Familial STAG2 Germline Mutation Defines a New Human Cohesinopathy
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Inner Centromere Localization of the CPC Maintains Centromere Cohesion and Allows Mitotic Checkpoint Silencing
ARTICLE Received 8 Feb 2017 | Accepted 5 Apr 2017 | Published 31 May 2017 DOI: 10.1038/ncomms15542 OPEN Inner centromere localization of the CPC maintains centromere cohesion and allows mitotic checkpoint silencing Rutger C.C. Hengeveld1, Martijn J.M. Vromans1, Mathijs Vleugel1, Michael A. Hadders1 & Susanne M.A. Lens1 Faithful chromosome segregation during mitosis requires that the kinetochores of all sister chromatids become stably connected to microtubules derived from opposite spindle poles. How stable chromosome bi-orientation is accomplished and coordinated with anaphase onset remains incompletely understood. Here we show that stable chromosome bi-orienta- tion requires inner centromere localization of the non-enzymatic subunits of the chromo- somal passenger complex (CPC) to maintain centromeric cohesion. Precise inner centromere localization of the CPC appears less relevant for Aurora B-dependent resolution of erroneous kinetochore–microtubule (KT–MT) attachments and for the stabilization of bi-oriented KT–MT attachments once sister chromatid cohesion is preserved via knock-down of WAPL. However, Aurora B inner centromere localization is essential for mitotic checkpoint silencing to allow spatial separation from its kinetochore substrate KNL1. Our data infer that the CPC is localized at the inner centromere to sustain centromere cohesion on bi-oriented chromo- somes and to coordinate mitotic checkpoint silencing with chromosome bi-orientation. 1 Department of Molecular Cancer Research, Center for Molecular Medicine, University -
Mutational Inactivation of STAG2 Causes Aneuploidy in Human Cancer
REPORTS mean difference for all rubric score elements was ing becomes a more commonly supported facet 18. C. L. Townsend, E. Heit, Mem. Cognit. 39, 204 (2011). rejected. Univariate statistical tests of the observed of STEM graduate education then students’ in- 19. D. F. Feldon, M. Maher, B. Timmerman, Science 329, 282 (2010). mean differences between the teaching-and- structional training and experiences would alle- 20. B. Timmerman et al., Assess. Eval. High. Educ. 36,509 research and research-only conditions indicated viate persistent concerns that current programs (2011). significant results for the rubric score elements underprepare future STEM faculty to perform 21. No outcome differences were detected as a function of “testability of hypotheses” [mean difference = their teaching responsibilities (28, 29). the type of teaching experience (TA or GK-12) within the P sample population participating in both research and 0.272, = 0.006; CI = (.106, 0.526)] with the null teaching. hypothesis rejected in 99.3% of generated data References and Notes 22. Materials and methods are available as supporting samples (Fig. 1) and “research/experimental de- 1. W. A. Anderson et al., Science 331, 152 (2011). material on Science Online. ” P 2. J. A. Bianchini, D. J. Whitney, T. D. Breton, B. A. Hilton-Brown, 23. R. L. Johnson, J. Penny, B. Gordon, Appl. Meas. Educ. 13, sign [mean difference = 0.317, = 0.002; CI = Sci. Educ. 86, 42 (2001). (.106, 0.522)] with the null hypothesis rejected in 121 (2000). 3. C. E. Brawner, R. M. Felder, R. Allen, R. Brent, 24. R. J. A. Little, J. -
SGOL1 Rabbit Pab
Leader in Biomolecular Solutions for Life Science SGOL1 Rabbit pAb Catalog No.: A16174 Basic Information Background Catalog No. The protein encoded by this gene is a member of the shugoshin family of proteins. This A16174 protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene Observed MW leads to the premature loss of centromeric cohesion, mis-segregation of sister 75kDa chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic Calculated MW prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of 24kDa/29kDa/31kDa/33kDa/35kDa/60 centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been kDa/64kDa associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Category Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher Primary antibody rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. Applications WB, IF Cross-Reactivity Human, Mouse, Rat Recommended Dilutions Immunogen Information WB 1:500 - 1:2000 Gene ID Swiss Prot 151648 Q5FBB7 IF 1:50 - 1:200 Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human SGOL1 (NP_612493.1). Synonyms SGO1;CAID;NY-BR-85;SGO;SGOL1 Contact Product Information Source Isotype Purification www.abclonal.com Rabbit IgG Affinity purification Storage Store at -20℃. -
Genome-Wide CRISPR Screen Reveals SGOL1 As a Druggable Target of Sorafenib-Treated Hepatocellular Carcinoma
Laboratory Investigation (2018) 98:734–744 https://doi.org/10.1038/s41374-018-0027-6 ARTICLE Genome-wide CRISPR screen reveals SGOL1 as a druggable target of sorafenib-treated hepatocellular carcinoma 1,2,3,4 2,3,4 2,3,4 2,3,4 2,3,4 2,3,4 Weijian Sun ● Bin He ● Beng Yang ● Wendi Hu ● Shaobing Cheng ● Heng Xiao ● 2,3,4 2,3,4 2,3,4 2,3,4 1 2,3,4 2,3,4 Zhengjie Yang ● Xiaoyu Wen ● Lin Zhou ● Haiyang Xie ● Xian Shen ● Jian Wu ● Shusen Zheng Received: 28 July 2017 / Revised: 28 December 2017 / Accepted: 6 January 2018 / Published online: 21 February 2018 © United States & Canadian Academy of Pathology 2018 Abstract The genome-wide clustered regularly interspaced short palindromic repeats (CRISPR) screen is a powerful tool used to identify therapeutic targets that can be harnessed for cancer treatment. This study aimed to assess the efficacy of genome- wide CRISPR screening to identify druggable genes associated with sorafenib-treated hepatocellular carcinoma (HCC). A genome-scale CRISPR knockout (GeCKO v2) library containing 123,411 single guide RNAs (sgRNAs) was used to identify loss-of-function mutations conferring sorafenib resistance upon HCC cells. Resistance gene screens identified SGOL1 as an indicator of prognosis of patients treated with sorafenib. Of the 19,050 genes tested, the knockout screen fi 1234567890();,: identi ed inhibition of SGOL1 expression as the most-effective genetic suppressor of sorafenib activity. Analysis of the survival of 210 patients with HCC after hepatic resection revealed that high SGOL1 expression shortened overall survival (P = 0.021). -
Cohesin Mutations in Cancer: Emerging Therapeutic Targets
International Journal of Molecular Sciences Review Cohesin Mutations in Cancer: Emerging Therapeutic Targets Jisha Antony 1,2,*, Chue Vin Chin 1 and Julia A. Horsfield 1,2,3,* 1 Department of Pathology, Otago Medical School, University of Otago, Dunedin 9016, New Zealand; [email protected] 2 Maurice Wilkins Centre for Molecular Biodiscovery, The University of Auckland, Auckland 1010, New Zealand 3 Genetics Otago Research Centre, University of Otago, Dunedin 9016, New Zealand * Correspondence: [email protected] (J.A.); julia.horsfi[email protected] (J.A.H.) Abstract: The cohesin complex is crucial for mediating sister chromatid cohesion and for hierarchal three-dimensional organization of the genome. Mutations in cohesin genes are present in a range of cancers. Extensive research over the last few years has shown that cohesin mutations are key events that contribute to neoplastic transformation. Cohesin is involved in a range of cellular processes; therefore, the impact of cohesin mutations in cancer is complex and can be cell context dependent. Candidate targets with therapeutic potential in cohesin mutant cells are emerging from functional studies. Here, we review emerging targets and pharmacological agents that have therapeutic potential in cohesin mutant cells. Keywords: cohesin; cancer; therapeutics; transcription; synthetic lethal 1. Introduction Citation: Antony, J.; Chin, C.V.; Genome sequencing of cancers has revealed mutations in new causative genes, includ- Horsfield, J.A. Cohesin Mutations in ing those in genes encoding subunits of the cohesin complex. Defects in cohesin function Cancer: Emerging Therapeutic from mutation or amplifications has opened up a new area of cancer research to which Targets. -
The Genetic Program of Pancreatic Beta-Cell Replication in Vivo
Page 1 of 65 Diabetes The genetic program of pancreatic beta-cell replication in vivo Agnes Klochendler1, Inbal Caspi2, Noa Corem1, Maya Moran3, Oriel Friedlich1, Sharona Elgavish4, Yuval Nevo4, Aharon Helman1, Benjamin Glaser5, Amir Eden3, Shalev Itzkovitz2, Yuval Dor1,* 1Department of Developmental Biology and Cancer Research, The Institute for Medical Research Israel-Canada, The Hebrew University-Hadassah Medical School, Jerusalem 91120, Israel 2Department of Molecular Cell Biology, Weizmann Institute of Science, Rehovot, Israel. 3Department of Cell and Developmental Biology, The Silberman Institute of Life Sciences, The Hebrew University of Jerusalem, Jerusalem 91904, Israel 4Info-CORE, Bioinformatics Unit of the I-CORE Computation Center, The Hebrew University and Hadassah, The Institute for Medical Research Israel- Canada, The Hebrew University-Hadassah Medical School, Jerusalem 91120, Israel 5Endocrinology and Metabolism Service, Department of Internal Medicine, Hadassah-Hebrew University Medical Center, Jerusalem 91120, Israel *Correspondence: [email protected] Running title: The genetic program of pancreatic β-cell replication 1 Diabetes Publish Ahead of Print, published online March 18, 2016 Diabetes Page 2 of 65 Abstract The molecular program underlying infrequent replication of pancreatic beta- cells remains largely inaccessible. Using transgenic mice expressing GFP in cycling cells we sorted live, replicating beta-cells and determined their transcriptome. Replicating beta-cells upregulate hundreds of proliferation- related genes, along with many novel putative cell cycle components. Strikingly, genes involved in beta-cell functions, namely glucose sensing and insulin secretion were repressed. Further studies using single molecule RNA in situ hybridization revealed that in fact, replicating beta-cells double the amount of RNA for most genes, but this upregulation excludes genes involved in beta-cell function. -
Anti-SGOL1 (Full Length) Polyclonal Antibody (DPABH-10476) This Product Is for Research Use Only and Is Not Intended for Diagnostic Use
Anti-SGOL1 (full length) polyclonal antibody (DPABH-10476) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION Antigen Description Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity. Immunogen Full length protein corresponding to Human Shugoshin aa 1-292.Sequence: MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNT STLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALK GKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPG QGESFQIEATPPETQQSPHLSLKDITNVSL Isotype IgG Source/Host Mouse Species Reactivity Human Purification Protein A purified Conjugate Unconjugated Applications WB Format Liquid Size 50 μg Buffer pH: 7.20; Constituent: 100% PBS Preservative None 45-1 Ramsey Road, Shirley, NY 11967, USA Email: [email protected] Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved Storage Shipped at 4°C. Store at 4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Genome-Wide Mapping in a House Mouse Hybrid Zone Reveals Hybrid Sterility Loci and Dobzhansky-Muller Interactions Leslie M Turner1,2, Bettina Harr1*
RESEARCH ARTICLE elifesciences.org Genome-wide mapping in a house mouse hybrid zone reveals hybrid sterility loci and Dobzhansky-Muller interactions Leslie M Turner1,2, Bettina Harr1* 1Department of Evolutionary Genetics, Max Planck Institute for Evolutionary Biology, Plön, Germany; 2Laboratory of Genetics, University of Wisconsin, Madison, United States Abstract Mapping hybrid defects in contact zones between incipient species can identify genomic regions contributing to reproductive isolation and reveal genetic mechanisms of speciation. The house mouse features a rare combination of sophisticated genetic tools and natural hybrid zones between subspecies. Male hybrids often show reduced fertility, a common reproductive barrier between incipient species. Laboratory crosses have identified sterility loci, but each encompasses hundreds of genes. We map genetic determinants of testis weight and testis gene expression using offspring of mice captured in a hybrid zone between M. musculus musculus and M. m. domesticus. Many generations of admixture enables high-resolution mapping of loci contributing to these sterility-related phenotypes. We identify complex interactions among sterility loci, suggesting multiple, non-independent genetic incompatibilities contribute to barriers to gene flow in the hybrid zone. DOI: 10.7554/eLife.02504.001 Introduction *For correspondence: harr@ New species arise when reproductive barriers form, preventing gene flow between populations evolbio.mpg.de (Coyne and Orr, 2004). Recently, two approaches have substantially -
Comparative Profiling Identifies C13orf3 As a Component of the Ska
The EMBO Journal (2009) 28, 1453–1465 | & 2009 European Molecular Biology Organization | Some Rights Reserved 0261-4189/09 www.embojournal.org TTHEH E EEMBOMBO JJOURNALOURN AL Comparative profiling identifies C13orf3 as a EMBO component of the Ska complex required for open mammalian cell division This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits distribution, and reproduction inany medium, provided the original authorand sourceare credited.This license does not permit commercial exploitation without specific permission. Mirko Theis1, Mikolaj Slabicki1, Subject Categories: cell cycle; genomics & computational Magno Junqueira1, Maciej Paszkowski- biology Rogacz1, Jana Sontheimer2, Ralf Kittler1,4, Keywords: esiRNA; kinetochore; shugoshin; Ska; spindle Anne-Kristine Heninger1, Timo Glatter3, checkpoint Kristi Kruusmaa1, Ina Poser1, Anthony A Hyman1, M Teresa Pisabarro2, Matthias Gstaiger3, Rudolf Aebersold3, Andrej Shevchenko1 and Frank Buchholz1,* 1Max Planck Institute for Molecular Cell Biology and Genetics, Dresden, Introduction Germany, 2Structural Bioinformatics, BIOTEC TU Dresden, Dresden, Germany and 3Institute for Molecular Systems Biology, ETH, Zu¨rich, Cell division and mitosis of eukaryotic somatic cells require Switzerland the coordinated function of many proteins in a temporally and spatially well-orchestrated process (Nigg, 2001; Proliferation of mammalian cells requires the coordinated Nasmyth, 2002; Varetti and Musacchio, 2008). Mitosis can function of many proteins -
Cell Cycle Arrest Through Indirect Transcriptional Repression by P53: I Have a DREAM
Cell Death and Differentiation (2018) 25, 114–132 Official journal of the Cell Death Differentiation Association OPEN www.nature.com/cdd Review Cell cycle arrest through indirect transcriptional repression by p53: I have a DREAM Kurt Engeland1 Activation of the p53 tumor suppressor can lead to cell cycle arrest. The key mechanism of p53-mediated arrest is transcriptional downregulation of many cell cycle genes. In recent years it has become evident that p53-dependent repression is controlled by the p53–p21–DREAM–E2F/CHR pathway (p53–DREAM pathway). DREAM is a transcriptional repressor that binds to E2F or CHR promoter sites. Gene regulation and deregulation by DREAM shares many mechanistic characteristics with the retinoblastoma pRB tumor suppressor that acts through E2F elements. However, because of its binding to E2F and CHR elements, DREAM regulates a larger set of target genes leading to regulatory functions distinct from pRB/E2F. The p53–DREAM pathway controls more than 250 mostly cell cycle-associated genes. The functional spectrum of these pathway targets spans from the G1 phase to the end of mitosis. Consequently, through downregulating the expression of gene products which are essential for progression through the cell cycle, the p53–DREAM pathway participates in the control of all checkpoints from DNA synthesis to cytokinesis including G1/S, G2/M and spindle assembly checkpoints. Therefore, defects in the p53–DREAM pathway contribute to a general loss of checkpoint control. Furthermore, deregulation of DREAM target genes promotes chromosomal instability and aneuploidy of cancer cells. Also, DREAM regulation is abrogated by the human papilloma virus HPV E7 protein linking the p53–DREAM pathway to carcinogenesis by HPV.Another feature of the pathway is that it downregulates many genes involved in DNA repair and telomere maintenance as well as Fanconi anemia. -
Autocrine IFN Signaling Inducing Profibrotic Fibroblast Responses By
Downloaded from http://www.jimmunol.org/ by guest on September 23, 2021 Inducing is online at: average * The Journal of Immunology , 11 of which you can access for free at: 2013; 191:2956-2966; Prepublished online 16 from submission to initial decision 4 weeks from acceptance to publication August 2013; doi: 10.4049/jimmunol.1300376 http://www.jimmunol.org/content/191/6/2956 A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Autocrine IFN Signaling Feng Fang, Kohtaro Ooka, Xiaoyong Sun, Ruchi Shah, Swati Bhattacharyya, Jun Wei and John Varga J Immunol cites 49 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2013/08/20/jimmunol.130037 6.DC1 This article http://www.jimmunol.org/content/191/6/2956.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2013 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 23, 2021. The Journal of Immunology A Synthetic TLR3 Ligand Mitigates Profibrotic Fibroblast Responses by Inducing Autocrine IFN Signaling Feng Fang,* Kohtaro Ooka,* Xiaoyong Sun,† Ruchi Shah,* Swati Bhattacharyya,* Jun Wei,* and John Varga* Activation of TLR3 by exogenous microbial ligands or endogenous injury-associated ligands leads to production of type I IFN. -
Cohesin Complex-Associated Holoprosencephaly
This is a repository copy of Cohesin complex-associated holoprosencephaly. White Rose Research Online URL for this paper: https://eprints.whiterose.ac.uk/175395/ Version: Accepted Version Article: Kruszka, P., Berger, S.I., Casa, V. et al. (32 more authors) (2019) Cohesin complex- associated holoprosencephaly. Brain, 142 (9). pp. 2631-2643. ISSN 0006-8950 https://doi.org/10.1093/brain/awz210 This is a pre-copyedited, author-produced version of an article accepted for publication in Brain following peer review. The version of record Paul Kruszka, Seth I Berger, Valentina Casa, Mike R Dekker, Jenna Gaesser, Karin Weiss, Ariel F Martinez, David R Murdock, Raymond J Louie, Eloise J Prijoles, Angie W Lichty, Oebele F Brouwer, Evelien Zonneveld-Huijssoon, Mark J Stephan, Jacob Hogue, Ping Hu, Momoko Tanima-Nagai, Joshua L Everson, Chitra Prasad, Anna Cereda, Maria Iascone, Allison Schreiber, Vickie Zurcher, Nicole Corsten-Janssen, Luis Escobar, Nancy J Clegg, Mauricio R Delgado, Omkar Hajirnis, Meena Balasubramanian, Hülya Kayserili, Matthew Deardorff, Raymond A Poot, Kerstin S Wendt, Robert J Lipinski, Maximilian Muenke, Cohesin complex- associated holoprosencephaly, Brain, Volume 142, Issue 9, September 2019, Pages 2631–2643 is available online at: https://doi.org/10.1093/brain/awz210 Reuse Items deposited in White Rose Research Online are protected by copyright, with all rights reserved unless indicated otherwise. They may be downloaded and/or printed for private study, or other acts as permitted by national copyright laws. The publisher or other rights holders may allow further reproduction and re-use of the full text version. This is indicated by the licence information on the White Rose Research Online record for the item.