OSTA (SLC51A) Rabbit Polyclonal Antibody – TA338900 | Origene

Total Page：16

File Type：pdf, Size：1020Kb

OSTA (SLC51A) Rabbit Polyclonal Antibody – TA338900 | Origene

OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA338900 OSTA (SLC51A) Rabbit Polyclonal Antibody Product data: Product Type: Primary Antibodies Applications: WB Recommended Dilution: WB Reactivity: Human Host: Rabbit Isotype: IgG Clonality: Polyclonal Immunogen: The immunogen for anti-OSTalpha antibody: synthetic peptide directed towards the middle region of human OSTalpha. Synthetic peptide located within the following region: LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. Concentration: lot specific Purification: Protein A purified Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 38 kDa Gene Name: solute carrier family 51 alpha subunit Database Link: NP_689885 Entrez Gene 200931 Human Q86UW1 Background: SLC51A is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood.SLC51A efficiently transports the major species of bile acids. Synonyms: OSTA; OSTalpha This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 OSTA (SLC51A) Rabbit Polyclonal Antibody – TA338900 Note: Immunogen Sequence Homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 92%; Rat: 92%; Rabbit: 92%; Guinea pig: 92%; Bovine: 86%; Mouse: 83% Protein Families: Transmembrane Product images: WB Suggested Anti-SLC51A Antibody Titration: 0.2-1 ug/ml; Positive Control: COLO205 cell lysate This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 2.

Copy Link

Recommended publications

UNIVERSITY of CALIFORNIA, SAN DIEGO The
UNIVERSITY OF CALIFORNIA, SAN DIEGO The Transporter-Opsin-G protein-coupled receptor (TOG) Superfamily A Thesis submitted in partial satisfaction of the requirements for the degree Master of Science in Biology by Daniel Choi Yee Committee in charge: Professor Milton H. Saier Jr., Chair Professor Yunde Zhao Professor Lin Chao 2014 The Thesis of Daniel Yee is approved and it is acceptable in quality and form for publication on microfilm and electronically: _____________________________________________________________________ _____________________________________________________________________ _____________________________________________________________________ Chair University of California, San Diego 2014 iii DEDICATION This thesis is dedicated to my parents, my family, and my mentor, Dr. Saier. It is only with their help and perseverance that I have been able to complete it. iv TABLE OF CONTENTS Signature Page ............................................................................................................... iii Dedication ...................................................................................................................... iv Table of Contents ........................................................................................................... v List of Abbreviations ..................................................................................................... vi List of Supplemental Files ............................................................................................ vii List of
[Show full text]
Genome-Wide Transcriptional Sequencing Identifies Novel Mutations in Metabolic Genes in Human Hepatocellular Carcinoma DAOUD M
CANCER GENOMICS & PROTEOMICS 11 : 1-12 (2014) Genome-wide Transcriptional Sequencing Identifies Novel Mutations in Metabolic Genes in Human Hepatocellular Carcinoma DAOUD M. MEERZAMAN 1,2 , CHUNHUA YAN 1, QING-RONG CHEN 1, MICHAEL N. EDMONSON 1, CARL F. SCHAEFER 1, ROBERT J. CLIFFORD 2, BARBARA K. DUNN 3, LI DONG 2, RICHARD P. FINNEY 1, CONSTANCE M. CULTRARO 2, YING HU1, ZHIHUI YANG 2, CU V. NGUYEN 1, JENNY M. KELLEY 2, SHUANG CAI 2, HONGEN ZHANG 2, JINGHUI ZHANG 1,4 , REBECCA WILSON 2, LAUREN MESSMER 2, YOUNG-HWA CHUNG 5, JEONG A. KIM 5, NEUNG HWA PARK 6, MYUNG-SOO LYU 6, IL HAN SONG 7, GEORGE KOMATSOULIS 1 and KENNETH H. BUETOW 1,2 1Center for Bioinformatics and Information Technology, National Cancer Institute, Rockville, MD, U.S.A.; 2Laboratory of Population Genetics, National Cancer Institute, National Cancer Institute, Bethesda, MD, U.S.A.; 3Basic Prevention Science Research Group, Division of Cancer Prevention, National Cancer Institute, Bethesda, MD, U.S.A; 4Department of Biotechnology/Computational Biology, St. Jude Children’s Research Hospital, Memphis, TN, U.S.A.; 5Department of Internal Medicine, University of Ulsan College of Medicine, Asan Medical Center, Seoul, Korea; 6Department of Internal Medicine, University of Ulsan College of Medicine, Ulsan University Hospital, Ulsan, Korea; 7Department of Internal Medicine, College of Medicine, Dankook University, Cheon-An, Korea Abstract . We report on next-generation transcriptome Worldwide, liver cancer is the fifth most common cancer and sequencing results of three human hepatocellular carcinoma the third most common cause of cancer-related mortality (1). tumor/tumor-adjacent pairs.
[Show full text]
Whole Exome Sequencing in Families at High Risk for Hodgkin Lymphoma: Identification of a Predisposing Mutation in the KDR Gene
Hodgkin Lymphoma SUPPLEMENTARY APPENDIX Whole exome sequencing in families at high risk for Hodgkin lymphoma: identification of a predisposing mutation in the KDR gene Melissa Rotunno, 1 Mary L. McMaster, 1 Joseph Boland, 2 Sara Bass, 2 Xijun Zhang, 2 Laurie Burdett, 2 Belynda Hicks, 2 Sarangan Ravichandran, 3 Brian T. Luke, 3 Meredith Yeager, 2 Laura Fontaine, 4 Paula L. Hyland, 1 Alisa M. Goldstein, 1 NCI DCEG Cancer Sequencing Working Group, NCI DCEG Cancer Genomics Research Laboratory, Stephen J. Chanock, 5 Neil E. Caporaso, 1 Margaret A. Tucker, 6 and Lynn R. Goldin 1 1Genetic Epidemiology Branch, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 2Cancer Genomics Research Laboratory, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; 3Ad - vanced Biomedical Computing Center, Leidos Biomedical Research Inc.; Frederick National Laboratory for Cancer Research, Frederick, MD; 4Westat, Inc., Rockville MD; 5Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD; and 6Human Genetics Program, Division of Cancer Epidemiology and Genetics, National Cancer Institute, NIH, Bethesda, MD, USA ©2016 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol.2015.135475 Received: August 19, 2015. Accepted: January 7, 2016. Pre-published: June 13, 2016. Correspondence: [email protected] Supplemental Author Information: NCI DCEG Cancer Sequencing Working Group: Mark H. Greene, Allan Hildesheim, Nan Hu, Maria Theresa Landi, Jennifer Loud, Phuong Mai, Lisa Mirabello, Lindsay Morton, Dilys Parry, Anand Pathak, Douglas R. Stewart, Philip R. Taylor, Geoffrey S. Tobias, Xiaohong R. Yang, Guoqin Yu NCI DCEG Cancer Genomics Research Laboratory: Salma Chowdhury, Michael Cullen, Casey Dagnall, Herbert Higson, Amy A.
[Show full text]
Animal Models to Study Bile Acid Metabolism T ⁎ Jianing Li, Paul A
BBA - Molecular Basis of Disease 1865 (2019) 895–911 Contents lists available at ScienceDirect BBA - Molecular Basis of Disease journal homepage: www.elsevier.com/locate/bbadis ☆ Animal models to study bile acid metabolism T ⁎ Jianing Li, Paul A. Dawson Department of Pediatrics, Division of Gastroenterology, Hepatology, and Nutrition, Emory University, Atlanta, GA 30322, United States ARTICLE INFO ABSTRACT Keywords: The use of animal models, particularly genetically modified mice, continues to play a critical role in studying the Liver relationship between bile acid metabolism and human liver disease. Over the past 20 years, these studies have Intestine been instrumental in elucidating the major pathways responsible for bile acid biosynthesis and enterohepatic Enterohepatic circulation cycling, and the molecular mechanisms regulating those pathways. This work also revealed bile acid differences Mouse model between species, particularly in the composition, physicochemical properties, and signaling potential of the bile Enzyme acid pool. These species differences may limit the ability to translate findings regarding bile acid-related disease Transporter processes from mice to humans. In this review, we focus primarily on mouse models and also briefly discuss dietary or surgical models commonly used to study the basic mechanisms underlying bile acid metabolism. Important phenotypic species differences in bile acid metabolism between mice and humans are highlighted. 1. Introduction characteristics such as small size, short gestation period and life span, which facilitated large-scale laboratory breeding and housing, the Interest in bile acids can be traced back almost three millennia to availability of inbred and specialized strains as genome sequencing the widespread use of animal biles in traditional Chinese medicine [1].
[Show full text]
Heidker Unr 0139D 12054.Pdf
University of Nevada, Reno Metabolic Effects of a Grape Seed Procyanidin Extract and its Relation to Bile Acid Homeostasis A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy in Cell and Molecular Biology By Rebecca M. Heidker Dr. Marie-Louise Ricketts/Dissertation Advisor May, 2016 Copyright by Rebecca M. Heidker 2016 All rights reserved THE GRADUATE SCHOOL We recommend that the dissertation prepared under our supervision by REBECCA HEIDKER Entitled Metabolic Effects Of Grape Seed Procyanidin Extract On Risk Factors Of Cardiovascular Disease be accepted in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Marie-Louise Ricketts, Advisor Patricia Berinsone, Committee Member Patricia Ellison, Committee Member Cynthia Mastick, Committee Member Thomas Kidd, Graduate School Representative David W. Zeh, Ph. D., Dean, Graduate School May, 2016 i Abstract Bile acid (BA) recirculation and synthesis are tightly regulated via communication along the gut-liver axis and assist in the regulation of triglyceride (TG) and cholesterol homeostasis. Serum TGs and cholesterol are considered to be treatable risk factors for cardiovascular disease, which is the leading cause of death both globally and in the United States. While pharmaceuticals are common treatment strategies, nearly one-third of the population use complementary and alternative (CAM) therapy alone or in conjunction with medications, consequently it is important that we understand the mechanisms by which CAM treatments function at the molecular level. It was previously demonstrated that one such CAM therapy, namely a grape seed procyanidin extract (GSPE), reduces serum TGs via the farnesoid X receptor (Fxr).
[Show full text]
FXR and FOXA2 Govern Two Complementary Regulatory Mechanisms to Maintain Apical BSEP Expression in Hepatocytes
Aus der II. Medizinische Klinik der Medizinischen Fakultät Mannheim (Direktor: Prof. Dr. med. Matthias Ebert) FXR and FOXA2 govern two complementary regulatory mechanisms to maintain apical BSEP expression in hepatocytes Inauguraldissertation zur Erlangung des Doctor scientiarum humanarun (Dr. sc. hum) der Medizinischen Fakultät Mannheim der Ruprecht-Karls-Universität zu Heidelberg vorgelegt von Sai Wang aus Shandong, China 2020 Dekan: Prof. Dr. med. Sergij Goerdt Referent: Prof. Dr. rer. nat. Steven Dooley CONTENTS Page LIST OF ABRREVIATIONS ..................................................................... 1 1 INTRODUCTION ................................................................................. 4 1.1 Bile acid metabolism......................................................................................... 4 1.1.1 Bile acid synthesis .................................................................................... 4 1.1.2 Bile canaliculi ............................................................................................ 6 1.1.3 Bile acid transport and enterohepatic circulation ...................................... 9 1.1.4 Regulation of bile acid synthesis ........................................................... 10 1.2 Bile salt export pump (BSEP) ......................................................................... 11 1.2.1 Structure and function of BSEP .............................................................. 11 1.2.2 Localization of BSEP .............................................................................
[Show full text]
The Regional-Specific Relative and Absolute Expression of Gut Transporters in Adult Caucasians: a Meta-Analysis
DMD Fast Forward. Published on May 10, 2019 as DOI: 10.1124/dmd.119.086959 This article has not been copyedited and formatted. The final version may differ from this version. DMD # 86959 TITLE PAGE The regional-specific relative and absolute expression of gut transporters in adult Caucasians: A meta-analysis Matthew D. Harwood, Mian Zhang, Shriram M. Pathak, Sibylle Neuhoff Certara UK Ltd, Simcyp Division, Level 2-Acero, 1 Concourse Way, Sheffield, S1 2BJ, UK (M.D.H., M.Z., S.M.P*., S.N.) *SMP is now an employee at Quotient Sciences, Nottingham, UK Downloaded from dmd.aspetjournals.org at ASPET Journals on September 23, 2021 1 DMD Fast Forward. Published on May 10, 2019 as DOI: 10.1124/dmd.119.086959 This article has not been copyedited and formatted. The final version may differ from this version. DMD # 86959 RUNNING TITLE PAGE Running Title: Healthy Adult Caucasian Gut Transporter Abundances Corresponding Author: Dr Matthew Harwood, Certara-Simcyp, Level 2-Acero, 1 Concourse Way, Sheffield, S1 2BJ, UK. [email protected]. Number of text pages: 36 Number of figures: 3 Number of references: 73 Number of words in the abstract: 250 Number of words in the introduction: 732 Downloaded from Number of words in the discussion: 1533 NON-STANDARD ABBREVIATIONS – ABC (ATP-Binding Cassette); ADAM (Advanced dmd.aspetjournals.org Dissolution Absorption and Metabolism); ASBT (Apical Sodium-Dependent Bile Acid Transporter, also see IBAT); BCRP (Breast Cancer Resistance Protein); CYP450 (Cytochrome at ASPET Journals on September 23, 2021 P450);
[Show full text]
Supplementary Information
SUPPLEMENTARY INFORMATION 1. SUPPLEMENTARY FIGURE LEGENDS Supplementary Figure 1. Long-term exposure to sorafenib increases the expression of progenitor cell-like features. A) mRNA expression levels of PROM-1 (CD133), THY-1 (CD90), EpCAM, KRT19, and VIM assessed by quantitative real-time PCR. Data represent the mean expression value for a gene in each phenotypic type of cells, displayed as fold-changes normalized to 1 (expression value of its corresponding parental non-treated cell line). Expression level is relative to the GAPDH gene. Bars indicate standard deviation. Significant statistical differences are set at p<0.05. B) Immunocitochemical staining of CD90 and vimentin in Hep3B sorafenib resistant cell line and its parental cell line. C) Western blot analysis comparing protein levels in resistant Hu6 and Hep3B cells vs their corresponding parental cells lines. Supplementary Figure 2. Efficacy of gene silencing of IGF1R and FGFR1 and evaluation of MAPK14 signaling activation. IGF1R and FGFR1 knockdown expression 48h after transient transfection with siRNAs (50 nM), in non-treated parental cells and sorafenib-acquired resistant tumor derived cells was assessed by quantitative RT-PCR (A) and western blot (B). C) Activation status of MAPK14 signaling was evaluated by western blot analysis in vivo, in tumors with acquired resistance to sorafenib in comparison to non-treated tumors (right panel), as well as in in vitro, in sorafenib resistant cell lines vs parental non-treated. Supplementary Figure 3. Gene expression levels of several pro-angiogenic factors. mRNA expression levels of FGF1, FGF2, VEGFA, IL8, ANGPT2, KDR, FGFR3, FGFR4 assessed by quantitative real-time PCR in tumors harvested from mice.
[Show full text]
Hematopoietically Expressed Homeobox Is a Target Gene of Farnesoid X Receptor in Chenodeoxycholic Acid–Induced Liver Hypertrophy
Hematopoietically Expressed Homeobox Is a Target Gene of Farnesoid X Receptor in Chenodeoxycholic Acid–Induced Liver Hypertrophy Xiangbin Xing,1,2* Elke Burgermeister,1* Fabian Geisler,1 Henrik Einwachter,¨ 1 Lian Fan,1,2 Michaela Hiber,1 Sandra Rauser,3 Axel Walch,3 Christoph Rocken,¨ 4 Martin Ebeling,5 Matthew B. Wright,5 Roland M. Schmid,1 and Matthias P.A. Ebert1 Farnesoid X receptor (FXR/Fxr) is a bile acid–regulated nuclear receptor that promotes hepatic bile acid metabolism, detoxification, and liver regeneration. However, the adap- tive pathways under conditions of bile acid stress are not fully elucidated. We found that wild-type but not Fxr knockout mice on diets enriched with chenodeoxycholic acid (CDCA) increase their liver/body weight ratios by 50% due to hepatocellular hypertro- phy. Microarray analysis identified Hex (Hematopoietically expressed homeobox), a central transcription factor in vertebrate embryogenesis and liver development, as a novel CDCA- and Fxr-regulated gene. HEX/Hex was also regulated by FXR/Fxr and CDCA in primary mouse hepatocytes and human HepG2 cells. Comparative genomic analysis identified a conserved inverted repeat-1–like DNA sequence within a 300 base pair enhancer element of intron-1 in the human and mouse HEX/Hex gene. A combi- nation of chromatin immunoprecipitation, electromobility shift assay, and transcrip- tional reporter assays demonstrated that FXR/Fxr binds to this element and mediates HEX/Hex transcriptional activation. Conclusion: HEX/Hex is a novel bile acid–induced FXR/Fxr target gene during adaptation of hepatocytes to chronic bile acid exposure. (HEPATOLOGY 2009;49:979-988.) iver enlargement (hepatomegaly) is an adaptive re- response.
[Show full text]
Tesis Presentada Por OIHANE ERICE AZPARREN
Departamento de Fisiología Facultad de Medicina y Odontología Novel insights in the pathogenesis of primary biliary cholangitis and cholangiocarcinoma Tesis presentada por OIHANE ERICE AZPARREN San Sebastián, 19 de Mayo de 2017 (c)2017 OIHANE ERICE AZPARREN Novel insights in the pathogenesis of primary biliary cholangitis and cholangiocarcinoma Tesis presentada por Oihane Erice Azparren Para la obtención del título de doctor en Investigación Biomédica por la Universidad del País Vasco/Euskal Herriko Unibertsitatea Tesis dirigida por Dr. D. Jesús María Bañales Asurmendi Dra. Dña. María Jesús Perugorria Montiel Sponsor: AKNOWLEDGEMENTS AGRADECIMIENTOS Hace ya más de cuatro años que me embarqué en la aventura de la tesis, un viaje lleno de emociones del que me llevo grandes recuerdos. El camino a la meta que es la tesis suele ser duro en ciertas ocasiones, pero con la ayuda de todos los que me han rodeado ha sido mucho más ameno, y aún recuerdo incluso mi primer día como si fuese ayer. Comienzo agradeciendo a mis directores de tesis, Txus y Matxus. Gracias por haberme acogido en el grupo y haberme dado la oportunidad de aprender tantas cosas, tanto a nivel profesional como personal, mostrando siempre un gran entusiasmo por la ciencia. Agradezco también a la Asociación Española Contra el Cáncer (AECC), especialmente a la Junta de Gipuzkoa por haberme concedido la beca gracias a la cual he podido desarrollar este trabajo. Además he podido conocer un poco más de cerca la labor que ejercen. El trabajo de los trabajadores y voluntarios es muy importante para la sociedad. Por todo ello, muchas gracias.
[Show full text]
2829 OST Alpha-OST Beta: a Key Membrane Transporter of Bile Acids
[Frontiers in Bioscience 14, 2829-2844, January 1, 2009] OST alpha-OST beta: a key membrane transporter of bile acids and conjugated steroids Nazzareno Ballatori1, Na Li1, Fang Fang1, James L. Boyer2, Whitney V. Christian1, Christine L. Hammond1 1Department of Environmental Medicine, University of Rochester School of Medicine, Rochester, NY 14642, 2Department of Medicine and Liver Center, Yale University School of Medicine, New Haven, CT 06520 TABLE OF CONTENTS 1. Abstract 2. Introduction 3. Bile acid synthesis and disposition 4. Hepatic bile acid transporters 5. Intestinal bile acid transporters 6. Identification of Ost alpha-Ost beta 7. Ost alpha and Ost beta are expressed in most tissues, but are most abundant in tissues involved in bile acid and steroid homeostasis 8. Ost alpha-Ost beta mediates the transport of bile acids, conjugated steroids, and structurally-related molecules: transport occurs by a facilitated diffusion mechanism 9. Heterodimerization of Ost alpha and Ost beta increases the stability of the individual proteins, facilitates their post- translational modifications, and is required for delivery of the Ost alpha-Ost beta complex to the plasma membrane 10. Expression of both Ost genes is positively regulated by bile acids through the bile acid-activated farnesoid X receptor, Fxr 11. Ost alpha-Ost beta is required for bile acid and conjugated steroid disposition in the intestine, kidney, and liver 12. Implications for human diseases 13. Summary 14. Acknowledgements 15. References 1. ABSTRACT 2. INTRODUCTION The organic solute and steroid transporter, Ost The steroid-derived class of compounds, alpha-Ost beta, is an unusual heteromeric carrier that including the bile acids, steroid hormones, and other appears to play a central role in the transport of bile acids, cholesterol metabolites, play critical roles in human conjugated steroids, and structurally-related molecules physiology; however, relatively little is known about the across the basolateral membrane of many epithelial cells.
[Show full text]
Developmental Regulation of the Drug-Processing Genome
DEVELOPMENTAL REGULATION OF THE DRUG-PROCESSING GENOME IN MOUSE LIVER By Julia Yue Cui B.S., Chukechen Honors College, Zhejiang University, 2005 Submitted to the Graduate Degree Program in Pharmacology, Toxicology, and Therapeutics and the Graduate Faculty of the University of Kansas in partial fulfillment of the requirements for the degree of Doctor of Philosophy Dissertation Committee Curtis Klaassen, Ph.D. (Chair) Yu-Jui Yvonne Wan, Ph.D. Bruno Hagenbuch, Ph.D. Grace Guo, Ph.D. Lane Christenson, PhD. Date defended: The Dissertation Committee for Julia Yue Cui certifies that this is the approved version of the following dissertation: DEVELOPMENTAL REGULATION OF THE DRUG-PROCESSING GENOME IN MOUSE LIVER Dissertation Committee Curtis Klaassen, Ph.D. (Chair) Yvonne Wan, Ph.D. Bruno Hagenbuch, Ph.D. Grace Guo, Ph.D. Lane Christenson, PhD. Date approved: ii ACKNOWLEDGEMENTS I would like to acknowledge my dissertation committee, Drs. Curtis Klaassen, Yu-Jui Yvonne Wan, Bruno Hagenbuch, Grace Guo, and Lane Christenson for their insightful suggestions and constructive criticisms to improve my dissertation. I am very grateful to my academic father, Dr. Curtis Klaassen, for introducing me to the world of toxicology, for his guidance and enthusiasm in my research, and endless support of my PhD studies. He always encourages me to do the most and best I can for my career. From him, not only have I learnt how to do good science, but also how to be a good scientist and educator. He is the person I trust the most in my career, the person I find confidence from always, and the person I will be eternally grateful for the rest of my life.
[Show full text]