DOCSLIB.ORG

Sequence Specificity of Src Homology 2 Domains

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Sequence Specificity of Src Homology 2 Domains SEQUENCE SPECIFICITY OF SRC HOMOLOGY 2 DOMAINS DISSERTATION Presented in Partial Fulfillment of the Requirements for the Degree Doctor of Philosophy in the Graduate School of The Ohio State University By Pauline H. Tan, B. S. Graduate Program in Chemistry The Ohio State University 2011 Committee: Professor Dehua Pei, Advisor Professor Jennifer J. Ottesen Professor Karin Musier-Forsyth Copyright by Pauline H. Tan 2011 ABSTRACT Src-homology domains are small modular domains that recognize phosphotyrosine-containing proteins and couple activated protein kinases to intracellular signaling pathways. Since they often have overlapping functions, their SH2 domains often compete for binding to the same pY proteins. Determining their sequence specificities will help identify target proteins. Consequently, this will help understand the molecular basis for their cellular functions. Twenty-six kinase SH2 domains were screened against a phosphotyrosyl (pY) peptide library, and positive beads were sequenced by partial Edman degradation and mass spectrometry. The data revealed that the kinase family SH2 domains selected a class of pY peptides consisting of mostly hydrophilic and hydrophobic residues at the pY+1 and pY+3 positions, respectively. After validating their binding, the literature was searched to find known SH2 targets and their pY motifs. Seventeen SH2 domains from several different protein families were also purified, screened, and sequenced to determine their binding motifs. The majority of the SH2 domains had high selectivity at the pY+3 or pY+1 position with a few selecting for multiple peptide classes. For example Vav1 and Vav2 SH2 domains selected for three classes of peptides. These minor classes of peptides may be motifs of new protein targets that have not been identified yet. Some SH2 domains such as the Grb7 family, HSH2D, ii and Vav family had high selectivity of Asn at the +2 position but little selectivity at other positions. More subtle differences were observed between protein families at certain positions. For instance, SH2 domains from a family of GTPase signaling proteins preferred Pro at the +3 position, while SH2 domains from the PIK3 family preferred norleucine at the +3 position. Genetic disorders such as Noonan’s syndrome and hematologic disorders such as juvenile myelomonocytic leukemia are caused by mutations in the SHP2 (PTPN11) gene. The mutations are mainly located in the SH2 binding cleft or in the NSH2/PTP interface. Mutations in the SH2 binding cleft may alter sequence specificity, resulting in new potential binding partners. Identifying novel binding partners may help lead to a better understanding of the complex mechanism of these disorders. Five SHP2 SH2 mutants were screened against a combinatorial phosphotyrosyl (pY) peptide library, and positive hits were sequenced. Only the T52S SH2 mutant exhibited a specificity switch from small to large branched hydrophobic residues at the +1 position. The T42A and L43F SH2 mutants exhibited increased binding affinities. In contrast, the specificities and binding of E76K and E139D SH2 mutants remained unchanged. After examining the crystal structure generated by PyMOL, altered specificity involved a substitution of a bulky Thr with a smaller Ser residue allowing more space for larger branched residues. The T52S consensus was entered into a protein database to search for new protein targets that bind to the mutant only. Twenty-six potential targets resulting from the database search were identified for the T52S mutant. iii DEDICATION Dedicated to my family iv ACKNOWLEDGMENTS I would like to thank my advisor Dr. Dehua Pei for his constant intellectual guidance and encouragement throughout these years. His dedication to science will serve as guide for me to achieve in my career. My experience in the Pei lab has provided me many opportunities to grow not only as a scientist but also as a person. I also wish to thank my committee members for guiding me during my candidacy and dissertation defense. I am deeply indebted to my senior labmates Dr. Anne-Sophie Wavreille and Dr. Yanyan Zhang, for their guidance on the projects and answering many questions. I would also like to thank my colleagues Dr. Qing Xiao, Dr. Amit Thakkar, Dr. Tao Liu, Dr. Xianwen Chen, Nick Selner, Tiffany Meyer, and Andrew Kunys, and the rest of the Pei lab members, past and present, for their support, friendship and intellectual discussions at lunchtime. Finally I wish to thank my parents and sister for their unconditional love, moral support, and encouragement. I would like to thank my parents for teaching me to work hard and achieve to my best ability. I also want to thank my sister Stephanie for her friendship and support throughout these years. Without hard work and family support, I would not be where I am now. v VITA June 2005 .......................................................B. S. in Chemistry & Biochemistry The Ohio State University 2005-2011 ......................................................Graduate Teaching and Research Associate The Ohio State University PUBLICATIONS 1. Chen, X., Tan, P., Zhang, Y. and Pei, D., “On-bead screening of combinatorial libraries: reduction of nonspecific binding by decreasing surface ligand density”, J. Comb. Chem. 2009, 11, 604-611. FIELDS OF STUDY Major Field: Chemistry vi TABLE OF CONTENTS Abstract ............................................................................................................................... ii Dedication .......................................................................................................................... iv Acknowledgments............................................................................................................... v Vita ..................................................................................................................................... vi List of Tables .................................................................................................................... xii List of Figures ................................................................................................................... xv List of Abbreviations ...................................................................................................... xvii Chapter 1 Introduction ........................................................................................................ 1 1.1. SH2 Domains .......................................................................................................... 1 1.2. Other Methods to determine the SH2 specificity .................................................... 5 1.2.1 Solution phase pooled library ............................................................................ 5 1.2.2. Microarray library (Oriented peptide array library (OPAL)) ........................... 6 1.2.3. One bead one compound library (OBOC) ........................................................ 7 1.2.4. Phage display .................................................................................................. 12 1.2.5. Two-hybrid systems ....................................................................................... 13 vii Chapter 2 Specificity of kinase SH2 domains .................................................................. 15 2.1. Introduction ........................................................................................................... 15 2.2. Experimental Procedures....................................................................................... 19 2.2.1 Materials .......................................................................................................... 19 2.2.2. Synthesis of the pY library and individual peptides ....................................... 20 2.2.3. SH2 constructs ................................................................................................ 22 2.2.4. Protein expression and purification ................................................................ 23 2.2.5. SH2 protein labeling ....................................................................................... 24 2.2.6. pY library screening ....................................................................................... 25 2.2.7. Partial Edman degradation.............................................................................. 26 2.2.8. Synthesis of individual pY peptides ............................................................... 27 2.2.9. Determination of dissociation constants by SPR ............................................ 28 2.2.10. Determination of dissociation constants by fluorescence polarization ........ 29 2.3. Results ................................................................................................................... 29 2.3.1. pY library synthesis and screening ................................................................. 30 2.3.2. General specificity of the kinase family SH2 domains .................................. 31 2.3.3. Sequence specificity of Src family kinase SH2 domains ............................... 31 2.3.4. Abl1 and Abl2 SH2 domains .......................................................................... 44 2.3.5. Csk and MATK SH2 domains ........................................................................ 48 viii 2.3.6. Fes and Fer SH2 domains ............................................................................... 51 2.3.7. Tec family kinase SH2 domains ....................................................................
Load more

Recommended publications
  • Regulation of the Src Family Kinases by Csk Masato Okada
    Int. J. Biol. Sci. 2012, 8 1385 Ivyspring International Publisher International Journal of Biological Sciences 2012; 8(10):1385-1397. doi: 10.7150/ijbs.5141 Review Regulation of the Src Family Kinases by Csk Masato Okada Department of Oncogene Research, Research Institute for Microbial Diseases, Osaka University, 3-1 Yamada-oka, Suita, Osaka 565-0871, JAPAN. Corresponding author: TEL: 81-6-6879-8297 FAX: 81-6-6879-8298, E-mail: [email protected]. © Ivyspring International Publisher. This is an open-access article distributed under the terms of the Creative Commons License (http://creativecommons.org/ licenses/by-nc-nd/3.0/). Reproduction is permitted for personal, noncommercial use, provided that the article is in whole, unmodified, and properly cited. Received: 2012.08.31; Accepted: 2012.10.01; Published: 2012.11.01 Abstract The non-receptor tyrosine kinase Csk serves as an indispensable negative regulator of the Src family tyrosine kinases (SFKs) by specifically phosphorylating the negative regulatory site of SFKs, thereby suppressing their oncogenic potential. Csk is primarily regulated through its SH2 domain, which is required for membrane translocation of Csk via binding to scaffold proteins such as Cbp/PAG1. The binding of scaffolds to the SH2 domain can also upregulate Csk kinase activity. These regulatory features have been elucidated by analyses of Csk structure at the atomic levels. Although Csk itself may not be mutated in human cancers, perturbation of the regulatory system consisting of Csk, Cbp/PAG1, or other scaffolds, and certain tyrosine phosphatases may explain the upregulation of SFKs frequently observed in human cancers. This review focuses on the molecular bases for the function, structure, and regulation of Csk as a unique regulatory tyrosine kinase for SFKs.
    [Show full text]
  • SRC Antibody - N-Terminal Region (ARP32476 P050) Data Sheet
    SRC antibody - N-terminal region (ARP32476_P050) Data Sheet Product Number ARP32476_P050 Product Name SRC antibody - N-terminal region (ARP32476_P050) Size 50ug Gene Symbol SRC Alias Symbols ASV; SRC1; c-SRC; p60-Src Nucleotide Accession# NM_005417 Protein Size (# AA) 536 amino acids Molecular Weight 60kDa Product Format Lyophilized powder NCBI Gene Id 6714 Host Rabbit Clonality Polyclonal Official Gene Full Name V-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) Gene Family SH2D This is a rabbit polyclonal antibody against SRC. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 Description products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire (). Peptide Sequence Synthetic peptide located within the following region: QTPSKPASADGHRGPSAAFAPAAAEPKLFGGFNSSDTVTSPQRAGPLAGG This gene is highly similar to the v-src gene of Rous sarcoma virus. This proto-oncogene may play a role in the Description of Target regulation of embryonic development and cell growth. SRC protein is a tyrosine-protein kinase whose activity can be inhibited by phosphorylation by c-SRC kinase. Mutations in this gene could be involved in the
    [Show full text]
  • Deregulated Gene Expression Pathways in Myelodysplastic Syndrome Hematopoietic Stem Cells
    Leukemia (2010) 24, 756–764 & 2010 Macmillan Publishers Limited All rights reserved 0887-6924/10 $32.00 www.nature.com/leu ORIGINAL ARTICLE Deregulated gene expression pathways in myelodysplastic syndrome hematopoietic stem cells A Pellagatti1, M Cazzola2, A Giagounidis3, J Perry1, L Malcovati2, MG Della Porta2,MJa¨dersten4, S Killick5, A Verma6, CJ Norbury7, E Hellstro¨m-Lindberg4, JS Wainscoat1 and J Boultwood1 1LRF Molecular Haematology Unit, NDCLS, John Radcliffe Hospital, Oxford, UK; 2Department of Hematology Oncology, University of Pavia Medical School, Fondazione IRCCS Policlinico San Matteo, Pavia, Italy; 3Medizinische Klinik II, St Johannes Hospital, Duisburg, Germany; 4Division of Hematology, Department of Medicine, Karolinska Institutet, Stockholm, Sweden; 5Department of Haematology, Royal Bournemouth Hospital, Bournemouth, UK; 6Albert Einstein College of Medicine, Bronx, NY, USA and 7Sir William Dunn School of Pathology, University of Oxford, Oxford, UK To gain insight into the molecular pathogenesis of the the World Health Organization.6,7 Patients with refractory myelodysplastic syndromes (MDS), we performed global gene anemia (RA) with or without ringed sideroblasts, according to expression profiling and pathway analysis on the hemato- poietic stem cells (HSC) of 183 MDS patients as compared with the the French–American–British classification, were subdivided HSC of 17 healthy controls. The most significantly deregulated based on the presence or absence of multilineage dysplasia. In pathways in MDS include interferon signaling, thrombopoietin addition, patients with RA with excess blasts (RAEB) were signaling and the Wnt pathways. Among the most signifi- subdivided into two categories, RAEB1 and RAEB2, based on the cantly deregulated gene pathways in early MDS are immuno- percentage of bone marrow blasts.
    [Show full text]
  • Gene Symbol Gene Description ACVR1B Activin a Receptor, Type IB
    Table S1. Kinase clones included in human kinase cDNA library for yeast two-hybrid screening Gene Symbol Gene Description ACVR1B activin A receptor, type IB ADCK2 aarF domain containing kinase 2 ADCK4 aarF domain containing kinase 4 AGK multiple substrate lipid kinase;MULK AK1 adenylate kinase 1 AK3 adenylate kinase 3 like 1 AK3L1 adenylate kinase 3 ALDH18A1 aldehyde dehydrogenase 18 family, member A1;ALDH18A1 ALK anaplastic lymphoma kinase (Ki-1) ALPK1 alpha-kinase 1 ALPK2 alpha-kinase 2 AMHR2 anti-Mullerian hormone receptor, type II ARAF v-raf murine sarcoma 3611 viral oncogene homolog 1 ARSG arylsulfatase G;ARSG AURKB aurora kinase B AURKC aurora kinase C BCKDK branched chain alpha-ketoacid dehydrogenase kinase BMPR1A bone morphogenetic protein receptor, type IA BMPR2 bone morphogenetic protein receptor, type II (serine/threonine kinase) BRAF v-raf murine sarcoma viral oncogene homolog B1 BRD3 bromodomain containing 3 BRD4 bromodomain containing 4 BTK Bruton agammaglobulinemia tyrosine kinase BUB1 BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast) BUB1B BUB1 budding uninhibited by benzimidazoles 1 homolog beta (yeast) C9orf98 chromosome 9 open reading frame 98;C9orf98 CABC1 chaperone, ABC1 activity of bc1 complex like (S. pombe) CALM1 calmodulin 1 (phosphorylase kinase, delta) CALM2 calmodulin 2 (phosphorylase kinase, delta) CALM3 calmodulin 3 (phosphorylase kinase, delta) CAMK1 calcium/calmodulin-dependent protein kinase I CAMK2A calcium/calmodulin-dependent protein kinase (CaM kinase) II alpha CAMK2B calcium/calmodulin-dependent
    [Show full text]
  • Fgr and Hck Neutrophils Requires the Src Family Kinases Adhesion-Dependent Degranulation Of
    Adhesion-Dependent Degranulation of Neutrophils Requires the Src Family Kinases Fgr and Hck This information is current as Attila Mócsai, Erzsébet Ligeti, Clifford A. Lowell and of September 25, 2021. Giorgio Berton J Immunol 1999; 162:1120-1126; ; http://www.jimmunol.org/content/162/2/1120 Downloaded from References This article cites 36 articles, 23 of which you can access for free at: http://www.jimmunol.org/content/162/2/1120.full#ref-list-1 Why The JI? Submit online. http://www.jimmunol.org/ • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average by guest on September 25, 2021 Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 1999 by The American Association of Immunologists All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Adhesion-Dependent Degranulation of Neutrophils Requires the Src Family Kinases Fgr and Hck1 Attila Mo´csai,2*† Erzse´bet Ligeti,† Clifford A. Lowell,‡ and Giorgio Berton3* Polymorphonuclear neutrophils (PMN) adherent to integrin ligands respond to inflammatory mediators by reorganizing their cytoskeleton and releasing reactive oxygen intermediates. As Src family tyrosine kinases are implicated in these responses, we investigated their possible role in regulating degranulation.
    [Show full text]
  • Cytokine Signaling Through the Novel Tyrosine Kinase RAFTK in Kaposi's
    Cytokine Signaling Through the Novel Tyrosine Kinase RAFTK in Kaposi’s Sarcoma Cells Zhong-Ying Liu,* Ramesh K. Ganju,*Jian-Feng Wang,* Mel A. Ona,* William C. Hatch,* Tong Zheng,‡ Shalom Avraham,* Parkash Gill,‡ and Jerome E. Groopman* *Divisions of Experimental Medicine and Hematology/Oncology, Beth Israel Deaconess Medical Center, Harvard Medical School, Boston, Massachusetts 02215; and ‡Division of Hematology/Oncology, Norris Cancer Center, University of Southern California, Los Angeles, California 90033 Abstract believed to be from the lymphatic endothelium (1–2). Etiolog- ical factors implicated in KS include the recently discovered A number of cytokines, including basic fibroblast growth human herpesvirus 8 (HHV-8)/Kaposi’s sarcoma herpesvirus factor (bFGF), vascular endothelial growth factor (VEGF), (KSHV) and TAT, the soluble transcriptional activator of oncostatin M (OSM), IL-6, and tumor necrosis factor alpha HIV (3–7). Considerable data indicate a role for endogenous (TNF-a), have been postulated to have a role in the patho- and exogenous cytokines in the pathogenesis of KS (8–16). genesis of Kaposi’s sarcoma (KS). The proliferative effects Growth factors such as basic fibroblast growth factor (bFGF) of bFGF and OSM may be via their reported activation of and vascular endothelial growth factor (VEGF), which are the c-Jun NH2-terminal kinase (JNK) signaling pathway in known to stimulate the mitogenesis of certain types of endo- KS cells. We now report that KS cells express a recently thelium, as well as Oncostatin M (OSM), IL-6, and tumor ne- identified focal adhesion kinase termed RAFTK which ap- crosis factor alpha (TNF-a) which are elaborated during in- pears in other cell systems to coordinate surface signals be- flammatory conditions, have been implicated in promoting KS tween cytokine and integrin receptors and the cytoskeleton cell growth (17–25).
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • The Multifaceted Role of CMA in Glioma: Enemy Or Ally?
    International Journal of Molecular Sciences Review The Multifaceted Role of CMA in Glioma: Enemy or Ally? Alessia Lo Dico 1,† , Cristina Martelli 1,† , Cecilia Diceglie 1 and Luisa Ottobrini 1,2,* 1 Department of Pathophysiology and Transplantation, University of Milan, Via F.Cervi 93, Segrate, 20090 Milan, Italy; [email protected] (A.L.D.); [email protected] (C.M.); [email protected] (C.D.) 2 Institute of Molecular Bioimaging and Physiology, National Research Council (IBFM-CNR), Via F.Cervi 93, Segrate, 20090 Milan, Italy * Correspondence: [email protected]; Tel.: +39-02(50)-330-404; Fax: +39-02(50)-330-425 † Authors contributed equally to this work. Abstract: Chaperone-mediated autophagy (CMA) is a catabolic pathway fundamental for cell home- ostasis, by which specific damaged or non-essential proteins are degraded. CMA activity has three main levels of regulation. The first regulatory level is based on the targetability of specific proteins possessing a KFERQ-like domain, which can be recognized by specific chaperones and delivered to the lysosomes. Target protein unfolding and translocation into the lysosomal lumen constitutes the second level of CMA regulation and is based on the modulation of Lamp2A multimerization. Finally, the activity of some accessory proteins represents the third regulatory level of CMA activity. CMA’s role in oncology has not been fully clarified covering both pro-survival and pro-death roles in different contexts. Taking all this into account, it is possible to comprehend the actual complexity of both CMA regulation and the cellular consequences of its activity allowing it to be elected as a modulatory and not only catabolic machinery.
    [Show full text]
  • The LRRC8A:C Heteromeric Channel Is a Cgamp Transporter and the Dominant
    bioRxiv preprint doi: https://doi.org/10.1101/2020.02.13.948273; this version posted February 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. The LRRC8A:C Heteromeric Channel Is a cGAMP Transporter and the Dominant cGAMP Importer in Human Vasculature Cells Lauren J. Lahey1,2, Xianlan Wen3, Rachel E. Mardjuki2,4, Volker Böhnert2,5, Christopher Ritchie2,5, Jacqueline A. Carozza2,4, Gaelen T. Hess2,6, Merritt Maduke3, Michael C. Bassik2,6, and Lingyin Li2,5,7,* 1Biophysics Program, 2Stanford ChEM-H, 3Department of Molecular and Cellular Physiology, 4Department of Chemistry, 5Department of Biochemistry, 6Department of Genetics, Stanford University School of Medicine, Stanford, CA 94305 USA. 7Lead Contact *Correspondence: [email protected] bioRxiv preprint doi: https://doi.org/10.1101/2020.02.13.948273; this version posted February 14, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. SUMMARY Extracellular 2'3'-cyclic-GMP-AMP (cGAMP) is an immunotransmitter secreted by cancer cells and taken up by host cells to activate the anti-cancer STING pathway. No cGAMP exporter has been identified, and SLC19A1, a recently identified cGAMP importer, does not account for the import actiVity in most cell types. Here, we identify the LRRC8A:C heteromeric channel, a volume-regulated anion channel (VRAC), as a cGAMP transporter. This channel mediates cGAMP import or export depending on the cGAMP chemical gradient. cGAMP influences anion influx through VRAC, indicating it is likely a direct substrate of the channel.
    [Show full text]
  • 4-6 Weeks Old Female C57BL/6 Mice Obtained from Jackson Labs Were Used for Cell Isolation
    Methods Mice: 4-6 weeks old female C57BL/6 mice obtained from Jackson labs were used for cell isolation. Female Foxp3-IRES-GFP reporter mice (1), backcrossed to B6/C57 background for 10 generations, were used for the isolation of naïve CD4 and naïve CD8 cells for the RNAseq experiments. The mice were housed in pathogen-free animal facility in the La Jolla Institute for Allergy and Immunology and were used according to protocols approved by the Institutional Animal Care and use Committee. Preparation of cells: Subsets of thymocytes were isolated by cell sorting as previously described (2), after cell surface staining using CD4 (GK1.5), CD8 (53-6.7), CD3ε (145- 2C11), CD24 (M1/69) (all from Biolegend). DP cells: CD4+CD8 int/hi; CD4 SP cells: CD4CD3 hi, CD24 int/lo; CD8 SP cells: CD8 int/hi CD4 CD3 hi, CD24 int/lo (Fig S2). Peripheral subsets were isolated after pooling spleen and lymph nodes. T cells were enriched by negative isolation using Dynabeads (Dynabeads untouched mouse T cells, 11413D, Invitrogen). After surface staining for CD4 (GK1.5), CD8 (53-6.7), CD62L (MEL-14), CD25 (PC61) and CD44 (IM7), naïve CD4+CD62L hiCD25-CD44lo and naïve CD8+CD62L hiCD25-CD44lo were obtained by sorting (BD FACS Aria). Additionally, for the RNAseq experiments, CD4 and CD8 naïve cells were isolated by sorting T cells from the Foxp3- IRES-GFP mice: CD4+CD62LhiCD25–CD44lo GFP(FOXP3)– and CD8+CD62LhiCD25– CD44lo GFP(FOXP3)– (antibodies were from Biolegend). In some cases, naïve CD4 cells were cultured in vitro under Th1 or Th2 polarizing conditions (3, 4).
    [Show full text]
  • Interactions of Cbl with Grb2 and Phosphatidylinositol 3'-Kinase in Activated Jurkat Cells
    University of Massachusetts Medical School eScholarship@UMMS Open Access Articles Open Access Publications by UMMS Authors 1995-07-01 Interactions of Cbl with Grb2 and phosphatidylinositol 3'-kinase in activated Jurkat cells Herman Meisner University of Massachusetts Medical School Et al. Let us know how access to this document benefits ou.y Follow this and additional works at: https://escholarship.umassmed.edu/oapubs Part of the Life Sciences Commons, and the Medicine and Health Sciences Commons Repository Citation Meisner H, Conway BR, Hartley DA, Czech MP. (1995). Interactions of Cbl with Grb2 and phosphatidylinositol 3'-kinase in activated Jurkat cells. Open Access Articles. Retrieved from https://escholarship.umassmed.edu/oapubs/1457 This material is brought to you by eScholarship@UMMS. It has been accepted for inclusion in Open Access Articles by an authorized administrator of eScholarship@UMMS. For more information, please contact [email protected]. MOLECULAR AND CELLULAR BIOLOGY, July 1995, p. 3571–3578 Vol. 15, No. 7 0270-7306/95/$04.0010 Copyright q 1995, American Society for Microbiology Interactions of Cbl with Grb2 and Phosphatidylinositol 39-Kinase in Activated Jurkat Cells HERMAN MEISNER, BRUCE R. CONWAY, DAVID HARTLEY, AND MICHAEL P. CZECH* Program in Molecular Medicine and Department of Biochemistry and Molecular Biology, University of Massachusetts Medical School, Worcester, Massachusetts 01605 Received 28 December 1994/Returned for modification 20 February 1995/Accepted 31 March 1995 T-cell receptor (TCR) cross-linking increases tyrosine phosphorylation of multiple proteins, only a few of which have been identified. One of the most rapidly tyrosine-phosphorylated polypeptides is the 120-kDa product of the proto-oncogene c-cbl, a cytosolic and cytoskeletal protein containing multiple proline-rich motifs that are potential binding sites for proteins containing Src homology 3 (SH3) domains.
    [Show full text]
  • Profiling Data
    Compound Name DiscoveRx Gene Symbol Entrez Gene Percent Compound Symbol Control Concentration (nM) JNK-IN-8 AAK1 AAK1 69 1000 JNK-IN-8 ABL1(E255K)-phosphorylated ABL1 100 1000 JNK-IN-8 ABL1(F317I)-nonphosphorylated ABL1 87 1000 JNK-IN-8 ABL1(F317I)-phosphorylated ABL1 100 1000 JNK-IN-8 ABL1(F317L)-nonphosphorylated ABL1 65 1000 JNK-IN-8 ABL1(F317L)-phosphorylated ABL1 61 1000 JNK-IN-8 ABL1(H396P)-nonphosphorylated ABL1 42 1000 JNK-IN-8 ABL1(H396P)-phosphorylated ABL1 60 1000 JNK-IN-8 ABL1(M351T)-phosphorylated ABL1 81 1000 JNK-IN-8 ABL1(Q252H)-nonphosphorylated ABL1 100 1000 JNK-IN-8 ABL1(Q252H)-phosphorylated ABL1 56 1000 JNK-IN-8 ABL1(T315I)-nonphosphorylated ABL1 100 1000 JNK-IN-8 ABL1(T315I)-phosphorylated ABL1 92 1000 JNK-IN-8 ABL1(Y253F)-phosphorylated ABL1 71 1000 JNK-IN-8 ABL1-nonphosphorylated ABL1 97 1000 JNK-IN-8 ABL1-phosphorylated ABL1 100 1000 JNK-IN-8 ABL2 ABL2 97 1000 JNK-IN-8 ACVR1 ACVR1 100 1000 JNK-IN-8 ACVR1B ACVR1B 88 1000 JNK-IN-8 ACVR2A ACVR2A 100 1000 JNK-IN-8 ACVR2B ACVR2B 100 1000 JNK-IN-8 ACVRL1 ACVRL1 96 1000 JNK-IN-8 ADCK3 CABC1 100 1000 JNK-IN-8 ADCK4 ADCK4 93 1000 JNK-IN-8 AKT1 AKT1 100 1000 JNK-IN-8 AKT2 AKT2 100 1000 JNK-IN-8 AKT3 AKT3 100 1000 JNK-IN-8 ALK ALK 85 1000 JNK-IN-8 AMPK-alpha1 PRKAA1 100 1000 JNK-IN-8 AMPK-alpha2 PRKAA2 84 1000 JNK-IN-8 ANKK1 ANKK1 75 1000 JNK-IN-8 ARK5 NUAK1 100 1000 JNK-IN-8 ASK1 MAP3K5 100 1000 JNK-IN-8 ASK2 MAP3K6 93 1000 JNK-IN-8 AURKA AURKA 100 1000 JNK-IN-8 AURKA AURKA 84 1000 JNK-IN-8 AURKB AURKB 83 1000 JNK-IN-8 AURKB AURKB 96 1000 JNK-IN-8 AURKC AURKC 95 1000 JNK-IN-8
    [Show full text]