOLAR !WARDS 4HEY ARE #HLOE #OUSINS !LICE $OVER (ANNAH $UNNE IN 4HE 3TREET /LD #OSTESSEY ON 4HURSDAYS PM PM #ALL Brandon Hatch, Jack Ogorman, Heidi Preston and Bethany Simmons. ,EE !NN "REWSTER ON DANCE CLUB Costessey Modern Sequence Dance Club meets on Fridays, KEEP FIT FREEZE-OVER TAVERHAM & DISTRICT PM AT THE #OSTESSEY #ENTRE #ALL *OHN ON 7EEKLY :UMBA LESSONS HAVE STARTED AFTER SCHOOL !LL WELCOME The annual Freeze-Over, involving 40 students, LIONS ST HELEN’S CHURCH BRILLIANT BEAUTY plus members of staff, 4HE CLUB RAISED AN IMPRESSIVE a WITH THE ANNUAL 3ANTA !N IMPRESSIVE a WAS RAISED FOR THE #HILDRENS 3OCIETY AT raised £600 for Shelter, COLLECTION 4HE NEXT 1UIZ N #HIPS IS ON 3ATURDAY -ARCH the Christingle Service. The Beauty Team have been given direct claims status, only normally awarded to PM AT THE #OSTESSEY #ENTRE centres that have been running for six years or more. Because of our high standards plus funds for our and the way the department is run, we are trusted with claiming the students’ Duke of Edinburgh BIRDWATCHING achievements and certification without them being checked. programme. ROYAL BRITISH LEGION Wensum Valley Birdwatching Society has an exciting The Costessey and District Branch raised a magnificent programme for 2012 including several interesting talks a IN THE ANNUAL 0OPPY !PPEAL 4HE BRANCH MEETS ON including one by artist Steven Cale. Field trips include visits FRIENDS OF VICTORY Full report on THE lRST 4HURSDAY OF THE MONTH AT THE "USH AT PM to Holkham, Hickling, Foxley Wood and the North Norfolk The new group has got off to a flying start with fund-raising plans already in the pages 14 – 15 #OAST #ALL #OLIN 7RIGHT ON pipeline. Contact [email protected] TAVERHAM BAND The Spring Concert will be held on Friday and Saturday BABY GROUP PUDSEY BEAR -ARCH PM AT 4AVERHAM 6ILLAGE (ALL 4ICKETS ,ITTLE !CORNS MEET ON 7EDNESDAYS AND 4HURSDAYS 4HE !CADEMY RAISED a FOR #HILDREN )N .EED TOP TECHNICIAN FROM WWWTAVERHAMBANDORG OR AM AM AT THE (EBRON #HAPEL #ALL Amanda Bradford, our Senior Science DAFFODIL DISPLAY Technician, has been short-listed for the The Gardening Club planted daffodil bulbs, donated by Costessey Parish Council, Gratnells Science Technician of the Year. on the roundabout in Middleton Crescent. Star TOP SCIENTIST Dear Victory Academy (ANNAH "EAVIS 9EAR HAS BEEN NOMINATED FOR 3ENIOR 9OUNG 3CIENTIST OF THE 9EAR I am writing to express my thanks to you and your team at KETTLE GIFT Letter Victory for welcoming the Progress Team from Old Buckenham High School and giving us such informative visits. +ETTLE &OODS OF "OWTHORPE HAS DONATED FOUR WHITEBOARDS TO THE !CADEMY SHROVE TUESDAY We were all very impressed with your set-up and the way in KLM LINKS which you have ensured the systems have been implemented and, The Business Department is forging links with KLM for the Unit 5 BTEC assignment Courage won the more importantly, consistently maintained. following discussions with Peter Mahony, Director of Finance of KLM. Pancake Day Sixth-Form race. Our Progress Team have come away with a great many ideas HEALTH ADVISER which will hopefully improve the behaviour of students in our *ILLY 'OURLAY HAS BEEN APPOINTED (EALTH !DVISER *ILLY HAS MANY YEARS EXPERIENCE IN school and, as a result, the quality of learning experiences within all aspects of health and well-being. the classroom. TESCO HELP Once again we do appreciate the time and quality of information 7E HAVE APPLIED FOR A a GRANT FROM 4ESCO #HARITY 4RUST TO FUND ARTWORK FOR THE you gave. Victory Orchard. Mrs N. Tarrant, Progress Leader. Old Buckenham High School
4 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 5 March 2012 Victory Flag: Vol 2 No. 2 New Look 7KH¿UVWVRGRQRXU spectacular £14 million New Build could be turned @ Victory this June or July. The design includes a dance studio, theatre, sports hall, seven science labs, a science lecture theatre, a science terrace with an observatory, open art terrace, engineering workshop and a hair and beauty salon. Mrs de Souza said: “Right at the centre is the dining area and the purpose-built theatre. That will be used for all our fantastic productions but we also want it ttoo rrunun aass a theatre ooutsideutside school hours.hours.””
6 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 7 March 2012 Victory Flag: Vol 2 No. 2 The Real Business Challenge … is an annual enterprise competition for Year 10s. 7KHUHJLRQDO¿QDOWRRNSODFHDW1RUZLFK&LW\ Football Club at the end of last year.
6WXGHQWVLQWKH¿QDOWHDPZHUH5HHFH&ROOLVRQ5\DQ0RUOH\-DPLH7KRPSVRQ $EELH0RUOH\/HZLV6ZDWPDQ&KDUORWWH1XQQ'HPL6LVWHUQ/RXLV/RFNH $OVRSLFWXUHGLV0UV%DOOHQWLQH+HDGRI%XVLQHVV7UDYHO 7RXULVP
The Challenge is linked to the curriculum; it challenges students to tackle a business task set by Coca-Cola Enterprises. It is work-related learning at its most engaging and an opportunity for a year group to develop enterprise skills that will give them a competitive edge in the job market. 7KHFKDOOHQJHRXUVWXGHQWVIDFHGZDVSDUWRI*HW6HWWKHRI¿FLDO/RQGRQ Education Programme. The challenge gave students a chance to pitch their business wits against other schools and work alongside Coca-Cola business experts. Students were tasked with developing a campaign to encourage consumers to recycle more and litter less in their region. The group had to put together a radio advert, billboard advert and carry out a presentation in IURQWRIDOOWKHRWKHUUHJLRQDO¿QDOLVWV$OWKRXJK nervous, they came across very professionally.
8 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 9 March 2012 Victory Flag: Vol 2 No. 2 Working With Europe TheTh two-year Comenius Project involves Enterprise In Action schoolss from France, Spain, Germany, Italy After a very successful Trafalgar night of selling homemade Halloween anda Victory Academy working on common cakes and toffee apples, the Enterprise Group has been working hard to environmentale issues in the workplace. FRPHXSZLWKQHZEXVLQHVVLGHDVWRUHLQYHVWWKHLUSUR¿WV ,WRI¿FLDOO\VWDUWHGODVW6HSWHPEHUZLWKDYLVLWWR+DQDX*HUP,WR DQ\0DQ\RIRXU dedicatedded students are currently liaising with local businesses to carry out primary rresearchese on working environment, communication systems, intelligent use of s ! GROUP OF GIRLS PRODUCED PERSONALISED BAUBLES FOR s !NOTHER GROUP WORKED ON A 6ALENTINES SPECIAL n rresources,eso recycling, vision of sustainable development. #HRISTMAS TREES AND RAISED a %XCELLENT FEEDBACK FROM messages to loved ones and secret admirers which went customers. up on the big screen during break and lunch time. 50p a This information will help students to write a common international charter and message. createcreate a video clip on good and bad practices. s ! GROUP OF 9EAR BOYS ARE HARD AT WORK PRODUCING promotional material, business cards and getting order s Several girls are busy preparing for Easter. They are going TheThe Academy will be hosting the next meeting forms ready to launch their business, Victory Services. Their to put together a large Easter basket to raffle. slogan is “No job too big or small, we are willing to do it iinn MMarch. We are looking forward to welcoming all”. Book early as these boys are in high demand. $OOSUR¿WVZLOOEHUHLQYHVWHGWRPDNH the othero schools to Norwich and working with s ! THIRD GROUP HAS LAUNCHED A STATIONERY SHOP WHICH opened after half-term. It will open during form time bigger and better businesses. When will thethemm to further develop our ideas. and break time. No more excuses for lack of equipment. If youyou wouldwo like to become involved in the project, contact Mrs Burns or Miss Gardiner. “No barriers to learning in our business”. 9LFWRU\SURGXFHLWV¿UVWPLOOLRQDLUH" 0RQH\0DWWHUV Student 7KHSHUVRQDO¿QDQFHFRXUVHVUXQIRUDOOVL[WK Success formers, Year 10 and Year 11 business studies Congratulations to the students are proving a big success. Business and Travel In the Level 3 Finance results so far, 77% achieved A and 14% B. students who have already 5HFHQWO\03VEDFNHGSHUVRQDO¿QDQFHFRXUVHVIRUVWXGHQWV$IWHUDQHLJKWPRQWK achieved 2 dist/2 dist* inquiry, the All-Party Parliamentary Group on Financial Education for Young People called on ministers to ensure school-leavers are better equipped to avoid running into equivalent to 2 A/2A*. money problems. Year 11: Business Katherine Fell, It published a report suggesting that personal $PEHU:DWHU¿HOG(OOLH3DXOLQJ James Gladden, Abenezor Follie.
¿QDQFHHGXFDWLRQEHPDGHFRPSXOVRU\ Year 10: Business Demi Sistern, in schools. Jamie Thompson. Year 11: Travel Shannon Bartram, Laura Brown, Katherine Fell, Taylor Marshall Nichols, Save a Tonne *UDFH2OLYHU$PEHU:DWHU¿HOG The Academy is working with the government-funded Save A Tonne campaign as a lead school in west Norwich. The campaign will be publicised at the Academy, feeder schools and local communities. ,WZLOOUDLVHDZDUHQHVVLQKRXVHKROGVDERXWWKHEHQH¿WVRILQVXODWLQJWKHLUKRPH 2IIHUKRXVHKROGVIUHHDGYLFHRQVHUYLFHVDQGJUDQWVIRUHQHUJ\VDYLQJ $GYLFHIRUFRPPXQLW\EXLOGLQJV 7UDLQLQJORFDOSHRSOHWREHFRPH&RPPXQLW\(QHUJ\&KDPSLRQVZLWKSD\PHQWIRUHDFK assessment. www.saveatonne.org.uk will showcase examples of practical insulation measures and renewable energy technologies. 7KHSURMHFWZLOOVXSSRUW1RUIRONEXVLQHVVHVZKLFKSURYLGHJRRGVDQGVHUYLFHV for energy saving and generation. 7KHUHZLOOEHORFDOFRPPXQLW\HYHQWVLQ0DUFK
10 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 11 March 2012 Victory Flag: Vol 2 No. 2 Aid To Africa Working With Bayer The Sixth Form Business Studies group visited Bayer Crop Science, Victory Academy is partnering Alert, a well-regarded Norwich last term as part of their Unit 1 coursework assignment. charity working on conservation projects and with In lessons the students have been studying the highly-regarded group. schools on Africa. ,WVSXUSRVHDQGW\SHRIRZQHUVKLS 6WXGHQWV¶FRPPHQWVRQWKHYLVLWZHUH The partnership follows a meeting between Science 7KHVWDNHKROGHUVZKRLQÀXHQFHLW "It was a very well organised, helpful and well explained $IRECTOR ,UCY !USTIN AND 2AE +OKES OF !LERT #OVER experience." supervisor Kerry Martin has known Rae Kokes and +RZLWLVRUJDQLVHGDQGKRZWKHVW\OHRIRUJDQLVDWLRQKHOSVWKHP the charity for some time. to achieve their purpose "Interesting and highly informative." s The Science Department has donated seven +RZWKHHFRQRPLFHQYLURQPHQWLQÀXHQFHV%D\HU&URS6FLHQFH¶V boxes of non-curriculum textbooks for children business activities "The way that they explained in Zimbabwe. +RZSROLWLFDOOHJDODQGVRFLDOIDFWRUVDUHLPSDFWLQJXSRQ%D\HU about the various parts of the site s ! PEN PAL SCHEME IS BEING ORGANISED WITH &URS¶VEXVLQHVVDFWLYLWLHV children in Zimbabwe. when we went on the tour was The students attended a presentation from Tim Green which s The charity has produced environmental provided some useful information for their coursework. They fascinating." educational packs which could be used in also had a guided tour of the site which helped them to put their "It's a good company that produces useful products that we
THE !CADEMY 4HERE ARE ALSO PACKS FOR knowledge of how the business operates into context. need to grow food effectively, and I found it very educational." primary schools. We are very grateful to Lisa Tekell and the other staff at Bayer Crop "Very informative and really interesting." Science who gave up their time to help us with our Sixth Form Rae Kokes, who has a "I found walking around the site very interesting. I was surprised Business course. master’s degree in animal how large the site was." behaviour, appeared in an ITV1 series called Lion Country.
www.itvwild.com/tvshows/lion-country/morethanjustagame www.lionalert.org
The Maths Department, led by Mr Weare, donated 600 non- curriculum textbooks to Aidan Thorne, a former student, who is now in Ghana working as a volunteer teacher. Aidan, who achieved a First in maths at 6KHI¿HOG8QLYHUVLW\KDVZRUNHGDVD volunteer mentor at the Academy and held an inspirational assembly earlier this term. A non-uniform day was held to raise money to pay for shipping the books to Ghana.
12 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 13 March 2012 Victory Flag: Vol 2 No. 2 Steps To Stardom Living The Dream By Joe Brown %\1DWDOLH*ULI¿QDQG(ULFND I learnt all his lines so I was ready if I was needed. willwillinging to help iiff we have auditions or After this I was made understudy for all the boys.s. givegive us advice aaboutb our careers. They Then Melusi who was playing Spencer droppeded out. I was buzzing to be told I had the part butut really push us tto our full potential,” it turned out I got the part of Dean the DJ andand Spencer was taken by Luke Barnes. I did Natalie said.sai not have a care in the world, I had a lead.ad. 14 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 15 March 2012 Victory Flag: Vol 2 No. 2 Q: Why do these people look so happy? 0UVGH6RX]DDSSHDUHGLQWKH'DLO\7HOHJUDSK'DLO\0DLOWKH *XDUGLDQ7KH6XQ('31RUZLFK(YHQLQJ1HZV1RUZLFK $GYHUWLVHUDQGRQ5DGLR1RUIRON$QJOLD79DQG/RRN(DVWRQ YDULRXVLVVXHV*RYHUQRU'DYLG3ULRUFRQWULEXWHGDQDUWLFOHWR WKH('3DQG*RYHUQRU6WHSKHQ%XUWRQZDVLQWHUYLHZHGRQ%%& :RPDQ¶V+RXU9LFWRU\ZDVPHQWLRQHGRQQXPHURXVVRFLDOEORJV ! 4ALK TO -RS 'AGE ABOUT the Carnegie Medal. +RUDWLR¶VFDIpFRRNHGDVSHFLDOEDWFKRI$Q]DF biscuits to celebrate Australia Day on January 26. The addition to the menu proved very popular. Keep In Touch Check www.ormistonvictoryacademy.co.uk for the latest news and blogs about the Academy. Updated daily, the website has had 160,000 hits and rising since last year. Join 5,500 Twitter followers @victoryoak for our latest news and views. 16 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 17 March 2012 Victory Flag: Vol 2 No. 2 The aim was to raise awareness of what it is like to be homeless in winter and raise money for Shelter – the idea is for students to experience what it is like to sleep outside in winter while having fun with other students. Freezing For Charity 7KHJURXSKDGD¿UHEDUUHOZHUHHQWHUWDLQHGE\DPLGQLJKW¿OPVKRZDQGZHUHZHOOIHG throughout the night. Thirty-seven students, supported by four staff members (Mrs Lawson, Mr Stevenson, Mr Greenwood and Mrs Neal), camped out in the Academy They raised more than £900, of which £600 Quad on a chilly February night to raise money for Shelter. will be donated to Shelter and the remainder will be used to buy new equipment for Duke of The Arrival Edinburgh expeditions. The Freeze-Over is based on the annual charity 6OHHS2XW/RQGRQHYHQWKHOGLQ6SLWDO¿HOGV Market. Morning… Setting up camp If anyone is interested in doing their Duke of Edinburgh Award, see Mrs Lawson. We meet in DT5 2.45pm every Thursday. We made it! 18 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 19 March 2012 Victory Flag: Vol 2 No. 2 Mr Jewson with Pauline Williamson, environmental coordinator, Mrs de Souza said: “It was a great honour to have the in the wildlife garden. Lord Lieutenant visit us, he took a close interest in what our students were studying. We all had a wonderful day.” Mr Jewson with Mollie and Lucie Smith, Visit by the Year 7. /RUG/LHXWHQDQW 7KH/RUG/LHXWHQDQWRI1RUIRON5LFKDUG-HZVRQSDLGDQRI¿FLDOYLVLWWR Victory Academy. Mr Jewson met Mrs de Souza and senior staff and was Mr Jewson is welcomed to the Academy by head boy taken on a tour of the Academy, including maths, modern languages, Luke Sycamore. Victory students learning how to graft fruit trees. humanities, science departments and the wildlife garden. 20 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 21 March 2012 Victory Flag: Vol 2 No. 2 Norfolk MP Visit Tour of Elizabeth Truss, MP for South-West Norfolk, has SDLGDQRI¿FLDOYLVLWWRWKH$FDGHP\ Academy Ms Truss, a member of the Justice Select Committee, met Mrs de Souza and senior staff and was taken on a tour of the Academy, including English, maths, French, Norman Lamb, MP history departments and the Beauty Salon. for North Norfolk, has visited Victory Academy. Mollie and Lucie Smith welcome Norman Lamb, MP, Mr Lamb, who has just been appointed a to Victory Academy. Government Minister, met Mrs de Souza and senior staff and was taken on a tour of the Academy, including English, maths, science, ITC departments and the Beauty Salon. Mrs de Souza said: “It was a pleasure for the staff and students Mrs de Souza said: “It was a great to meet Norman opportunity for the staff and students Lamb. We had a wide- to meet Elizabeth Truss. She has a great ranging discussion on interest in education policy.” education policy.” /HDGLQJ%XVLQHVV9LVLW Leading Norfolk Top Teaching businesswoman A huge new opportunity for Victory Yvonne Mason students is opening up with plans to paid a visit to the launch the Sir Isaac Newton Free School The Sir Isaac Newton Academy. in Norwich. Sixth Form Free School After a meeting The sixth-form Maths and Science school will have links with leading with Mrs de Souza, universities, businesses and organisations across Norfolk and beyond. It is supported by community leaders across the county. she was taken “The school will aim for A*-As at A-level and the students on a tour of the ZLOOEHTXDOL¿HGIRU2[EULGJHDQGWKHEHVWXQLYHUVLWLHV Academy. It is an enormous opportunity for our students who Mrs Mason are passionate about maths and science,” founded the Mason Mrs de Souza said. Trust to support Visit www.sixthformfreeschool.co.uk young people or phone the hotline 01603 734 162. in Norfolk and Suffolk. 22 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 23 March 2012 Victory Flag: Vol 2 No. 2 Maths Diary Dates: Mathematics GCSE Maths Examiners Tips Year 9 & 10 2 KS4: Edexcel 5MB Module 1 Mon 11th June PM 6HWRXW\RXUZRUNLQJVHQVLEO\DQGWLGLO\ Edexcel 5MB Module 2 Weds 13th June AM A man is walking his dog on 5HYLVHDQGEHSUHSDUHGWRZULWH\RXUJHRPHWULF DQJOHV Edexcel 5MB Module 3 Tues 19th June PM MATTER properties of shapes) reasons. KHFN a lead towards home at an %HYHU\FDUHIXOZKHQZRUNLQJZLWKQHJDWLYHQXPEHUVDQGFKHFN average of 3mph. your answers for reasonableness. Q Year 11 When they are 1.5 miles from home the man lets the dog off $OZD\VVKRZ\RXUZRUNLQJDVWKLVPD\JDLQ\RXUPDUNVHYHQ the lead. The dog immediately runs off home at an average LI\RXU¿QDODQVZHULVZURQJ Edexcel 1MA0 Linear Non Calc Mon 11th June PM [email protected] speed of 5mph. :KHQGHVLJQLQJDTXHVWLRQQDLUHUHPHPEHUWRTXRWHDWLPH Edexcel 1MA0 Linear Calc Weds 13th June AM When the dog reaches the house it turns around and runs period and do not overlap your response box values. AQA Additional Maths Non Calc Tues 29th May PM KS3: back to the man. It repeats this until the man reaches the 6KRZWKHDOJHEUDLFSURFHVVRQERWKVLGHVRIWKHHTXDWLRQ AQA Additional Maths Calc Fri 1st June PM Place the numbers 1-9 KRXVHDQGOHWVLQWKHGRJ+RZPDQ\PLOHVGRHVWKHGRJFRYHU 'RQ¶WXVHWULDODQGHUURUWRVROYHDOJHEUDLFHTXDWLRQVZKHQ from being let off the lead to being let in the house? inclusive in the nine regions it is clear that you should use manipulation. V %ULQJDOOWKHDSSURSULDWHHTXLSPHQWHVSHFLDOO\FRPSDVVHV A Level formed by the Olympic rings and a protractor. R so that there is exactly one number in each region and the sum 'RQ¶WPHDVXUHGLDJUDPVXQOHVVVSHFL¿FDOO\DVNHGWRGRVRQJ Core Weds1 16th May AM of the numbers in :KHQXVLQJFRQYHUVLRQJUDSKVVKRZ\RXUZRUNE\GUDZLQJ Core Weds2 16th May AM each ring is 11. The Trivia lines on the graph. Statistics Fri1 18th May AM diagram shows part A classic question: Three friends :KHUHSRVVLEOHFKHFNORQJKDQGFDOFXODWLRQVZLWKWKHLU Decision Thurs1 24th May AM of the solution, what calculators. number goes in the buy a kettle for £30, paying £10 Core Thurs3 31st May AM Core Thurs4 14th June AM region marked *? each. 7KHPDQDJHUWKHQUHDOLVHVWKHNHWWOHVKRXOG¶YHEHHQ 5HFRPPHQGHG0DWKV:HEVLWHV instead of £30 so he asks the assistant to refund £5 to the 'U0DWK KWWS PDWKIRUXPRUJGUPDWK IULHQGV+RZHYHUWKHDVVLVWDQWNHHSV IRUKLPVHOIDQG :ROIUDP$OSKD KWWS ZZZZROIUDPDOSKDFRP WPO gives the students only £1 back each meaning that they each ALevel FRQWULEXWHG WRWKHNHWWOH+RZHYHU [ IRUWKH 3OXV0DWKV0DJD]LQH KWWS SOXVPDWKVRUJLQGH[KWPO EXWHG NHWWOHDQGWKHVKRSDVVLVWDQWKDV :KHUH HDQGWKH VKR Solve: is thehe missing pound?pou nd? In the range 24 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 25 March 2012 Victory Flag: Vol 2 No. 2 Victory hits the slopes Forty-one students, accompanied by staff members, went on a six-day skiing trip over half-term to Mallnitz in Austria. They skied every day and evening activities included bowling, swimming, ice skating and a pizza evening. The trip was organised by Ms Stone. 26 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 27 March 2012 Victory Flag: Vol 2 No. 2 Our Performing Arts Department and Façade Productions staged a brilliant production of Boogie Nights at Christmas. After weeks of busy rehearsals, Boogie Nights, the 1997 American drama written E\3DXO7KRPDV$QGHUVRQ¿OOHGWKHKDOO on three successive nights plus a special matinee show for our feeder schools. The lead roles were played by: Taylor Wooltorton, Zoe Utting, Chloe Watret,et, Eliot Hunter, Joe Brown,n, 5KLDQQD*ULI¿Q Luke Barnes and Shannon Moore. Thanks to our outside friends who helped ZLWKWKHVHWWKHEDQGDQGFRVWXPHVɊ *OHQQDQG7KHOPD+HZLWW,VREHO5LFH Peter Edwards, Mick Tindale, Dave Cowie, Vicki Sidnell and Dawn Secker. 28 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 29 March 2012 Victory Flag: Vol 2 No. 2 Victory Fruit Top Green Award 9LFWRU\$FDGHP\KDVEHHQDZDUGHGWKHSUHVWLJLRXV(FR Planting has just finished at the Victory Orchard Green Flag. This follows a lengthy inspection of the Academy’s which is sited next to our organic Victory Allotment. HQYLURQPHQWDODFWLYLWLHVE\DQ(FR6FKRROVDVVHVVRU As part of the award, the Academy set up an eco committee, developed an action plan and an eco )T HAS BEEN PLANTED WITH A VARIETY OF TRADITIONAL %AST !NGLIAN FRUIT TREES MAINLY of Norfolk origin, including Costessey’s own varieties, New Costessey Seedling code, involved the whole Academy in good environmental practice and linked the environmental and Herbert Eastoe. work to the curriculum. Mrs de Souza said: “The students worked so hard for this award. We only have one environment; The theme for the orchard is a sundial, with trees it is importance for us to show leadership on this issue.” Dr Allen was responsible for the project. planted in hourly positions, and, like the Victory Allotment, this will be an organic wildlife friendly environment, which will include a number of wildlife Members of the habitats such as a wildlife pond, native hedgerow Gardening Club busy and a small meadow area. pruning bushes in the &RUITFUL 3CHOOLS #OORDINATOR (ELEN "ANKS AND 2(3 %DUCATION /FlCER !LISON Findlay, worked with Mrs Williamson to mark out the site. Wildlife Garden as part Seventeen Prince's Trust volunteers worked with us to create the orchard, of the winter clean-up. and members of the Core Group of Victory students assisted with planting the trees. Although initially planted with young fruit trees, this orchard area will be well established and Victory Academy is one of productive by the time the New Build is completed, 30 secondary schools in the serving to enhance the landscaped environment UK who are trialling the that our architects have designed. use of vending machines for WKHVDOHRI+HDUW+HDOWK\ snacks and drinks. The scheme is being run by the British +HDUW)RXQGDWLRQ The project is a whole school initiative, with the School Council actively involved in the initial market research to choose suitable options to be sold in the machines. A small Press-Button group of students worked after school with Art teacher, Andy Wilson, and DT teacher, Simon Dagless, to design Victory branding Health Food for the machines which attracted great interest on their arrival in January. The popularity of the machines is evident IURPRXU-DQXDU\VDOHV¿JXUHVDQG students are encouraged to continue to suggest new lines to stock. The project will form the basis of coursework for students in Food Technology and Business Studies. 30 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 31 March 2012 Victory Flag: Vol 2 No. 2 United by a love of books and the hope of FRPSHWLQJLQWKHZRUOG¿QDOLQ1HZ=HDODQG this summer, an eight-strong group of Year Kids’ 7s and 8s went to the City of Norwich School with a large group of supporters. Lit Quiz By Mrs Gage Victory Herbs Members of the Gardening Club, assisted by DT technician Lester Billman and Science WHDFKHU5RG6WHYHQVRQKDYHEHJXQZRUNWRFUHDWHDIUDJUDQW+HUE*DUGHQ in a neglected patio area between Food Technology and the Beauty Salon. The garden will consist of a number of raised beds planted with a variety of culinary and aromatic herbs such as basil, thyme, sage, chives and lavender. &RRNHU\VWXGHQWVZLOOEHDEOHWRH[SHULHQFHWKHWDVWHVHQVDWLRQVDQGEHQH¿WVRI cooking with fresh herbs, while clients visiting the Beauty Salon will be welcomed by a calming sensory environment which will enhance their holistic beauty therapy. The project was funded by a B & Q Youth Can Do It Grant of £250. Bees For Victory Everyone was impressed by the lively personality of the quizmaster, Professor Mills, from the University of Auckland. +HKDVEHHQSDVVLRQDWHDERXWERRNVDOOKLVOLIHDQGGHFLGHGWR HVWDEOLVKWKH.LGV¶/LW4XL]LQ WRUHZDUGFKLOGUHQZKRH[FHO Snug in their hives, protected from the DWµWKHVSRUWRIUHDGLQJ¶ woodpeckers, our Victory Bees are 7KLVZDVWKH¿UVWWLPHRXUVWXGHQWVKDGFRPSHWHGDQGDOWKRXJK WKH\GLGQRWZLQWKLV(DVW$QJOLDQKHDW &16ZRQDQGZHQWRQWR preparing themselves for their Premier compete for the honour of representing the UK in New Zealand), Performance on Saturday, they enjoyed themselves enormously. April 21st, when they will be the focus of a Bee Aware community outreach day. The team members were Sabrina Burgess, Callem Kernahan, In conjunction with the University of East Anglia $OH[0LOOV5\DQ1HZWRQ/DXUHQ6DIIHU/XF\:DWHU¿HOG,VREHO Beekeeping Society, we will be running this Wilkinson and Amy Woods. Our supporters were Ebonhi Andrews, Saturday event, open to friends, family and $VKOH\%LVKRS%HQ&DZGURQ*HRUJLD+HZLWW0DGLVRQ0XVVHWW other members of our local community who Kirsten Oakley and Phoebe Sayer. are interested to learn all about the fascinating ZRUOGRIWKH+RQH\%HH You were a credit to the Academy Further details will be circulated at a later for your enthusiasm, behaviour date, but register your interest with [email protected]. and knowledge of great books. 32 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 33 March 2012 Victory Flag: Vol 2 No. 2 2XU ImaginativeImaginative designs were on vievieww iinn the Beauty Salon fforor the department’s Make-up CCompetition.ompetition. MrsMrs de Souza inspected the entries and said she waswas veryvery proud ofof the professionalismprofessionalism ofof the departmentdepartment and the imagination and effort that had gone into the entries. entries VWSUL]H Jemmaeauty Utting outstanding make-up Blook of Cheryl Cole QGSUL]H Olivia Clarke for outstanding planning and make-up application UGSUL]HWR0DLVLH5REHUWVRQIRUDWWHQWLRQ to detail on her make-up look $QRWKHUSUL]HZHQWWR.LUVWHQ$OOHQIRUWKLQNLQJ RXWVLGHWKHER[DQGUHFUHDWLQJWKH4XHHQRI+HDUWV Book Now! Follow us @VictoryBeauty Follow us Beauty@Victory Beauty @Victory 7KH¿UVWEHDXW\VDORQZLWKLQDQ$FDGHP\ For a full range of Beauty Therapy treatments including manicures, non-surgical facials, massage, self tanning, waxing and lots more Open Tuesdays 2-5pm, Thursday 1-3pm & Friday 9-1pm Ring for appointments on 01603 742310 ex 3312 Victory Academy, Middleton Crescent, Costessey, Norwich, NR5 0PX. 34 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 35 March 2012 Victory Flag: Vol 2 No. 2 Funds For The Tots A group of Year 11s staged a face-painting session at the Academy to raise funds for the NNUH Cots for Tots appeal and as part of their Wider Key Skills TXDOL¿FDWLRQ The students had to demonstrate 7ZRKXQGUHGDQGWZHQW\¿YH%URZQLHVIURPGLIIHUHQWXQLWVDFURVV their ability to work as a team with a VSHFL¿FJRDO Norfolk completed their Stargazer Badge at Victory Academy in January. Reach For The Stars Activities included learning about the eight phasesases ooff tthehe &&R&RXQW\&RPPLVVLRQHUDQG/XF\$XVWLQ9LFWRU\¶V'LUHFWRURIX moon's cycle using Jaffa cakes as an edible versionsion ofof thethe SScience,cie presented each Brownie with their Stargazer badge and PRRQH[SORULQJWKHKDOOWR¿QGWKHSODQHWVLQRXUVRODURXUVRODU ¿¿QLVKHGZLWKWKHJUDQG¿QDOHRIJD]LQJDWWKHUHDOWKLQJRXWVLGQLV H V\VWHPDQG¿QDOO\FRPSHWLQJLQWHDPVWRWHVWWKHLUNQRZOHGJHRI The computer program, which we used, is free to download. www. WKHSODQHWVIURPWKHHYHQLQJ¶VDFWLYLWLHV stellarium.org The Brownies were fascinated and intrigued with the many stars A big thank-you to everyone who helped to make this event and constellations projected onto the whiteboard, receiving many possible, particularly Mrs Bradford. µ2RRRV¶DQGµ$KKKV¶)LQDOO\+HOHQ*UHHQ1RUIRON*LUO*XLGLQJ 0U%DOODGGUHVVHVWKH0U%DOODGGUHVVHVWKH :HOFRPH%DFN'D:HOFRPH%DFN'D\\ 36 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 37 March 2012 Victory Flag: Vol 2 No. 2 INTER – COLLEGE FOOTBALL/ RUGBY RESULTS 2012 Intercollege X or Y Band 1st (40 pts) 2nd (30 pts) 3rd (20 pts) 4th (10 pts) Cross-Country Winners Yr. 8 Boys Enterprise Endeavour Courage Discovery 7X band: Boys 9Y band: Boys Yr. 8 Girls Endeavour Discovery Enterprise Courage &KULVWRSKHU%XUWRQ DQO&RXUDJH ± -DFN%XQQ NMH'LVFRYHU\ ± %DYRQ1JDQGX DF\'LVFRYHU\ ± 7\OHU6LVWHUQ OIG&RXUDJH ± Yr. 9 Boys Discovery Endeavour Courage Enterprise *HRUJH:RRGV DYH'LVFRYHU\ ± /XNH6DYRU\ OWQ&RXUDJH ± Yr. 9 Girls Courage Endeavour Discovery Enterprise 7X band: Girls 9Y band: Girls /XFLH6PLWK UPQ(QWHUSULVH ± 0HJDQ6WHYHQV DYH'LVFRYHU\ ± Yr. 10 Boys Discovery Courage Endeavour Enterprise /HDQQH6WHHOH QVH&RXUDJH ± /DXUHQ6ZDQ+RUWRQ ONO&RXUDJH ± 0HOLVVD'HQQHWW OWQ&RXUDJH ± Yr. 10 Girls Endeavour Courage Enterprise Discovery 7Y band: Boys 10X band: Boys +DUU\%URZQ OIG&RXUDJH ± Overall 1st Place 2nd Place 3rd Place 4th Place &RQQRU+RZHWW FGG(QGHDYRXU ± +D\GQ0DUWLQ UPQ(QWHUSULVH ± :LOOLDP&RUN WFV'LVFRYHU\ ± Result ENDEAVOUR DISCOVERY COURAGE ENTERPRISE +DUU\/DQGOHV UWP(QGHDYRXU ± +DUU\0DVRQ OWQ&RXUDJH ± 190pts 160pts 150pts 110pts 7Y band: Girls 10X band: Girls 0ROOLH6LWK UPQ(QWHUSULVH ± &KDUORWWH+DWFK OVV&RXUDJH ± INTER – COLLEGE CROSS COUNTRY RESULTS 2012 $QWLRQLD)DLU P\Q'LVFRYHU\ ± &DUOD%OXQGHOO± DF\'LVFRYHU\ ± *HRUJLD&RXOWKDUG ONO&RXUDJH ± $GULDQQH5XVKPHU UVW(QGHDYRXU ± X or Y Band 1st (40 pts) 2nd (30 pts) 3rd (20 pts) 4th (10 pts) 8X band: Boys 10Y band: Boys 7DQDND.DJXGD DQO&RXUDJH ± $DURQ6RGGHQ%ODQFKÀRZHU ONO&RXUDJH ± Yr. 7 XBand Discovery Courage Enterprise Endeavour -DFN(OOLRWW DF\'LVFRYHU\ ± &KULVWLDQ:LVH MJG'LVFRYHU\ ± %UDQGRQ3LVDFDQH UPQ(QWHUSULVH ± 'DPLHQ4XLQQHOO DYH'LVFRYHU\ ± Yr. 7 YBand Endeavour Courage Enterprise Discovery 8X band: Girls 10Y band: Girls -HQQD3RZHOO QEV(QWHUSULVH ± &KDUORWWH1XQQ QEN(QGHDYRXU ± Yr. 8 XBand Enterprise Discovery Endeavour Courage =DYDUQDK6PLWK UWP(QGHDYRXU ± 0HJDQ&XUWLV ONO&RXUDJH ± *HRUJLD'XUUDQW QVW(QGHDYRXU ± $EELH&RSHPDQ QVH&RXUDJH ± Yr. 8 YBand Enterprise Endeavour Discovery Courage 8Y band: Boys 11X band: Boys &DOOXP%HQQHW MJU(QWHUSULVH ± /XNH6\FDPRUH QVH&RXUDJH ± Yr. 9 XBand Courage Discovery Endeavour Enterprise 'HDQ7HUU\ WFV'LVFRYHU\ ± -DFN%HDYLV MUO(QWHUSULVH ± +D\GRQ*HRUJH WFN(QWHUSULVH ± 5HHFH:DUG VGV(QWHUSULVH ± Yr. 9 YBand Courage Discovery Enterprise Endeavour 8Y band: Girls 11X band: Girls /XF\:DWHU¿OHG MUO(QWHUSULVH ± (OOLH3DXOLQJ QEN(QGHDYRXU ± Yr. 10 XBand Discovery Courage Endeavour Enterprise 6KDQQRQ/LVWHU VGV(QWHUSULVH ± /DXUHQ6WUDWKHDUQ ORU'LVFRYHU\ ± &KHOVHD6DYRU\ MJU(QWHUSULVH ± -DVPLQH3DWHUVRQ KVH&RXUDJH ± Yr. 10 YBand Courage Discovery Endeavour Enterprise 9X band: Boys 11Y band: Boys $VKOH\0RUWLPHU ONO&RXUDJH ± 2OLYHU*RUKDP WFN(QWHUSULVH ± Yr. 11 XBand Courage Enterprise Discovery Endeavour $VKOH\%XUWRQ OWQ&RXUDJH ± 5LFKDUG6SDOGLQJ UVW(QGHDYRXU ± 6DP+HQGHQ OVV&RXUDJH ± $GDP(ZOHV QVW(QGHDYRXU Yr. 11 YBand Discovery Enterprise Endeavour Courage 9X band: Girls 11Y band: Girls .LUVWHQ+DUULV QEN(QGHDYRXU ± (ULFD+DOO UPQ(QWHUSULVH Overall 1st Place 2nd Place 3rd Place 4th Place 7HUL(WKHULGJH± ORU'LVFRYHU\ ± *UDFH6PLWK OIG&RXUDJH 'DQLHOOH6WDUOLQJ DYH'LVFRYHU\ ± Result COURAGE DISCOVERY ENTERPRISE ENDEAVOUR $P\*UHHQ MJU(QWHUSULVH 280pts 260pts 230pts 200pts 38 www.ormistonvictoryacademy.co.uk www.ormistonvictoryacademy.co.uk 39 Inter College Results & Staff Football March 2012 Vol 2 No 2 Kicking To Victory The staff football team has entered the Thursday night County 5s business enterprise league. Victory v Lovewell Blake Accountants Won 11-8 7KLVZDVWKHWHDP¶V¿UVW¿[WXUHDQGWKH\VWDUWHGZHOOVFRULQJWZRHDUO\JRDOV'HVSLWHDORWRI pressure , the team found the Lovewell Blake goalkeeper in inspired form, keeping his team in the JDPHIRUWKHPDMRULW\RIWKH¿UVWKDOI6RPHORRVHGHIHQGLQJIURP9LFWRU\VDZWKHRSSRVLWLRQVFRUH three times in quick succession, Victory trailing at half time 3-2. The second half started much the same way with the opposition goalkeeper making a string of exceptional saves. Lovewell Blake scored twice quickly after half time, leading 5-2. This inspired Victory into action, some much improved defending meant that we enjoyed far more SRVVHVVLRQRIWKHEDOODQGEHJDQWRPDNHWKLVDGYDQWDJHSD\$¿QHVHFRQGKDOIGLVSOD\RI ¿QLVKLQJPHDQWWKDWWKHRSSRVLWLRQJRDONHHSHUZDV¿QDOO\EHLQJEHDWHQ$TXLFNUXQRIJRDOV saw the Academy take the lead 6-5, and they stayed in front until the end pressing home their DGYDQWDJH¿QLVKLQJWKHJDPHFRPIRUWDEOHZLQQHUV$JRRG¿UVWRXWLQJLQWKHOHDJXH Scorers:3KLO/HH±1LF%OLVV±5LFK7LPP±-RKQ*UHHQZRRG±5LFK+XJKHV Victory v Proxama Technologies Won 22-4 The team started well and played some nice football early on creating lots of chances, with the Proxama team chasing shadows for WKHPDMRULW\RIWKH¿UVWKDOI:LWKWKH¿QLVKLQJPXFKLPSURYHGIURPWKH¿UVWZHHNWKH$FDGHP\WHDPRSHQHGXSDFRPPDQGLQJ OHDGZLWKWKHRSSRVLWLRQ¿QGLQJLWGLI¿FXOWWRFRSHZLWKWKHÀRZLQJIRRWEDOODQGZRUNUDWHRIWKH9LFWRU\VLGH$FRXSOHRIGHIHQVLYH ODSVHVWRZDUGVWKHHQGRIWKH¿UVWKDOIDOORZHGWKHRSSRVLWLRQWRVFRUHWZRTXLFNJRDOVEXW9LFWRU\OHGDWKDOIWLPH The second half played out much the same way with the Academy team proving too strong for the opposition. They were able to FRPIRUWDEO\EXLOGXSRQWKHOHDGLQWKH¿UVWKDOIDQGZHUHVFRULQJJRDOVIRUIXQIURPDOODUHDVRIWKHSLWFKDQGIURPDOOSOD\HUVLQWKH team. Final score 22-4. Goal scorers: 3KLO/HH±5LFK7LPP±1LF%OLVV±5LFK+XJKHV±-RKQ*UHHQZRRG± Victory v Petans Off-shore Survival Won 11-4 Stay up-to-date with what's going on at our Academy March 2012 April 2012 March 21 Talent Show April 18 Storming the Castle March 28 UKMT Maths Challenge April 20 Global Day March 29 Careers Event April 24 Year 8 Options Evening April 25 Achievement Review Day www.ormistonvictoryacademy.co.uk