Targeting Selectins, Siglecs and Mammalian Glycans
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse
Welcome to More Choice CD Marker Handbook For more information, please visit: Human bdbiosciences.com/eu/go/humancdmarkers Mouse bdbiosciences.com/eu/go/mousecdmarkers Human and Mouse CD Marker Handbook Human and Mouse CD Marker Key Markers - Human Key Markers - Mouse CD3 CD3 CD (cluster of differentiation) molecules are cell surface markers T Cell CD4 CD4 useful for the identification and characterization of leukocytes. The CD CD8 CD8 nomenclature was developed and is maintained through the HLDA (Human Leukocyte Differentiation Antigens) workshop started in 1982. CD45R/B220 CD19 CD19 The goal is to provide standardization of monoclonal antibodies to B Cell CD20 CD22 (B cell activation marker) human antigens across laboratories. To characterize or “workshop” the antibodies, multiple laboratories carry out blind analyses of antibodies. These results independently validate antibody specificity. CD11c CD11c Dendritic Cell CD123 CD123 While the CD nomenclature has been developed for use with human antigens, it is applied to corresponding mouse antigens as well as antigens from other species. However, the mouse and other species NK Cell CD56 CD335 (NKp46) antibodies are not tested by HLDA. Human CD markers were reviewed by the HLDA. New CD markers Stem Cell/ CD34 CD34 were established at the HLDA9 meeting held in Barcelona in 2010. For Precursor hematopoetic stem cell only hematopoetic stem cell only additional information and CD markers please visit www.hcdm.org. Macrophage/ CD14 CD11b/ Mac-1 Monocyte CD33 Ly-71 (F4/80) CD66b Granulocyte CD66b Gr-1/Ly6G Ly6C CD41 CD41 CD61 (Integrin b3) CD61 Platelet CD9 CD62 CD62P (activated platelets) CD235a CD235a Erythrocyte Ter-119 CD146 MECA-32 CD106 CD146 Endothelial Cell CD31 CD62E (activated endothelial cells) Epithelial Cell CD236 CD326 (EPCAM1) For Research Use Only. -
A CD22-Shp1 Phosphatase Axis Controls Integrin Β7 Display and B Cell Function in Mucosal Immunity
UCSF UC San Francisco Previously Published Works Title A CD22-Shp1 phosphatase axis controls integrin β7 display and B cell function in mucosal immunity. Permalink https://escholarship.org/uc/item/27j4g9rr Journal Nature immunology, 22(3) ISSN 1529-2908 Authors Ballet, Romain Brennan, Martin Brandl, Carolin et al. Publication Date 2021-03-01 DOI 10.1038/s41590-021-00862-z Peer reviewed eScholarship.org Powered by the California Digital Library University of California Europe PMC Funders Group Author Manuscript Nat Immunol. Author manuscript; available in PMC 2021 August 15. Published in final edited form as: Nat Immunol. 2021 March 01; 22(3): 381–390. doi:10.1038/s41590-021-00862-z. Europe PMC Funders Author Manuscripts A CD22-Shp1 phosphatase axis controls integrin β7 display and B cell function in mucosal immunity Romain Ballet1,2,#, Martin Brennan1,2,10, Carolin Brandl3,10, Ningguo Feng1,4, Jeremy Berri1,2, Julian Cheng1,2, Borja Ocón1,2, Amin Alborzian Deh Sheikh5, Alex Marki6, Yuhan Bi1,2, Clare L. Abram7, Clifford A. Lowell7, Takeshi Tsubata5, Harry B. Greenberg1,4, Matthew S. Macauley8,9, Klaus Ley6, Lars Nitschke3, Eugene C. Butcher1,2,# 1The Center for Molecular Biology and Medicine, Veterans Affairs Palo Alto Health Care System and The Palo Alto Veterans Institute for Research, Palo Alto, CA, United States 2Laboratory of Immunology and Vascular Biology, Department of Pathology, School of Medicine, Stanford University, Stanford, CA, United States 3Division of Genetics, Department of Biology, University of Erlangen-Nürnberg, Erlangen, -
Pharmacologic Considerations in the Disposition of Antibodies and Antibody-Drug Conjugates in Preclinical Models and in Patients
antibodies Review Pharmacologic Considerations in the Disposition of Antibodies and Antibody-Drug Conjugates in Preclinical Models and in Patients Andrew T. Lucas 1,2,3,*, Ryan Robinson 3, Allison N. Schorzman 2, Joseph A. Piscitelli 1, Juan F. Razo 1 and William C. Zamboni 1,2,3 1 University of North Carolina (UNC), Eshelman School of Pharmacy, Chapel Hill, NC 27599, USA; [email protected] (J.A.P.); [email protected] (J.F.R.); [email protected] (W.C.Z.) 2 Division of Pharmacotherapy and Experimental Therapeutics, UNC Eshelman School of Pharmacy, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA; [email protected] 3 Lineberger Comprehensive Cancer Center, University of North Carolina at Chapel Hill, Chapel Hill, NC 27599, USA; [email protected] * Correspondence: [email protected]; Tel.: +1-919-966-5242; Fax: +1-919-966-5863 Received: 30 November 2018; Accepted: 22 December 2018; Published: 1 January 2019 Abstract: The rapid advancement in the development of therapeutic proteins, including monoclonal antibodies (mAbs) and antibody-drug conjugates (ADCs), has created a novel mechanism to selectively deliver highly potent cytotoxic agents in the treatment of cancer. These agents provide numerous benefits compared to traditional small molecule drugs, though their clinical use still requires optimization. The pharmacology of mAbs/ADCs is complex and because ADCs are comprised of multiple components, individual agent characteristics and patient variables can affect their disposition. To further improve the clinical use and rational development of these agents, it is imperative to comprehend the complex mechanisms employed by antibody-based agents in traversing numerous biological barriers and how agent/patient factors affect tumor delivery, toxicities, efficacy, and ultimately, biodistribution. -
Selectins in Cancer Immunity
Zurich Open Repository and Archive University of Zurich Main Library Strickhofstrasse 39 CH-8057 Zurich www.zora.uzh.ch Year: 2018 Selectins in cancer immunity Borsig, Lubor Abstract: Selectins are vascular adhesion molecules that mediate physiological responses such as inflam- mation, immunity and hemostasis. During cancer progression, selectins promote various steps enabling the interactions between tumor cells and the blood constituents, including platelets, endothelial cells and leukocytes. Selectins are carbohydrate-binding molecules that bind to sialylated, fucosylated glycan structures. The increased selectin ligand expression on tumor cells correlates with enhanced metastasis and poor prognosis for cancer patients. While, many studies focused on the role of selectin as a mediator of tumor cell adhesion and extravasation during metastasis, there is evidence for selectins to activate signaling cascade that regulates immune responses within a tumor microenvironment. L-Selectin binding induces activation of leukocytes, which can be further modulated by selectin-mediated interactions with platelets and endothelial cells. Selectin ligand on leukocytes, PSGL-1, triggers intracellular signaling in leukocytes that are induced through platelet’s P-selectin or endothelial E-selectin binding. In this review, I summarize the evidence for selectin-induced immune modulation in cancer progression that represents a possible target for controlling tumor immunity. DOI: https://doi.org/10.1093/glycob/cwx105 Posted at the Zurich Open Repository and -
Molecular and Clinical Characterization of LAG3 in Breast Cancer Through 2994 Samples
Molecular and Clinical Characterization of LAG3 in Breast Cancer Through 2994 Samples Qiang Liu Chinese Academy of Medical Sciences & Peking Union Medical College Yihang Qi ( [email protected] ) Chinese Academy of Medical Sciences and Peking Union Medical College https://orcid.org/0000-0001- 7589-0333 Jie Zhai Chinese Academy of Medical Sciences & Peking Union Medical College Xiangyi Kong Chinese Academy of Medical Sciences & Peking Union Medical College Xiangyu Wang Chinese Academy of Medical Sciences & Peking Union Medical College Yi Fang Chinese Academy of Medical Sciences & Peking Union Medical College Jing Wang Chinese Academy of Medical Sciences & Peking Union Medical College Research Keywords: Cancer immunotherapy, CD223, LAG3, Immune response, Inammatory activity Posted Date: June 19th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-36422/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/33 Abstract Background Despite the promising impact of cancer immunotherapy targeting CTLA4 and PD1/PDL1, a large number of cancer patients fail to respond. LAG3 (Lymphocyte Activating 3), also named CD233, is a protein Coding gene served as alternative inhibitory receptors to be targeted in the clinic. The impact of LAG3 on immune cell populations and co-regulation of immune response in breast cancer remained largely unknown. Methods To characterize the role of LAG3 in breast cancer, we investigated transcriptome data and associated clinical information derived from a total of 2994 breast cancer patients. Results We observed that LAG3 was closely correlated with major molecular and clinical characteristics, and was more likely to be enriched in higher malignant subtype, suggesting LAG3 was a potential biomarker of triple-negative breast cancer. -
CD22 Antigen Is Broadly Expressed on Lung Cancer Cells and Is a Target for Antibody-Based Therapy
Published OnlineFirst September 17, 2012; DOI: 10.1158/0008-5472.CAN-12-0173 Cancer Therapeutics, Targets, and Chemical Biology Research CD22 Antigen Is Broadly Expressed on Lung Cancer Cells and Is a Target for Antibody-Based Therapy Joseph M. Tuscano1,2, Jason Kato1, David Pearson3, Chengyi Xiong1, Laura Newell4, Yunpeng Ma1, David R. Gandara1, and Robert T. O'Donnell1,2 Abstract Most patients with lung cancer still die from their disease, necessitating additional options to improve treatment. Here, we provide evidence for targeting CD22, a cell adhesion protein known to influence B-cell survival that we found is also widely expressed in lung cancer cells. In characterizing the antitumor activity of an established anti-CD22 monoclonal antibody (mAb), HB22.7, we showed CD22 expression by multiple approaches in various lung cancer subtypes, including 7 of 8 cell lines and a panel of primary patient specimens. HB22.7 displayed in vitro and in vivo cytotoxicity against CD22-positive human lung cancer cells and tumor xenografts. In a model of metastatic lung cancer, HB22.7 inhibited the development of pulmonary metastasisandextendedoverallsurvival.Thefinding that CD22 is expressed on lung cancer cells is significant in revealing a heretofore unknown mechanism of tumorigenesis and metastasis. Our work suggests that anti- CD22 mAbs may be useful for targeted therapy of lung cancer, a malignancy that has few tumor-specific targets. Cancer Res; 72(21); 5556–65. Ó2012 AACR. Introduction lymphoma (NHL), HB22.7, effectively binds lung cancer cells fi in vitro in vivo In the United States, lung cancer is the most common and mediates speci c and killing. -
Dinutuximab for the Treatment of Pediatric Patients with High-Risk Neuroblastoma
Expert Review of Clinical Pharmacology ISSN: 1751-2433 (Print) 1751-2441 (Online) Journal homepage: http://www.tandfonline.com/loi/ierj20 Dinutuximab for the treatment of pediatric patients with high-risk neuroblastoma Jaume Mora To cite this article: Jaume Mora (2016): Dinutuximab for the treatment of pediatric patients with high-risk neuroblastoma, Expert Review of Clinical Pharmacology, DOI: 10.1586/17512433.2016.1160775 To link to this article: http://dx.doi.org/10.1586/17512433.2016.1160775 Accepted author version posted online: 02 Mar 2016. Published online: 21 Mar 2016. Submit your article to this journal Article views: 21 View related articles View Crossmark data Full Terms & Conditions of access and use can be found at http://www.tandfonline.com/action/journalInformation?journalCode=ierj20 Download by: [Hospital Sant Joan de Deu], [Jaume Mora] Date: 30 March 2016, At: 23:12 EXPERT REVIEW OF CLINICAL PHARMACOLOGY, 2016 http://dx.doi.org/10.1586/17512433.2016.1160775 DRUG PROFILE Dinutuximab for the treatment of pediatric patients with high-risk neuroblastoma Jaume Mora Department of Pediatric Onco-Hematology and Developmental Tumor Biology Laboratory, Hospital Sant Joan de Déu, Passeig Sant Joan de Déu, Barcelona, Spain ABSTRACT ARTICLE HISTORY Neuroblastoma (NB) is the most common extra cranial solid tumor of childhood, with 60% of patients Received 14 December 2015 presenting with high risk (HR) NB by means of clinical, pathological and biological features. The 5-year Accepted 29 February 2016 survival rate for HR-NB remains below 40%, with the majority of patients suffering relapse from Published online chemorefractory tumor. Immunotherapy is the main strategy against minimal residual disease and 21 March 2016 clinical experience has mostly focused on monoclonal antibodies (MoAb) against the glycolipid dis- KEYWORDS ialoganglioside GD2. -
Immunotherapy in Various Cancers
© 2021 JETIR June 2021, Volume 8, Issue 6 www.jetir.org (ISSN-2349-5162) Immunotherapy in various Cancers Nirav Parmar 1st Year MSc Student Department of Biosciences and Bioengineering, IIT- Roorkee India Abstract: Immunotherapy in the metastatic situation has changed the therapeutic landscape for a variety of cancers, including colorectal cancer. Immunotherapy has firmly established itself as a new pillar of cancer treatment in a variety of cancer types, from the metastatic stage to adjuvant and neoadjuvant settings. Immune checkpoint inhibitors have risen to prominence as a treatment option based on a better knowledge of the development of the tumour microenvironment immune cell-cancer cell regulation over time. Immunotherapy has lately appeared as the most potential field of cancer research by increasing effectiveness and reducing side effects, with FDA-approved therapies for more than 10 various tumours and thousands of new clinical studies. Key Words: Immunotherapy, metastasis, immune checkpoint. Introduction: In the late 1800s, William B. Coley, now generally regarded as the founder of immunotherapy, tried to harness the ability of immune system to cure cancer for the first time. Coley began injecting live and attenuated bacteria like Streptococcus pyogenes and Serratia marcescens into over a thousand patients in 1891 in the hopes of causing sepsis and significant immunological and antitumor responses. His bacterium mixture became known as "Coley's toxin" and is the first recorded active cancer immunotherapy treatment [1]. To better understand the processes of new and traditional immunological targets, the relationship between the immune system and tumour cells should be examined. Tumours have developed ways to evade immunological responses. -
Datasheet A02938-1 Anti-LGALS3BP Antibody
Product datasheet Anti-LGALS3BP Antibody Catalog Number: A02938-1 BOSTER BIOLOGICAL TECHNOLOGY Special NO.1, International Enterprise Center, 2nd Guanshan Road, Wuhan, China Web: www.boster.com.cn Phone: +86 27 67845390 Fax: +86 27 67845390 Email: [email protected] Basic Information Product Name Anti-LGALS3BP Antibody Gene Name LGALS3BP Source Rabbit IgG Species Reactivity human,mouse Tested Application WB,IHC-P Contents 500ug/ml antibody with PBS ,0.02% NaN3 , 1mg BSA and 50% glycerol. Immunogen A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR). Purification Immunogen affinity purified. Observed MW 65KD Dilution Ratios Western blot: 1:500-2000 Immunohistochemistry in paraffin section: 1:50-400 (Boiling the paraffin sections in 10mM citrate buffer,pH6.0,or PH8.0 EDTA repair liquid for 20 mins is required for the staining of formalin/paraffin sections.) Optimal working dilutions must be determined by end user. Storage 12 months from date of receipt,-20℃ as supplied.6 months 2 to 8℃ after reconstitution. Avoid repeated freezing and thawing Background Information Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. -
Estado Clínico-Oncológico De Pacientes Incluidos En El Ensayo Clínico RANIDO Tratados Con Racotumomab O Nimotuzumab
ISSN-E: 1990-7990 RNPS:2008 Univ Méd Pinareña. Septiembre-Diciembre 2020; 16(3):e503 ARTÍCULO ORIGINAL Estado clínico-oncológico de pacientes incluidos en el ensayo clínico RANIDO tratados con Racotumomab o Nimotuzumab Clinical-oncological status of patients included in RANIDO clinical trial treated with Racotumomab or Nimotuzumab César Adrián Blanco-Gómez1 , Ana Lázara Delgado-Reyes1 , Laura Elena Valdés-Rocubert1 , Rolando David Hernández-Godínez2 , Martha Elena Gómez-Vázquez3 1Universidad de Ciencias Médicas de Pinar del Río. Facultad de Ciencias Médicas “Dr. Ernesto Guevara de la Serna”. Pinar del Río, Cuba. 2Universidad de Ciencias Médicas de Granma. Hospital Provincial Universitario “Carlos Manuel de Céspedes”. Granma, Cuba. 3Universidad de Ciencias Médicas de Pinar del Río. Policlínico Universitario “Raúl Sánchez Rodríguez”. Pinar del Río, Cuba. Recibido: 16 de febrero de 2020 | Aceptado: 25 de abril de 2020 | Publicado: 17 de mayo de 2020 Citar como: Blanco-Gómez CA, Delgado-Reyes AL, Valdés-Rocubert LE, Hernández-Godínez RD, Gómez-Vázquez ME. Estado clínico- oncológico de pacientes incluidos en el ensayo clínico RANIDO tratados con Racotumomab o Nimotuzumab. Univ Méd Pinareña [Internet]. 2020 [citado: Fecha de Acceso]; 16(3):e503. Disponible en: http://www.revgaleno.sld.cu/index.php/ump/article/view/503 RESUMEN Introducción: RANIDO es un ensayo clínico extendido hasta la atención primaria de salud con el objetivo de evaluar la eficacia de los productos biotecnológicos cubanos Racotumomab y Nimotuzumab para el tratamiento del cáncer de pulmón de células no pequeñas. Objetivo: caracterizar clínico-oncológicamente a los pacientes incluidos en el ensayo clínico RANIDO tratados con Racotumomab y Nimotuzumab en Pinar del Río entre enero de 2013 y enero de 2018. -
Australian Public Assessment for Polatuzumab Vedotin
Australian Public Assessment Report for Polatuzumab vedotin Proprietary Product Name: Polivy Sponsor: Roche Products Pty Ltd December 2019 Therapeutic Goods Administration About the Therapeutic Goods Administration (TGA) • The Therapeutic Goods Administration (TGA) is part of the Australian Government Department of Health and is responsible for regulating medicines and medical devices. • The TGA administers the Therapeutic Goods Act 1989 (the Act), applying a risk management approach designed to ensure therapeutic goods supplied in Australia meet acceptable standards of quality, safety and efficacy (performance) when necessary. • The work of the TGA is based on applying scientific and clinical expertise to decision- making, to ensure that the benefits to consumers outweigh any risks associated with the use of medicines and medical devices. • The TGA relies on the public, healthcare professionals and industry to report problems with medicines or medical devices. TGA investigates reports received by it to determine any necessary regulatory action. • To report a problem with a medicine or medical device, please see the information on the TGA website <https://www.tga.gov.au>. About AusPARs • An Australian Public Assessment Report (AusPAR) provides information about the evaluation of a prescription medicine and the considerations that led the TGA to approve or not approve a prescription medicine submission. • AusPARs are prepared and published by the TGA. • An AusPAR is prepared for submissions that relate to new chemical entities, generic medicines, major variations and extensions of indications. • An AusPAR is a static document; it provides information that relates to a submission at a particular point in time. • A new AusPAR will be developed to reflect changes to indications and/or major variations to a prescription medicine subject to evaluation by the TGA. -
Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- Selectin and CXCR4
University of Nebraska Medical Center DigitalCommons@UNMC Theses & Dissertations Graduate Studies Fall 12-16-2016 Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E- selectin and CXCR4 Maria M. Steele University of Nebraska Medical Center Follow this and additional works at: https://digitalcommons.unmc.edu/etd Recommended Citation Steele, Maria M., "Pancreatic Cancer Invasion of the Lymphatic Vasculature and Contributions of the Tumor Microenvironment: Roles for E-selectin and CXCR4" (2016). Theses & Dissertations. 166. https://digitalcommons.unmc.edu/etd/166 This Dissertation is brought to you for free and open access by the Graduate Studies at DigitalCommons@UNMC. It has been accepted for inclusion in Theses & Dissertations by an authorized administrator of DigitalCommons@UNMC. For more information, please contact [email protected]. i PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 By Maria M. Steele A DISSERTATION Presented to the Faculty of the University of Nebraska Graduate College in Partial Fulfillment of the Requirements for the Degree of Doctor of Philosophy Cancer Research Graduate Program Under the Supervision of Professor Michael A. Hollingsworth University of Nebraska Medical Center Omaha, NE November, 2016 Supervisory Committee Michael A. Hollingsworth, Ph.D. Kaustubh Datta, Ph.D. Angie Rizzino, Ph.D. Joyce C. Solheim, Ph.D. ii PANCREATIC CANCER INVASION OF THE LYMPHATIC VASCULATURE AND CONTRIBUTIONS OF THE TUMOR MICROENVIRONMENT: ROLES FOR E-SELECTIN AND CXCR4 Maria M. Steele University of Nebraska, 2016 Advisor: Michael A. Hollingsworth ABSTRACT As the fourth leading cause of cancer-related deaths, pancreatic cancer is one of the most lethal forms of cancers in the United States.