Product Datasheet

Recombinant Human -1(TMOD1)

Catalog No: #AP77050

Package Size: #AP77050-1 20ug #AP77050-2 100ug #AP77050-3 1mg Orders: [email protected] Support: [email protected]

Description

Product Name Recombinant Human Tropomodulin-1(TMOD1)

Brief Description Recombinant

Host Species E.coli

Purification Greater than 90% as determined by SDS-PAGE.

Immunogen Description Expression Region:1-359aaSequence Info:Full Length

Other Names Erythrocyte tropomodulin

Accession No. P28289

Calculated MW 67.6 kDa

Tag Info N-terminal GST-tagged

Target Sequence MSYRRELEKYRDLDEDEILGALTEEELRTLENELDELDPDNALLPAGLRQKDQTTKAPTGPFKREELLDHLEKQ

AKEFKDREDLVPYTGEKRGKVWVPKQKPLDPVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYY

QALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKEN

SYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKV

EMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV

Formulation Tris-based buffer50% glycerol

Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability

of the protein itself.

Generally, the shelf life of liquid form is 6 months at -20°C,-80°C. The shelf life of lyophilized form is 12 months

at -20°C,-80°C.Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for

up to one week.

Background

Blocks the elongation and depolymerization of the filaments at the pointed end. The Tmod,TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. May play an important role in regulating the organization of actin filaments by preferentially binding to a specific isoform at its N-terminus.

References

"Genomic organization of mouse and human erythrocyte tropomodulin encoding the pointed end capping protein for the actin filaments." Chu X., Thompson D., Yee L.J., Sung L.A. 256:271-281(2000)Research Topic:Others

Note: This product is for in vitro research use only and is not intended for use in humans or animals.

Address: 8400 Baltimore Ave., Suite 302, College Park, MD 20740, USA http://www.sabbiotech.com 1