Product Datasheet
Recombinant Human Tropomodulin-1(TMOD1)
Catalog No: #AP77050
Package Size: #AP77050-1 20ug #AP77050-2 100ug #AP77050-3 1mg Orders: [email protected] Support: [email protected]
Description
Product Name Recombinant Human Tropomodulin-1(TMOD1)
Brief Description Recombinant Protein
Host Species E.coli
Purification Greater than 90% as determined by SDS-PAGE.
Immunogen Description Expression Region:1-359aaSequence Info:Full Length
Other Names Erythrocyte tropomodulin
Accession No. P28289
Calculated MW 67.6 kDa
Tag Info N-terminal GST-tagged
Target Sequence MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQ
AKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYY
QALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKEN
SYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKV
EMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV
Formulation Tris-based buffer50% glycerol
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability
of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months
at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for
up to one week.
Background
Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod,TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. May play an important role in regulating the organization of actin filaments by preferentially binding to a specific tropomyosin isoform at its N-terminus.
References
"Genomic organization of mouse and human erythrocyte tropomodulin genes encoding the pointed end capping protein for the actin filaments." Chu X., Thompson D., Yee L.J., Sung L.A. Gene 256:271-281(2000)Research Topic:Others
Note: This product is for in vitro research use only and is not intended for use in humans or animals.
Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1