We acknowledge the fi nancial support of the Government of Canada through the Canada Periodical Fund of the Department of Canadian Heritage.
www.minnedosatribune.com
Vol. 131 No. 21 Friday, August 2, 2013 90 cents + tax Local resident discovered to ready to rock!
be long-time By DARRYL HOLYK
American he tenth year of TMinnedosa’s annual fugitive August long weekend mu- sic festival as a non-profi t co-operative is set to kick off today with anticipa- tion for the best three days Rockin’ the Fields has had. After two previous failed attempts at festivals at the local rock site, the current rendition of the festival has found its niche and as their slogan says, Rockin’ the Fields is “solid as a rock”. With humble begin- nings to keep the rock fes- Police photo tival going in Minnedosa, Rockin’ the Fields has By JENNIFER PAIGE experienced continual growth since its fi rst festi- local woman living val back in 2004. A in Minnedosa was “We’ve grown in baby recently discovered to be steps and it’s been fabu- a long-time American fu- lous,” said festival promot- gitive, evading criminal er, Tom Crook. “We have charges for the past 16 a great board of directors. years. Th ey stick to the budget Known in town as and that’s one of the main Jean McPherson, Jean reasons we have survived ten years. We’ve been able Terese Keating has been Photo by Darryl Holyk a wanted fugitive in the to increase the budget a state of Oregon since little more every year.” (L-R) RFM President, Darcy Bialas; Director in Charge of Site, Barry Coutts 1998. As a result of this, an- and Lead Hand, Blaine Instance are pictured with the reclaimed On April 13, 1997, nual improvements are Bombers seats recently installed in the main concert bowl. Keating, who was 38 made to the site and bigger years-old at the time, was name acts are booked. Trooper, Monster Truck, forward for RFM and was fl ip seats, which RFM was site. “Th is year we have in- driving under the influ- “Last year we had one One Bad Son, Starship fea- a goal of organizers right able to acquire from the old stalled 198 fl ip seats which ence with her two small of the biggest bands we’ve turing Mickey Th omas and from day one. “I think that Bombers stadium in Win- will be great for the rock- children and caused a ever had as Rockin’ the Th e Headpins. A number of paid off and people are see- nipeg. ers who want to sit down, fatal car accident which Fields with Finger Eleven. other bands will also be ap- ing the hard work that is go- Th anks to Marty take a load off and enjoy killed 65-year-old, Jewel Th is year, we have Th eory pearing on the secondary ing into this,” said Tom. McNabb and the Winni- the show,” mentioned RFM Anderson. of a Dead Man so we’re stages. Regulars attending peg Blue Bombers, RFM President, Darcy Bialas. slowly getting there.” Other Two years ago saw the this years festival will see was able to take a crew Continued big name acts scheduled return of the big main stage some welcome improve- into Winnipeg earlier this Continued to appear this weekend in- on Page 13 at the bottom of the concert ments to the concert bowl year to remove some of on Page 3 clude Th e Trews, Big Wreck, bowl. Th is was a huge step with the installation of blue the seats for use at the rock WELCOME RODEO AND ROCKIN’ THE FIELDS FANS! Enjoy your August long weeknd in friendly Minnedosa! 2 Friday, August 2, 2013 Th e Minnedosa Tribune Maxine Woodcock new Services to Seniors Coordinator
commented. Her offi ce is independence. served at the Town View located on the main fl oor of According to Maxine, Manor three times a per the Town View Manor and “My role as Resource Coor- week. At the beginning of is open Monday through dinator is to coordinate ser- August, Maxine will begin Friday. vices to help seniors main- training with Victoria Life- Minnedosa and Dis- tain independent living. I line to provide seniors with trict Services to Senior will be recruiting service more safety. Th is program (MDSS) is an organization providers such as drivers, off ers help at the touch of a that supports seniors in the those who will do clean- button. Town of Minnedosa, R.M. ing, help with shopping, As for right now, “I am of Odanah, R.M. of Minto, laundry, errands, etc. and in the process of updating and the northern part of the matching them with clients the list of housing avail- R.M. of Saskatchewan. It is needing a helping hand.” able to seniors in Minnedo- funded through the Prairie MDSS also has an sa. Th is means a list of Mountain Health Authority equipment lending pro- prospective apartments, and governed by a Board gram for tub chairs, walk- condos, etc.” Maxine an- of Directors that aim to ers, and canes in addition nounced. maintain a seniors’ to three congregate meals Mavericks in semi fi nals
Photo by Darryl Holyk A month into her new position as Services to Seniors Coordinator, Maxine Woodcock is looking forward to new programs and opportunities that are available to seniors in the community.
By SARAH DALRYMPLE and District Services to on various topics of inter- Seniors. “I look forward to est, to the community as a s of July 2nd, Maxine working with seniors and whole. We have an open AWoodcock has taken those with disabilities. I door policy, so I look for- up the role of Resource Co- plan to off er information ward to meeting and work- ordinator for Minnedosa sessions and workshops ing with everyone.” Maxine
File photo
By DARRYL HOLYK year run as Santa Clara game was not determined League Champions. Th e at press time. his weekend, the Mavericks closed out the After a long run under TMinnedosa Mavericks regular season with 11 the coaching guidance of will represent the Santa wins and two losses and Orville Madill, the Maver- Clara Baseball League at are now moving on to the icks are now coached by the AA Provincial tourna- semi fi nals from a suc- Jay Klym and appear to be ment in Hamiota. Th e Mav- cessful quarter fi nal run. continuing their string of ericks are up against seven Th e Mavericks next game baseball athletic strength. other “best of” teams from will be against the Por- Good luck to the Maver- around the province. tage Padres and fans can icks in the upcoming pro- Our local team has expect a home game here vincial tournament and had another successful in Minnedosa next week, semi-fi nal games! year defending its seven although the date of that
15% OFF 1st 20 signed customers Roofing, Soffit, Fascia, Eavestrough 1-204-868-0260 [email protected] SATISFACTION GUARANTEED!!! Th e Minnedosa Tribune Friday, August 2, 2013 3 RFM ten years strong and growing
Continued view of the main stage but $175,000 from the festival. before and after the festi- will include afternoon mu- ing Ted roaming the site on from Page 1 also the secondary stage All of these funds go back val, assisting with the set- sic at the small stage under horseback throughout the (the former Main Stage) into the community. up, teardown and cleanup the tent, a scavenger hunt, weekend. Th is year, due to Additional fl ip seats and the smaller stage area “Th is couldn’t be done of the site. a rock trivia contest and a recent health issue, Ted are planned to be installed which is located where the without our volunteers. It’s Gates for this year’s Texas Hold-em poker tour- will not be on horseback in the year’s ahead. Along previous secondary stage turned into a great com- festival opened Th urs- nament. Th e best decorat- but is looking forward to with the fl ip seats, bench once was. munity event and people day at noon and at press ed campsite contest is also joining in the party and seating in the concert bowl Pulling off a festival realize that and come out time Wednesday tickets returning this year with wheeling around the site provides seating for 600 of this magnitude takes here and help. It makes were still available. “We’re some great prizes avail- soaking up all the fun and people. “Th is year, we can months of hard work and all the diff erence in the ahead of last year and we able. music RFM brings to the seat 800 people easily,” planning as well as an world,” mentioned Tom. expect a huge number of Th e land which is now property what was former- mentioned Darcy. army of volunteers. RFM is Organizers estimate walk-up as well,” said Tom. occupied by the RFM site ly his pasture. Another addition to fortunate to have secured in excess of 250 volun- “Th at is dependent on the is owned by Ted and Di- RFM is ten years the concert bowl is a per- the trust of local volunteers teers are involved with the weather but it’s looking ana Clarke. Back in 1995 strong and still rocking on manent handicap deck lo- which are rewarded with a Rockin’ the Fields week- like it’s going to be a nice when planning for the fi rst and from the growth and cated at the top centre of the portion of the weekends’ end. Th is number does not weekend so it should be a Classic Rock was under- improvements experi- concert bowl. Measuring profi ts. Since RFM began, include the numerous vol- great party.” way, the Clarke’s off ered 17 enced over the years, this 16 feet by 16 feet, this deck local service clubs have unteers who lend a help- Campground A has acres of their land with the festival has a bright future not only provides a great received approximately ing hand or a strong back been completely sold out rental fee being the annual in our community. Party with about 50% of Camp- property taxes. Ted and on rock fans! ground B also booked. Diana are happy to see the Th is is an increase from site still being used and are previous years. Last year, impressed with the growth there was some overfl ow Rockin’ the Fields has ex- into Campground B but perienced in the past de- Where’s Subway? If your label only three or four campers. cade. reads By DARRYL HOLYK and approvals for renovations have With the nights fi lled “Th is all started back been secured. Construction is hoped with music, new daytime in 1996 and back then it activities have been added might have been a little bit 13/08/31 few months ago, it was an- to begin within the next two weeks. to provide more options for bigger but certainly wasn’t nounced that SUBWAY® would He is also waiting for the necessary It’s time to A rockers looking for some- as much fun as it is now,” be opening in the former Chicken equipment to be dispatched from renew! thing to do during the day. said Ted. “Th ese volun- Delight/Valley Cache building on the SUBWAY® headquarters. Th e annual beach volley- teers are doing just a great Call 867-3816 east side of Main Street. At that time, If all goes as planned, the ball tournament returns job out here.” the anticipated date for opening was Minnedosa SUBWAY® location and other daytime events Fans may recall see- Fun Fest weekend. Th at weekend has is now anticipating an opening come and gone and no SUBWAY®, so, date sometime in mid September. what’s happening? Th e fi rst SUBWAY® opened in Au- Owner Ash Patel has confi rmed gust 1965 and has grown into a mega- that SUBWAY® will be opening in franchise chain with more than 39,000 Minnedosa later this year. After some locations around the world. delays, the required building permits
13075GG02 4 Friday, August 2, 2013 Th e Minnedosa Tribune
Darryl A. Holyk - Publisher & Editor- [email protected]
From the Falling between the cracks By ELISSA L. get help and support, with very minimal success. Edmonton, AB Th e maximum entitlement for permanent impair- ment in 2008 was approximately $133,000, and to Publisher’s o you know what it’s like when everything you date, MPIC has calculated my total entitlement be By Ddo, everyday is hard? To be searching your $21,295.84. Th is includes a 5% rating for the most Darryl mind for childhood memories and fi nd only black severe level of concussion or loss of consciousness holes? Or to suff er from debilitating migraines al- allowed, 5% for my loss of cognitive function and Holyk desk... most every day? July 14th, 2013 marked the fi ve year 2% for the largest of the brain bleeds in my left ce- anniversary of my battle. Fighting to be me again, to rebral hemisphere. be “normal”, to receive support with my challenges Given the most recent information on both We’re back... and all around fi ghting for my life. Here’s my story: long and short term eff ects of brain injury and con- After a much needed, one week vacation, Th e On July 14th, 2008 I was a passenger in a vehi- cussion particularly on a youthful brain this settle- Tribune staff is back at it slaving away in the back shop. cle “t-boned” by a semi that had run a red light. My ment seems sadly inadequate. Th e insurance plan And when I say slaving, I truly mean slaving! It has been lungs collapsed and I was knocked unconscious is also supposed to provide income replacement quite the week to come back as we began the week with instantly. Th e First responders to the accident in- while you recover from your injuries but this has only half of our regular staff able to be here. Th is tem- cubated and got me off to the hospital where doc- proven to be extremely inadequate and an endless porary staff shortage certainly left us feeling the strain. tors told my family that due to the brain bleeds and battle of letter writing, appeals and meetings that It’s a little hectic when there are only two people to fi ll swelling I likely would not survive. Well, it turns out have provided little. Most of the doctors’ recom- four positions, make a 20-page newspaper along with they were wrong. I woke from the coma just in time mendations have been ignored or I’ve been given printing and folding thousands of Rockin’ the Fields to celebrate my 20th birthday on July 20th, 2008. excuses that are not only ridiculous but insulting. and Rodeo programs, along with other print jobs and Since this time, I have struggled to regain both cog- Excuses that imply I’m not damaged enough to de- offi ce duties. Somehow, we got it done! Hopefully, by the time you are reading this, we are back to a full com- nitive and physical functioning. I remember being serve help, my anxiety is caused from a romantic pliment of staff . in the hospital and having to really concentrate break-up two years after the accident or even that on getting the timing of breathing and swallowing the reason I struggle is because I live too far away right so that I didn’t choke on my food. I still mess from my family. Our new reporter... this up sometimes. I paid for insurance and assumed that should Mid week, we welcomed Jennifer Paige as Th e Tri- Today, I am working part-time during the sum- the worst happen, my family and I shouldn’t be bune’s new reporter/photographer. We are greatlful mer as a Child Development Worker and pursu- made to carry the bulk of the burden alone. Where to have Jennifer on staff and look forward to what she ing a degree during the school year. If all goes as are you now MPIC? I can’t adequately function in brings to this newspaper. She comes to us with a great planned, I will be graduating from university in an “average” life, I can’t sue and I can’t seem to get deal of past experience with other publications as a December with my elementary B. Ed. Minoring in the support I need from you; so what now? It fright- feature writer, editor and production assitant. Special Education. ens me to think about where I would be today with To most, I appear “normal” but don’t let that out the amazing support of my family, friends, doc- busy weekend ahead... fool you. I’ve spent a good part of the last fi ve years tors and teachers. Th e August long weekend has arrived and for hiding the diffi culties in hopes of one day fi nding Th is letter is being sent across Canada because Minnedosa that means a busy weekend with lots to myself again and pushing my limits physically, although this accident took place in Manitoba, I do for rock and rodeo fans with the return of Rockin’ mentally and emotionally to be the best I can be. don’t believe I can be the only one in the country the Fields of Minnedosa and the Minnedosa Rodeo. It’s hard living with a personality and chanllenges fi ghting a battle likes this. Th is situation is wrong Th is year, RFM is celebrating its 10th anniversary as you don’t recognize. and Canadians deserve to know the injustice that’s a non-profi t co-operative and the rodeo is hot off the I’m writing to tell my story because there’s a taking place in our country. heels of being named last year’s Heartland Rodeo As- dark side I believe people should be aware of. Th is Th ere was nothing special about me, it could sociation’s Rodeo of the Year (for a second time in its accident took place in Winnipeg, MB; a province just as easily have been you in that car that day. short history!) Many months of hard work, sweat and with no-fault public insurance. Th is really isn’t a Some people will think that I should “just be thank- volunteer time go into the oprganization of these two good combination when it comes to personal inju- ful that I’m alive today” but to that I say, “No, this is events and I would like to personally congratulate ev- ries, especially brain injuries such as mine where MY life.” As far as I know, I only get one so I deserve eryone who has a hand in bringing these two August the full cognitive damage is diffi cult to measure. the chance to LIVE it. I will not settle for just getting long weekend attractions to our community. Your Since the car accident I have been struggling with by with “Good enough”! hard work draws people from near and far, supports Manitoba Public Insurance Corporation (MPIC), to our local economy and boosts our tourism profi le!
Th e Minnedosa Tribune is independently owned and is the Th e Minnedosa Tribune Ltd. does not The Minnedosa Tribune Ltd. oldest weekly newspaper in the Canadian West and has guarantee the publication of all submitted articles and published continuously from the same premises since Box 930 Minnedosa, MB R0J 1E0 photographs. Th ese submissions, are at the discretion of the March of 1883. We acknowledge the fi nancial support of the publisher and will appear as space permits. Th e Minnedosa Published Friday of each week from the premises of Government of Canada through the Canada Periodical Fund Th e Minnedosa Tribune Ltd Tribune . 14 - 3rd Ave. S.W. (CPF) for our publishing activities. reserves the right to edit any submission as deemed necessary by the publisher. Minnedosa, MB. R0J 1E0 E-Mail Addresses: Member of Manitoba Community Newspapers Association We are not responsible for fax transmissions or email and Newspapers Canada General: [email protected] submissions that are not received. To guarantee that such submissions have been received please confi rm with a phone Audited twice a year by Canadian Media Circulation Audit Ads/printing: [email protected] call or in person. Phone: (204) 867-3816 Classifi eds: [email protected] Fax: (204) 867-5171 All contents copyright 2013 www.minnedosatribune.com Cell: (204) 867 - 7000 TRUSTED Ι CONNECTED Ι TARGETED Th e Minnedosa Tribune Friday, August 2, 2013 5
Letters to the Editor Dear Editor, families that need them do agree with. On July tre and a parental advoca- and provide support after 4, the Minister of Family cy group called Manitoba n July 4th, River East a child has completed the Services Jennifer Howard, Families for Eff ective Au- Ye Old OMLA Bonnie Mitch- ABA program by Grade 5. said: “We need to provide tism Treatment. elson introduced a reso- Th e government did better training and better Bjornson also said lution in the legislature not live up to that policy tools for parents.” Minister the government’s support that called on the NDP to statement on this issue, of Education Nancy Allan for ABA has increased by provide the necessary sup- and that amounts to noth- added: “We believe that 36 percent since 2008. Trib ports for Manitoba fami- ing more than another in a providing services for fam- Strangely, this contradicts lies seeking any form of series of broken promises. ilies with Autism is impor- the claims of both Howard autism treatment. More Th is hurts the very Mani- tant.” Minister of Children and Allan, who says fund- and more children are be- tobans who need the most and Youth Opportunities ing has risen 35 percent. – A 40-foot high white medal cross, with a 20-foot ing diagnosed with Autism help; yet another example Kevin Chief said: “Is there Which is it? 2003 horizontal arm has been erected at the Little River Rock- in Manitoba and families of the NDP taking Manito- more to do – yes.” Minis- Th e facts tell a diff er- fest site. Th e cross was donated to Little River Faithfest by are increasingly unable to bans for granted. ter of Entrepreneurship ent story. In fact no new a number of Westman companies. access eff ective therapies Th ere are currently 62 Training and Trade Peter money has been invested that treat autism. children on a wait-list for Bjornson said: “Th ere is into the ABA program One of those thera- pre-school-aged therapy more we can do to support since the release of the 1993 – A sixteen-year-old driver suff ered two fractures pies is Applied Behavioral and that number is grow- families with children with government’s pre-election in her left eye socket and a broken nose after being struck Analysis or ABA. Th e out- ing every day. Th ere are Autism.” promise 2011, which was by a water fi lled balloon which was thrown through her comes of children with two very serious problems During the July 4th clearly a promise simply car window as she drove along the Beach Road neat the autism who undergo this with this situation. First, debate, this government’s meant to placate thou- cemetery junction. Th ree local men have been charged treatment are nothing autism specialists note arrogance was in full view sands of Manitobans be- with aggravated assault. short of remarkable. A re- the importance of early and worse yet, the gov- fore an election. intervention. Second, if a ernment had no problem Th is is not an issue of cent study by the St. Amant 1983 – A proposal from the Minnedosa Rotary Club to child does not receive pre- lying on the record. For money; this is an issue of Centre outlined that after purchase a handivan has received approval from Town school ABA treatment they example, Bjornson said choices. Being in govern- only one year of this ther- Council. ap y communication skills are ineligible for school- the government had: “re- ment is about choices. Al- improved by 166 percent, aged services. structured ABA program- locating dollars to support social skills by 130 percent Currently there are ming at St. Amant (Centre) your political party rather 1973 – Mayor Joyce Stevenson and Agriculture Min- and adaptive skills by 67 nine children in Manitoba to promote a more fl exible than supporting Manito- ister, Sam Uskiw signed an agreement for the extension percent. who have received NO service model…and has bans with Autism is the and modernization of Minnedosa’s water and sewer fa- Just prior to the 2011 treatment because they increased the number of wrong choice. I think it’s cilities. Th e $400,000 project will be equally cost shared election the NDP released have aged-out of eligibility ABA Spaces.” time to change the ones by the Town and Province. a policy statement on Au- and 20 more are set to age- Th e facts tell a diff er- making the choices. tism called Th rive! In that out by September. ent story – indeed there 1963 – John Hnybida of Brandon very likely owes his document , the govern- I don’t agree with was a restructuring of the Leanne Rowat, life to Mrs. Ruth Williamoski and her assistant Raymond ment made a commitment much that the govern- programming which re- Orr. While swimming at Minnedosa Lake, about 30 yards to eliminate wait-lists ment says or does these sulted in increased spaces MLA for Riding Mountain from shore, John found himself in trouble when he got for ABA therapy, provide days but I will share a few but this restructuring was PC Critic for Family caught in a strong current. Ruth and Raymond came to “booster” sessions for comments from a debate done in partnership be- Services his rescue and brought the visitor to shore. in the Legislature that I tween the St. Amant Cen- 1933 – Th e W.I. ladies from south of town held a very Letters to the Editor successful dance in Jas Stewart’s barn in aid of a ladies restroom for town. Th e Minnedosa Tribune welcomes Letters to the Editor. All letters must include the writers full name, address, and telephone number. Only the writer’s The Minnedosa 1923 – Th e excavation is complete for the new school. name will be published; address and phone number Building will begin as soon as the lumber arrives. are required for confi rmation. Anonymous letters will & District not be published. Letters that are deemed libelous, Foundation 1903 - P.H. Chipman of the Canadian Northern Land in bad taste, or describe an incident involving other Department, has sold several lots in Clanwilliam at pric- people, will not be published. es between $100and $150 each. Th e Minnedosa Tribune reserves the right to The thoughful consideration edit letters based on taste, legality, clarity, and of Verna Averill, when length. Letters to the Editor can be submitted in 1893 – A severe storm blows out the front of P.J. McDer- person, sent by mail to Box 930, Minnedosa, MB planning her Estate, continues mott’s store and smashes numerous windows in G.W. R0J 1E0, by fax (204) 867-5171, or by email to to provide a $2,000.00 Beynon’s residence. [email protected] annual scholarship to a graduating M.C.I. Student. TOP RATE Your legacy could help the Minnedosa Foundation do more. 1 year 75%* Call Maxine Laws at *Rates subject to change 204-867-2126 1. Certain conditions may apply 3 year 5 year 2.10%* 2.40%* Dave McDonaldƕBruce McNabb www.ricefinancial.com Call For More Terms & Rates 867-3946 6 Friday, August 2, 2013 Th e Minnedosa Tribune No injuries in multi-vehicle accident
found travelling 153km/ hr on Highway 16 near Cops’ Corner Minnedosa. An odor of By alcohol was observed on his breath and he was Cst. JUSTIN detained for an impaired investigation. He blew a HUDDLE 24 hour suspension, and a sober passenger ended up driving the rest of the way reetings and wel- way #16. Police responded home. But not before he Gcome to the Cops to fi nd no injuries, and was given his $744.50 tick- Corner. Summer is fl ying mixed stories of the event. et for the excess speed. by, and the mosquitos are No charges were given, I wonder why the sober fl ying high. Just thought I and as always it is good to driver didn’t drive in the would create a rhyme this see no injuries. fi rst place… Consequently week to start off the col- A police foot chase due to the males 15 day umn… keepin’ it fresh. ended with a male being suspension, he was later Offi cers responded caught with a stolen ste- stopped at a check stop to 59 calls for service this reo from a vehicle. Th e in Brandon on a diff er- time around. male was charged for the ent day and found with a A camper trailer was off ence and will appear suspended license. Th is on fi re at a rest stop near in court to face a judge on 22-year-old will be with- RCMP photo Minnedosa, causing some his charges. He and his out a license for a while alarm. Luckily there were friend were both charged if Manitoba Public Insur- Minor damage to the passenger side of one of the vehicles involved no injuries, and no foul with underage consump- ance has anything to say in the recent incident involving a semi trailer on HIghway #16. play suspected. Th e unit tion of alcohol as well. Th e about it. Th at is for sure. was hauled away to Bran- price of those two tickets So there it is. Another don after the blaze was totaled $1347.30. speeder of the week, plus put out. Th is week’s top mon- a little extra. A multi-vehicle ac- ey loser was drinking and Be safe. Enjoy the STAMPS 02'(51/22.6 cident involving a semi- driving as well. A male Rockin’ the Fields week- AUGUST BACK TO SCHOOLSPECIAL trailer occurred on High- was stopped after he was end here in town. Rubber or $10.00 Haircut & Style (12 and under)
Self-inking $15.00 Haircut & Style (13 to 18) Call $10.00 OFF Highlights The Minnedosa BOOK NOW!!! Tribune August 1st - 30th 867-3816 204-867-5694
*Other coupons or discounts will not be accepted with this promotion*
127,&(2)5(*,675$7,21 2)35263(&7,9(&$1','$7()25*(1(5$/ 081,&,3$/%<(/(&7,21 502)6$6.$7&+(:$1 3URVSHFWLYH PXQLFLSDO HOHFWLRQ FDQGLGDWHV PXVW UHJLVWHU ZLWK WKH 6HQLRU (OHFWLRQ2I¿FLDO 6(2 GXULQJWKHUHJLVWUDWLRQSHULRGEHIRUHWKH\PD\EHJLQ WRDFFHSWFRQWULEXWLRQVLQFXUH[SHQVHVIXQGUDLVHRUERUURZPRQH\IRUWKHLU FDPSDLJQ 127,&( ,6 +(5(%< *,9(1 WKDW , ZLOO EH UHFHLYLQJ FDQGLGDWH UHJLVWUDWLRQV )RUWKHRI¿FHRIFRXQFLOORUIRU:DUG%HWZHHQ$XJXVWDQG$XJXVW $WWKH5XUDO0XQLFLSDOLW\RI6DVNDWFKHZDQRI¿FHUG$YHQXHGXULQJ UHJXODUKRXUVRIEXVLQHVVRQ7XHVGD\VWKURXJK)ULGD\V 7RREWDLQDUHJLVWUDWLRQIRUPFRQWDFWWKH6(2DWWKHQXPEHUOLVWHGEHORZRU FRQWDFWWKHPXQLFLSDORI¿FHDW %UHQGD)DQVKHU 6HQLRU(OHFWLRQ2I¿FLDO 5XUDO0XQLFLSDOLW\RI6DVNDWFKHZDQ 3KRQH )D[ Th e Minnedosa Tribune Friday, August 2, 2013 7 Creating change through education
By SARAH DALRYMPLE area to settle after the slave peace where we wouldn’t the near future. With this the kids to learn better, go door to door to try to trade was abolished. Ten- be killed,” Victoria ex- ambition in mind, she was Victoria provides the stu- convince the parents that “Learning the way sions soon arose between plained. able to receive enough dents with two meals at children would do better through truth” Th at is the the people that had re- Because of the war, funding for part one of her school. at school than at home. motto that you can fi nd on ceived education in Amer- the people were not able idea. Th e school opened 75% of the members Sometimes we have to beg Nyenoweh-Eston Prepa- ica and the uneducated to fi nd food to eat. Victo- on September 9th, 2012 at the school are girls. Girls them to let the girls come ratory School in Liberia, travelers that had settled in ria used her experience and includes an admin- are often not allowed to go to school as it aff ects their West Africa. Minnedosa this region. By 1980, a mi- as a fi nance manager in istrative offi ce, a feeding to school in favor of their home life.” Th e govern- has been increasingly in- litia had developed to over the Refugee Camp to fi nd program, a productive en- brothers. Th e scholarship ment will not award fund- volved in spreading the throw the government be- funding for food through vironment, library materi- program helps to assist ing for Victoria’s school right to education, which cause the Militia felt like the Canadian Food Grains als, and a nurse for fi rst aid girls so that they can at- until the school has been something that we take for they were treated poorly Bank. Th at is how she met purposes. tend school as well as boys. functioning for fi ve years. granted every day. Victoria compared to those that the people of Eston and Th e feeding program In the future, Victoria Until then, Victoria will Wollie was a living remind- had been educated before Minnedosa. Shortly after is a unique aspect in this will face the challenges of have to face the challenges er of this fact. arrival. After the govern- the war, she began to re- school that no others have. sustaining the scholarship of sustaining the feeding After arriving in Can- ment was overthrown, alize that education could Children are usually only program and the feed- program and the various ada on June 24th, she has people realized that the solve many of the prob- allowed one meal a day ing program. Only some scholarships on her own. been busy traveling from new force controlling Libe- lems that they faced in at home. In order to help of the families can aff ord Victoria’s fl ight back to Winnipeg to Eston, and fi - ria was much worse than the small tuition fee. “We Liberia left on July 10th. nally to Minnedosa. How- the previous government. ever, this is not her fi rst By 1985, the entire country trip out to our neck of the was involved. woods. She also came in Th e militia often used 2009 on a tour with the the infl uence of child sol- Senior Ladies and Men’s Open results Canadian Food Grains diers and would kill any- Bank. During this time she one that opposed them. SUBMITTED had a score of 120 (CB). inspired a small group of Realizing it was not safe in Th e Men’s Open was held held at the Minnedosa people in Eston to help her Liberia, Victoria headed t he Senior Ladies Open was held at Minnedosa Golf Club on Sunday, July 21st with 66 players regis- fundraise enough money the nearest border with her TGolf and Country Club on Wednesday, July 17th. tered, 36 of which were non-members. to start a children’s school. four children in tow. Along Participating were 95 players of which 68 were non- In the Championship Flight, Dale Coulter earned After 4 years, the fi rst fl oor the way she was joined by members of the local golf club. fi rst place with 74. In second place was Tyler Turner of the school had been 9 other children that she In the Championship Flight, fi rst went to Giselle with 75 (CB) and in third was Andrew Oakden with 75 built and over 64 students now considers her own. “I Sayer with 89 (CB), second went to Sherril Flick with (CB). have been registered. was working as a fi nance 89 (CB)and third went to Janice Meadows with 93 First Flight results included Reid Hunter in fi rst However, the school is not manager for a fl ight com- (CB). with 82 (CB), Dan Bailey in second with 82 (CB) and yet self-suffi cient and there pany at the time of the war. First Flight winners were Diane Wahl in fi rst, Lloyd Ferguson in third with 83. are plans to add on a sec- Everything was destroyed Charlotte Evanyshyn in second and Pam Lewis in For Second Flight, Dan Johnson was fi rst with 89 ond fl oor for Grades 3-6. so that we could not com- third. All three scored 100 (CB). followed by Dave Johnston in second with 90 (CB) Victoria is from the municate to people out- In Second Flight, fi rst went to Gladys Rea with 107 and Scott Lancaster in third with 90 (CB). province of Liberia in West side of the country. So our (CB), second went to Brenda Ardron with 107 (CB) In the Th ird Flight fi rst went to Braden DeMon- Africa. Th is country was family decided that we had and third went to Joleen Patterson with 108 (CB). tigny with 96. Second place went to Rick Saler with 97 founded in 1847 and was to get to a diff erent coun- Th ird Flight results include Grace Lampard in (CB) and third place went to Len Kenler with 97 (CB). the fi rst country in Africa try. We walked through the fi rst with 115 (CB), Gwen Hoff man in second with 115 Longest Drive went to Myles Lawrence on #4. to gain independence. bushes, for days, and were (CB), and Karen Parenteau in third with 115 (CB). Myles also earned Closest to the Hole on #12, as Freed slaves from the just walking towards some In the Fourth Flight, Lucille Johnson was fi rst, did Mel Loewen on #5. United States came to this border in order to fi nd Anne Reid second and Dennise Dyck third. All three Longest Drive went to Dean Oakden on #15.
:DWHU7HVWLQJ'D\ $XJXVWWK $77(17,215HVLGHQWVLQWKH50¶VRI%ODQVKDUG'DO\+DUULVRQ boost! 3DUN 6DVNDWFKHZDQ 6WUDWKFODLU DQG WKH SDUWV RI &ODQZLOOLDP 0LQWR I need a 2GDQDK 5RVHGDOH ZLWKLQ WKH /65&' DQG WKH 7RZQV RI (ULFNVRQ 0LQQHGRVD5DSLG&LW\DQG5LYHUV 7KH/LWWOH6DVNDWFKHZDQ5LYHU&RQVHUYDWLRQ'LVWULFWZLOOEH FRRUGLQDWLQJDZHOOZDWHUWHVWLQJGD\IRUWKHVHUHVLGHQWVRQ$XJXVWWK 6321625 $OOVKLSSLQJFRVWVZLOOEHFRYHUHGE\WKH'LVWULFW7KUHHGLIIHUHQW 0216$172 WHVWVDUHRIIHUHG Shotgun Start: 6:00 p.m. 7HVW WRWDOFROLIRUPDQG(FROL Your child’s safety 2-Man scramble 7HVW WRWDOFROLIRUP(FROLDQGQLWUDWHQLWULWH is important. 7HVW WRWDO FROLIRUP (FROL QLWUDWHQLWULWH FDOFLXP PDJQHVLXP VRGLXP KDUGQHVV SRWDVVLXP PDQJDQHVH FRSSHU LURQ Starting August 8, the law ]LQFFKORULGHVXOSKDWHFRQGXFWLYLW\S+ requires children to 3LFN XS VDPSOH ERWWOHV DW WKH IROORZLQJ ORFDWLRQV EHIRUH remain in booster seats 0RQGD\$XJXVWWK until they are at least: 5LYHUV±50RI'DO\RI¿FH 2DN5LYHU±/LWWOH6DVNDWFKHZDQ5LYHU&RQVHUYDWLRQ'LVWULFWRI¿FH 13075gg04• 145 cm (4’9”) tall 6WUDWKFODLU±50RI6WUDWKFODLURI¿FH • 36 kg (80 lb.) OR (OSKLQVWRQH+LOOWRS*URFHWHULD *DV 1HZGDOH±50RI+DUULVRQRI¿FH • 9 years old 6DQG\/DNH+HULWDJH&RRS*URFHU\6WRUH 5DSLG&LW\7RZQRI5DSLG&LW\RI¿FH 0LQQHGRVD0DQLWRED$JULFXOWXUH)RRG 5XUDO,QLWLDWLYHVRI¿FH (ULFNVRQ±50RI&ODQZLOOLDPRI¿FH In the event of a crash, research shows that 2QDQROH±50RI3DUNRI¿FH 3OHDVHPDUN\RXUFDOHQGDUVDVZHZLOO21/<$&&(376$03/(6 booster seats protect children from serious RQWKHPRUQLQJRI021'$<$8*8677+ injury by more than 60 per cent. IURP$07230 Proper installation and use of a booster seat are 'URS2IIORFDWLRQVZLOOEHLQFOXGHGLQWKHVDPSOHERWWOHSDFNDJHV important. For more information call 1-888-767-7640 $Q\TXHVWLRQVSOHDVHFRQWDFW or visit the Road Safety section at mpi.mb.ca. /LWWOH6DVNDWFKHZDQ5LYHU&RQVHUYDWLRQ'LVWULFW 32%R[ 2DN5LYHU0%5.7 DWRU7ROO)UHH 8 Friday, August 2, 2013 Th e Minnedosa Tribune
SANDY LAKE NEWS
By DIANE BACHEWICH tree. Th e infant daughter of some 60 descendants of Walter Prokopchuk of together, old fashioned Gloria Campbell and Chad and Melissa Davies the late Tom and Ann Bu- Vancouver is presently BBQ supper at the North lad to see Francis Janice Duchominsky trav- was honoured with a baby hay held a family reunion spending a month with Hall for family and close GKuzmak home from elled to Medicine Hat, AB shower on Friday evening at the farm yard of Ger- sister Elsie Spitula. friends. Also, we got to Brandon Regional Hospi- to Pick up her two grand- at the Drop-in Centre. It ald and Gladys Ryback at Kathy and Brian Bragg meet their future son-in- tal and doing much better children and take them was well attended. Lake Audy. Th ere were 17 of Sherwood Park, AB are law Tom, fi ancé of daugh- after her knee surgery. to Reston, MB to pick up Janice Duchominsky children under the age of spending a few days with ter Ayn’s. A good fellow- Visiting with Sadie two more grandkids. Glo- and Jean Derhak were out seven present. mom Sadie Rystephanuk ship was held by all. Prokopchuk were her ria has four little ones for a few days, but unfor- Dennis and LaVerne and attended the Spitula- Wayne and Rebecca daughter Sandra and from ages two to six years tunately Jean was taken Lewandoski of Fort Mc- Fediuk wedding in Winni- Lewandoski and children granddaughter Taylor of holidaying and keeping back by son John Antoni- Murray are spending part peg. Max and Isabella of Win- Moose Jaw, SK. grandma Glo a hopping- tion when she was called of the summer here at On July 26th and 27th, nipeg are holidaying for A large family gather- happily. for an emergency eye their cabin. once again Gerald and the past three weeks here ing attended the Sichews- Saturday was a busy surgery. Speedy recovery Helen Quellette and Gladys Ryback of Lake at the lake. ki-Stasiuk family reunion day here with the celebra- and hope everything went son of Cold Lake, AB Audy hosted a family re- Bill Shurvell of Kam- held at the Sandy Lake Rec tion of Heritage Days. It well. Janice stayed back called in for a surprise vis- union on the Ryback side. loops, BC and Betty Ross Centre on the July 20th started with the delicious for a holiday. it with Diane Bachewich. It was the fi rst time some of Toronto, ON and Dennis weekend. fried bread at the outdoor Th e Legion Men’s Also spending the week- of the cousins from Chica- Shurvell and Bryan Sieben A baby shower for kitchen. Th en at the fi re monthly 50/50 draw for end with Diane were neice go, US have met and were of Calgary, AB spent a few little Brielle Antonation hall were demonstrations the month of July was won Shelly, Carlin and Victoria never out in this part of days visiting with Earle held on the afternoon of of Ukrainian Easter egg by Anne Huculak. Bedrey of Vanscoy, SK. the country. and Marcia Shurvell and Sunday, July 21st at the painting by Lisa Rystepha- Th e family of Gerald Th ey also attended the Leonard and Pam Le- the rest of the family. Drop-in Centre was well nuk, rope making by An- Ryback helped him cele- Spitula-Stasiuk reunion. wandoski held a great get attended. thony Rystephanuk, paper brate his 74th birthday on Bev Marchischuk had fl owers of roses, carna- Sunday, July 28th. Birth- her nephew Dennis and tions and lily’s by Helen day cake and coff ee were Eva Wahasko of Salmon Derhak, wheat weaving by they treat for everyone Glass Tiger in Free Outdoor Concert Arm, BC visiting with her. Darcy Rystephanuk and present. Th e Communities in cross stitching by Ovia Jennie Coulson of Bloom held their annual Bachewich. Lorrie Lewan- Dauphin, MB spent the at Riding Mountain National Park BBQ supper on Friday, doski was in charge of the day with Helen Derhack July 19th at the outdoor clay hut and explaining on Monday. kitchen. all the details about it. Congratulations to Happy Birthday to Speeches and greetings Pam Spitula and Graham Lorrie Lewandoski who were given by Helen Le- Fediuk who were mar- treated everyone at the wandoski, Robert Sopuck, ried in Winnipeg on Sat- Drop-in Centre to birth- Murray Davies and Do- urday, July 27th. Pam is day cake, ice cream and reen Stapleton. It was nice the daughter of Ennis and saskatoons which he to see so many volunteers Debbie Spitula. picked of fhis Saskatoon helping out for this event. On July 21st and 22nd
0LQQHGRVD&RPPXQLW\ If your label reads &KLOG&DUH&RRS 1HZ.LQGHUJDUWHQ3URJUDP 13 /08 /31 DW7DQQHUV&URVVLQJ6FKRRO It’s time to renew! /LPLWHGVSRWVDYDLODEOHIRU6HSWHPEHU SUBMITTED est entry onto the charts, take in various activities GD\6XEVLG\$YDLODEOH “Hit and Run,” Moskaluke throughout the day. Th e Call 867-3816 is making a name for her- Wasagaming Chamber of DPSP0RQGD\)ULGD\ iding Mountain Na- Rtional Park (RMNP) self in the Country Music Commerce will host the &DOO&KULVWDDW is celebrating its 80th an- world with her sassy, con- ever popular Boo in the niversary in true 80s style! fi dent voice and her no Park, the annual warm up On Saturday, August 24th, holds barred lyrics. for Halloween which gives Juno Award winners Glass “Live entertainment the park’s youngest visi- Tiger will headline this and special events con- tors a chance to go trick- year’s free outdoor con- tinue to be a park summer or-treating and take part in
cert! tradition,” said Acting Park several spooky activities. Th e 80s? Yeah, why Superintendent Richard Th is year visitors can not? Whether you are re- Dupuis. “As we continue experience the new Parks living past “glory days” or to work with our partners Canada Zone. Th is popular checking out the retro style and bring new experi- activity area features many of your parents’ era, this ences to our visitors, Parks learning and entertain- event will be entertaining Canada’s goal is to off er ing activities for anyone for everyone with classic outstanding experiences curious about nature and hits from Glass Tiger like that connect people to our conservation. Th ere will “Don’t Forget Me When parks in new ways. Our vis- also be an oTENTik open I’m Gone, “Th in Red Line” itors will be able to enjoy house for those who have and “Someday”. music in a casual concert not yet seen this cozy and Opening act Jess Mos- setting and there is plenty hassle-free addition to the kaluke, Saskatchewan’s of open space for them to menu of options available CMA 2013 Female Vocalist set up their lawn chairs at the Wasagaming Camp- of the Year, is a young up for an unobstructed view ground. and coming singer song- of the stage in Manitoba’s Th e concert is targeted writer from Langenburg, premier tourism destina- to appeal to all ages. Regu- Saskatchewan. From her tion.” lar park entry fees will ap- breakout single, “Catch Me In addition to the con- ply for the weekend. If You Can,” to her new- cert, visitors will be able to Th e Minnedosa Tribune Friday, August 2, 2013 9 NEWDALE NEWS
By RAVEN’S GLEN WI While here Fern and Shir- Rink on July 20th. Th eir Pederson. Best of luck! bogging, with all entries their way home to Gimli, ley attended the 50th An- daughter Gwen has spent Th e Strathclair Mos- making it through in good from visiting family in Sas- any from town en- niversary of Georgina and many hours over several quito AA ball team played time. Th is was followed by katchewan. Mjoyed the annual Albert McEvoy of Alexan- years, compiling the Sta- in Morden on July 20th at diff erent classes of trucks, Welcome home to Gerald Strathclair Fair on July der, held in Brandon. Fern siuk family history and the Mosquito AA Cham- with some going through Watkins who has spent the 16th, starting with the pan- is a cousin of Georgina’s. spearheading this reunion pionship,15 team tourna- in great times and others last three weeks visiting a cake breakfast, parade, dis- Shirley then drove her to with help from many fam- ment, but came out on needing a pull out! Hav- brother in Brampton, On- plays and then listening to her sister, Hollis Stewart’s ily members. the short end of the four ing the time clock and an tario. the mellow tunes provided home in Miniota, where Congratulations to the games they played. New- emcee made it much more It was nice to see Di- by Corrine Mervyn, who Fern visited for several Oak River Bantam AA ball dale members were Tyler fun for the fans. ane (Dymtar) Doerntlien entertained in the rink days before heading home team on winning the Base- Dalke, Nathan Lamb, Kristi Mona Moyer, Parkland from Calgary here visiting in the afternoon. Special to Denver. Also, Marilyn ball Manitoba Bantam Morris and Ryan Pedersen. Seniors Co-ordinator took with Uncle John Dymterko, guests joining Corinne on and Arnold Grambo of AA Championship July Th e Leisure Inn’s Dale a group of Strathclair and at Harrison House and her stage were her Dad, Mur- Brandon stopped to visit 20-21st. Th ey beat Pilot and Melissa Smith, hosted Newdale seniors on the sister Brenda Passegger, ray Mervyn on guitar and Shirley on their way home Mound in the fi nal 8-1 and the third annual “DALEF- supper cruise on the Mar- for a few days last week. Zack Koscielny on violin. from attending a Hudson went undefeated through EST” on July 19 -20th. Th e tese at Clear Lake on July Grandson, Pat, Sherry A cold plate supper and Bay Route meeting in Sas- the round robin games. Bad Marleys entertained 29th. and Carter Bradley of Win- ball games ended the day. katchewan recently. Th is qualifi es them to play on Friday night in the big Tom and Marge (Su- nipeg visited with Grand- Shirley Pederson had Ralph and Shirley in the Western Canadian tent and Saturday was lymka) Robinson and ma, Eileen Bradley last her Normal School friend Pedersen and 190 fam- Championships in Swift “mud-bogging” day, with their daughter Cathy vis- weekend. Th ey attended Fern Dzaman, from Den- ily members attended the Current in August. Team lawn mower races start- ited with Ralph and Shir- the Folk Festival in Bran- ver Colorado visiting her Stasiuk Family Reunion members from Newdale ing off , followed by Quad- ley Pedersen last week on don. for several days in July. held in Sandy Lake Curling were Eric Lamb and Rudy Business Cards We print business cards BASSWOOD NEWS in all styles & quantities. Colour Cards Stop in today prices starting at By ZELDA FIRBY for the Royal birth! She re- Ron and Margaret or call us 250 500 1000 turned to Edmonton, AB Sweet and Marla Pearce for details. $45.00 $70.00 $110.00 eepest sympathy is on Sunday, July 28th. and family have returned Dextended to Isabella Recent visitors with to their homes in Calgary, The Minnedosa Tribune Proven and family and Ron and Gaileen Kingdon AB after spending a week Minnedosa, MB ● 204-867-3816 relatives on the passing were Jill Mills and Drayton with the Stan and Mark of husband, father and of North Battleford, SK, Firby’s. Th ey were also here grandfather Harold Proven Janna Kingdon of Winni- to attend the celebration of Onanole, MB. A memo- peg, MB and Graeme and of the marriage of Marvin rial service was held on Nakella Kingdon and Nora Sillen and Grace Yerex in Saturday, July 27th in the of Dauphin, MB. June. Th e celebration was valley at the residence of Marion Ogibowski and held at their farm at Erick- Dave Proven. Ray, along with the Reis son on July 20th. Patricia Menzies spent family of Winnipeg and the Heather Emerson- two days in Winnipeg visit- Terry McMillan family of Proven attended the wed- 7+(72:12)0,11('26$ ing her mother. She then Calgary AB attended the ding of a family friend in fl ew to Edinburgh, Scot- wedding of Brett Hextall Winnipeg on Saturday in 6HDOHG WHQGHUV ZLOO EH UHFHLYHG DW WKH 7RZQ RI 0LQQHGRVD¶V &LYLF $GPLQLVWUDWLRQ land where she spent three in Bismark, ND on Friday, which Taryn and Rachel %XLOGLQJORFDWHGDW0DLQ6WUHHW6RXWK0LQQHGRVD0%5-(XSWR weeks. While in Edin- July 26th. Luhowy were in the wed- SPSUHYDLOLQJORFDOWLPHRQ0RQGD\6HSWHPEHU burgh, she was able to take Mac, Gordon and ding party. )RUWKHIROORZLQJZRUNV a three-day course in Eliz- Cam Ross hosted a 25th Heather Emerson- abethan Embroidery. She wedding anniversary at Proven and Rachel Luhowy &RQVWUXFWLRQRIÀRRUVZDOOVPHFKDQLFDOHOHFWULFDODQGUHODWHGZRUNVWRFRPSOHWH then moved to London, the farm for their parents of Minnedosa spent a week DQG¿QLVKWKH0LQQHGRVD3XEOLF:RUNV6KRS7KHVKHOORIWKLVDSSUR[LPDWHO\ England for three weeks Barry and Johanne Ross on recently in New York. ¶[¶SRVWIUDPHEXLOGLQJKDVDOUHDG\EHHQFRQVWUXFWHG7KHLQWHULRUOD\RXW – a thrill to be in London Saturday evening. ZLOOLQFOXGHDQRSHQVTIW6KRSDUHDDVZHOODVVTIWRIRI¿FHDQGZRUN VSDFHVZLWKPH]]DQLQHDERYH 7KHVHDOHGWHQGHUVDUHWREHPDUNHGDV Subscribe to The Minnedosa Tribune 5)4%LGIRU0LQQHGRVD3XEOLF:RUNV6KRS3KDVH,, $VLWHUHYLHZLVVFKHGXOHGIRUDP0RQGD\$XJXVWDW&UHUDU MAIL THIS FORM WITH PAYMENT TO BOX 930, %D\0LQQHGRVD0%%LGGHUVDUHUHTXLUHGWRDWWHQG6HHWKHWHQGHUGRFXPHQW MINNEDOSA, MB R0J 1E0 PHONE 204-867-3816 DSSHQGLFHVIRUWKHORFDWLRQRI&UHUDU%D\ (DFK WHQGHU PXVW EH DFFRPSDQLHG E\ D IXOO\ H[HFXWHG %,' %21' RQ WKH IRUP Within Manitoba: NAME: SURYLGHGDQGLQIDYRXURIWKH7RZQRI0LQQHGRVDIRUWKHDPRXQWVKRZQRQWKH7HQGHU $37.29 tax included 7HQGHUVZLOOEHSXEOLFO\RSHQHGDQGUHDGDWWKHORFDWLRQWLPHDQGGDWHVSHFL¿HGDERYH 7HQGHUGRFXPHQWVPD\EHREWDLQHGRQRUDIWHU7XHVGD\$XJXVWWKDWWKH7RZQ Other Canadian locations: RI 0LQQHGRVD &LYLF$GPLQLVWUDWLRQ 2I¿FH 0DLQ 6WUHHW 6RXWK 0LQQHGRVD ADDRESS: 0%RUDWWKHRI¿FHVRI$VVRFLDWHG(QJLQHHULQJ)LYH'RQDOG6WUHHW6RXWK $34.65 tax included :LQQLSHJ0%RQGHSRVLWRID&(57,),('&+(48(LQWKHDPRXQWRIRQ HDFK7HQGHU'HSRVLWZLOOEHUHIXQGHGRQO\RQ WKHVXEPLVVLRQRIDERQD¿GHWHQGHU Renewal RU WKHUHWXUQRIWKHWHQGHUGRFXPHQWVZLWKLQVHYHQ GD\VDIWHUWHQGHUFORVLQJLQ UHXVDEOHFRQGLWLRQ New Subscription TOWN: 7KHORZHVWRUDQ\WHQGHUPD\QRWQHFHVVDULO\EHDFFHSWHG PROVINCE: .HQ*-HQNLQV Online subscriptions at &KLHI$GPLQLVWUDWLYH2I¿FHU www.minnedosatribune.com POSTAL CODE: 7RZQRI0LQQHGRVD 10 Friday, August 2, 2013 Th e Minnedosa Tribune The Erickson 4-H Beef Club would like to thank the following businesses for purchasing their 4-H steers. Minnedosa Pharmacy - 2 steers Chabot Equipment, Drayson Minnedosa Vet Clinic & Brothers & Primetime Parkline Auto Embroidery Enns Brothers John’s Tax Service & Accounting Minnedosa Insurance Burgess Quality Foods & Saler Bachoe & Ken Kane Integra Tire Aerial Spraying Heritage Co-op R.M. of Minto & Mowat Livestock R.M. of Odanah Thank you to the following for supporting the Erickson 4-H Beef Club Achievement Erickson Credit Union Erickson Legion RBC Shirley Montgomery Curle Farms Allen Kopechuk Crestview Land & Cattle Leona Smith Clanwilliam General Store Parish Backhoe Joe & Helen Woychyshyn Minnedosa Credit Union Heritage Co-op Craig Pearson Leanne Rowat Trackside Angus Cattlex LTD. Cook Family R.M. of Minto R.M. of Odanah R.M. of Clanwilliam Dorothy & Barrie Brooking Thank you to Minnagro for sponsoring our new club shirts! Th e Minnedosa Tribune Friday, August 2, 2013 11
Sale Dates: *We accept Visa, Master Card & debit card purchases AUGUST 2 - 8 * Try one of our delicious BBQ chickens! *We deliver within town limits Mon - Sat at 4:00 p.m. (STARTS FRI 9:00 A.M. - ENDS THURS 9:00 P.M.) * We sell fruit, veggie & meat trays and fruit baskets ($2 charge - $10 minimum order) (24 hours notice is appreciated) *Senior’s Discount every Friday (65 & up) *We sell lottery tickets *We sell R.O. water GROCERY FROZEN FOODS Unico tomatoes - diced, whole or crushed ...... 796ml ...... $1.59 Michelina’s frozen dinners asstd .....227-284gr .. 4/$5.00 General Mills Cheerios asstd ...... 400-500gr ...... $3.99 Highliner cod fillets ...... 400gr ...... $5.99 Miracle Whip asstd ...... 890ml ...... $3.49 NN english muffins CP ...... 12ea ...... $3.49 PC pop asstd...... 12x355ml ...... $3.19 Breyers Classic Ice Cream asstd ...... 1.66lt ...... $4.89 PC garlic & butter croutons ...... 140gr ...... $1.99 GHB novelties - creamsicles, revello or fudgesicle ...... 12x60ml ...... $4.69 PC choc covered raisins, peanuts or almonds340gr ...... $3.99 PC brussel sprouts, baby carrots or broccoli ...... 500gr ...... $2.49 PC chocolate melts asstd ...... 340gr ...... $3.99 PC Woodfried pizza asstd ...... 410gr ...... $4.99 PC Green dishwasher detergent ...... 54ea ...... $9.99 PC Texas onion rings ...... 907gr ...... $4.99 PC alkaline batteries asstd ...... 2-4ea ...... $2.99 Five Alive and Fruitopia beverage asstd ...... 295ml ...... 4/$5.00 PC crisp thin vegetable crackers ...... 225gr ...... $1.79 McCain Superfries asstd ...... 900gr ...... $2.59 PC English cream crackers ...... 200gr ...... $1.79 PC NFC apple juice ...... 1.89lt ...... $2.49 Gatorade - orange ...... 6x591ml ...... $4.99 Tim Horton’s coffee ...... 930gr .... $16.99 NN honey graham wafers...... 400gr ...... $1.99 MEATS Pepperidge Farms Goldfish asstd...... 180-200gr ...... $2.99 Betty Crocker Froot by the Foot asstd ...... 128gr ...... $2.99 Fresh whole chicken ...... $2.99/lb Lay’s potato chips asstd ...... 270gr .. 2/$6.00 NN garlic coil ...... 750gr ...... $5.59 Fruite drink - orange, grape or fruit punch ...... 2lt .. 2/$3.00 NN regular bacon ...... 500gr ...... $3.99 PC bathroom tissue ...... 24rl ...... $5.99 Maple Leaf Pizza Pack ...... $1.35/100gr NN chunk light tuna CP ...... 6x170gr ...... $7.49 Beef Striploin steak ...... $7.99/lb NN white vinegar ...... 4lt ...... $2.49 Club pack lean ground beef ...... $2.79/lb NN marshmallows CP - regular or mini ...... 1kg ...... $3.99 Fresh pork shoulder blade steak ...... $2.49/lb Kellogg’s Fun Pack cereal ...... 210gr ...... $3.49 Fresh pork shoulder blade roast boneless ...... $$2.59/lb NN plastic wrap CP ...... 305m ...... $7.99 PC Burgers asstd ...... 1.13kg .... $12.99 Purina cat chow ...... 8kg ...... $21.99 NN chicken wings asstd ...... 907gr ...... $13.99 Ragu pasta sauce asstd ...... 640ml ...... $1.49 PC breaded chicken bites ...... 680gr ...... $8.99 Uncle Ben’s Bistro Express rice asstd ...... 250gr ...... $1.99 Seaquest crab flavoured pollock ...... 227gr ...... $2.99 NN white rice ...... 2kg ...... $3.99 Ziggy’s X-Lean chicken - smoked or cooked ...... $1.99/100gr Kraft pourable salad dressing asstd ...... 475ml ...... $2.59 Diana sauce - gourmet chicken n rib ...... 500ml ...... $2.49 Bick’s pickles - baby dills, swt mixed or yum yum ...... 1lt ...... $2.99 Miss Vickie’s potato chips asstd ...... 200gr ...... $2.99 Pringles potato chips asstd ...... 168gr ...... $1.99 PRODUCE Ocean Spray cranberry cocktail asstd ... 1.89lt ...... $2.99 Gala a pples ...... $1.49/lb Crest toothpaste asstd ...... 130ml ...... $2.49 Corn ...... 2/$1.00 Black Diamond cheese - marble or medium .700gr ...... $8.59 Zucchini ...... $0.99/lb Source yogurt asstd ...... 650gr ...... $2.59 Pillsbury cresent rolls ...... 235gr .. 2/$3.00 Red cherries ...... $3.99/lb Black Diamond cheese slices ...... 1kg ...... $6.99 Cauliflower ...... $1.99 Dole ultimate caesar salad kit ...... 252gr ...... $2.99 Danone Creamy yogurt - strw/pch/ch/mng16x100gr ..... $4.99 I Can’t Believe It’s Not Butter ...... 454gr ...... $2.99 Grape tomatoes ...... pint ...... $1.99 Red peppers ...... bag of 4 ...... $2.99 Heinz ketchup 1lt $3.49 BAKERY Motts Clamato juice asstd 1.89lt $2.99 Wonder hot dog or hamburger buns asstd...... $1.99 Dutch Oven bread asstd ...... 3/$4.98 NN™ regular weiners 450gr $2.49 OPEN MONDAY AUGUST 5 - 9 A.M. - 9 P.M. ALL PRICES ARE PLUS GST, PST & OTHER LEVIES WHERE APPLICABLE *WE RESERVE THE RIGHT TO LIMIT QUANTITIES /8&.<'2//$5 ) 2 2 ' 6 OPEN 9:00 AM - 9:00 PM, 7 DAYS A WEEK 70 Main Street South, Minnedosa 867-2821 *PRICES AVAILABLE AT THE LUCKY DOLLAR IN MINNEDOSA ONLY 12 Friday, August 2, 2013 Th e Minnedosa Tribune Moments in Riding Mountain: Death of a Tyrant
home and garden, and could feel the ground shift pocket gopher. I am vic- However, in an eff ort began its insidious task of below your feet as yet an- torious, and to me go the to put a positive spin on rendering the population other tunnel collapsed. spoils. Or at least the peas. the situation, let me say into a quivering mass of Th is is where I centred Until another gopher that I fi nd this year’s mos- fear. Ok, perhaps I exag- my counter attack. I dug shows up, of course. quito populations “inter- gerate, since a full 80% of out various tunnels, laid esting”. “Interesting” in the household population my trap inside, and recov- Nature Notes: their abundance this year, didn’t even know about ered the hole with straw and interesting that they the @#$!% pocket gopher. and dirt. Alas, the @#$!% Admittedly, I was a bit are attacking us at high But that didn’t stop the pocket gopher was smart. shocked by the response noon, on windy days, in remaining 20% (me) from Countless times I would from my article on ticks. the sunshine. You have to waging an epic battle for return to fi nd burrow and It never dawned on me admire their persistence. supremacy of the gar- trap fi lled with soil. that other people would I have noticed that den. For a while, I had It was only when I view biting ticks as odd. diff erent species are now nearly given up in despair, harkened back to the wise Th e good news is that I coming out of the wood- Th e cheeky pocket gopher can just like Vichy, France. I words of Ray Frey that I have since heard of several work. Big lazy mosqui- be diffi cult to deter. watched as 1/3 of my pea gained success. Veteran other tick biters, although toes have been replaced vines withered, their roots gopher trappers, the Freys most are still in the closet. by little ones that seem to By KEN KINGDON of pocket gopher known cut off from below. Next happened to mention that At least I know I am not take pleasure in inducing to inhabit my garden. Per- it was the garlic – whole to trap them, you have to alone. Fight on tick-biting as much pain as possible here is jubilation in the haps it lives in yours too). plants disappeared over- set the trap at a 45 degree brothers (and sisters, if while drawing blood. Now TKingdon household Th ey say war is hell, night. angle. Anything less would there are any women who there is concern about today. Fireworks are ex- and from the skirmishes Th at’s when Sir Win- make the gopher fi ll the bite ticks). West Nile Virus. ploding, the dog is doing I have been involved in ston Churchill’s words “we area with dirt. And while we are on It’s all very interesting, cartwheels, and there is a over the past week, I would shall not fl ag or fail” fi lled Th is last time, a day the subject of blood suck- in a painful, miserable sort perpetual ray of sunshine have to agree. Sleepless my thoughts. No, I would that will go down in the an- ing invertebrates, this is of way, but the only con- beaming down on our nights, countless engage- not give up. I would not al- nals of history, I placed my the worst year for mosqui- solation is that September house. I even fi nd myself ments with the enemy, low the @#$!% pocket go- trap on a steep upward an- toes in the 15 years that we is only a month away. humming a few bars of feint and counter-feint, all pher to win. I would step gle. I covered it with straw have lived at our current “ding dong, the witch is adding up to a struggle that up my game. My weapon and soil. I went to bed. I house. dead.” defi nes classic guerrilla of choice? A rat trap. woke up. I discovered the Th ese celebrations, warfare. Catching a @#$!% dead @#$!% pocket go- akin to those experienced It all began when I no- pocket gopher is not easy. pher, killed instantly with at the end of the Second ticed that something was Finding its burrows is. Th e a blow to the head. I cel- New Business World War in 1945, come killing my rhubarb. Are dirt mounds started show- ebrated. from the death of a @#$!% you kidding me??? Noth- ing up in rather discrete Needless to say, my pocket gopher*. (*You’ll ing kills rhubarb, or so I places – among the peas, victory will be viewed by notice the @#$!% modifi er thought. under the rhubarb leaves. some as much ado about Directory available I am using on its name – Evidently some agent Walking in the garden was nothing. Th ese critics, I this is deliberate, as this is of evil, a “mole” if you like, like walking in a minefi eld, surmise, have never done a very specifi c subspecies had infi ltrated our happy as at any moment, you battle with the @#$!%
Additions to the Voter’s List and/or 127,&(2)120,1$7,216 Personal Security Protection Requests 585$/081,&,3$/,7<2)6$6.$7&+(:$1 RURAL MUNICIPALITY OF 127,&(,6+(5(%<*,9(1WKDWRQWKHIROORZLQJGD\V SASKATCHEWAN $8*867WKWRWKHWK$' %HWZHHQWKHKRXUVRIDPWR1221DQG In accordance with Section 36 of the Municipal Councils and SPWRSP School Boards Election Act (MCSBEA), the Rural Municipality $WWKH2I¿FHRIWKH5XUDO0XQLFLSDOLW\RI6DVNDWFKHZDQ of Saskatchewan’s Voter’s List is open for changes or revisions at 435-3rd Avenue, Rapid City, MB Tuesday through Thursday on DWUG$YHQXH August 6th to 8th, 2013. At this time the Senior Election Official 5DSLG&LW\0% will be available to update the voter’s list. 120,1$7,216ZLOOEHUHFHLYHGIRUWKHRI¿FHVRI Ͳ Any person who is eligible to vote in municipal &281&,//25IRU:$5' elections in the Local Authority of Rural Municipality of Saskatchewan can have his or her name added to the RIWKHDIRUHVDLG/RFDO$XWKRULW\ Voter’s List, or have any information about the voter on the Voter’s List corrected. 7KHQRPLQDWLRQGHDGOLQHLV$XJXVWDWSP 1RPLQDWLRQVFDQQRWEHDFFHSWHGDIWHUWKLVGD\ Ͳ Any person can request to have his or her name and address obscured from the Voter’s List. By DARRYL HOLYK $OO QRPLQDWLRQV VKDOO EH PDGH LQ ZULWLQJ DQG VKDOO EH VLJQHG E\ DWOHDVWWZHQW\¿YHHOHFWRUVRU127OHVVWKDQRIWKHHOHFWRUV Ͳ A person whose name has been obscured will receive a ZKLFKHYHULVWKHOHVVHU RIWKHDXWKRULW\RUZDUG DVWKHFDVHPD\ Personal Security Certificate and identification number. very two years, the Minnedosa Chamber of Com- EH EXWLQDOOFDVHVE\DWOHDVWWZRHOHFWRUV(DFKQRPLQDWLRQVKDOO In a civic election, that person may only vote by Sealed merce reprints the local business directory for busi- Envelope Ballot and cannot vote in person at the regular E EHDFFRPSDQLHGE\DZULWWHQDFFHSWDQFHE\WKHFDQGLGDWHDQGDOVR or advance voting places. nesses and residents. Th e 2013-2014 Business Directory E\WKHFDQGLGDWH¶VGHFODUDWLRQRITXDOL¿FDWLRQ To implement the above, a written request must be submitted to is now complete and ready for distribution. Th is year’s di- 1RPLQDWLRQVPD\EH¿OHGLQSHUVRQDWWKHDERYHORFDWLRQRQWKH the Senior Election Official, in person, by email, fax or mail to: rectory features the name and phone numbers of all local GDWHDQGKRXUVVSHFL¿HGE\DQRI¿FLDODJHQWRUE\ID[7RREWDLQD Chamber members as well as other important contacts QRPLQDWLRQSDSHUDQGRUFDQGLGDWH¶VGHFODUDWLRQRITXDOL¿FDWLRQ The R.M. of Saskatchewan FRQWDFWWKH6(2DWWKHWHOHSKRQHQXPEHUOLVWHGEHORZ 435-3rd Ave., Box 9 such as emergency numbers, school, churches and com- Rapid City, MB munity halls. 1RPLQDWLRQSDSHUVQRWDFFRPSDQLHGE\WKHUHTXLUHGGRFXPHQWV R0K 1W0 Th e new business directory is available free of charge DQGQRWSURSHUO\¿OHGVKDOOEHUHMHFWHG Phone: (204) 826-2515 'DWHGDW5DSLG&LW\LQWKH3URYLQFHRI0DQLWREDWKLVWKGD\RI Fax: (204) 826-2274 and can be picked up at the following locations; Th e -XO\$' Email: [email protected] Fashion House, Minnedosa Credit Union, Th e Minnedo- %UHQGD)DQVKHU A By-Election will take place in September, 2013 sa Tribune, RBC (Royal Bank), Burgess Quality Foods, 6HQLRU(OHFWLRQ2I¿FLDO Schimmel’s Bakery, Minnnedosa Pharmacy, Town of 5XUDO0XQLFLSDOLW\RI6DVNDWFKHZDQ Brenda Fansher 3KRQH Senior Election Official Minnedosa, R.M. of Minto/Odanah offi ce, Minnedosa )D[ Questions? Call (204) 826-2515 Insurance, John’s Tax Service, Heritage Co-op Food Mar- ket and the Community Development/BDO offi ce. Th e Minnedosa Tribune Friday, August 2, 2013 13 American fugitive located in Minnedosa Continued endangering another per- crossing. law enforcement she had earned in Canada with sentence based on Ke- from Page 1 son. However, in March Keating proceeded to managed to keep her true an American law enforce- ating fl eeing the United 1998 with a pending trial build a life with her two identity a secret. ment database. Matching States, evading arrest and Keating sideswiped Keatings lawyer lost all children and common- Sixteen years later and identifi cation confi rmed because of her additional Andersons vehicle on In- contact with her and the law husband, Leonard almost 3,000 km away, an that Jean McPherson was impaired driving arrests terstate #5, near Albany, court issued a bench war- McPherson, on a farm near investigator with Manitoba in fact, Jean Terese Keat- while in Canada under an Oregon, causing Anderson rant for her arrest. Minnedosa. RCMPs Red River Integrat- ing, the fugitive suspect in assumed name. to lose control of her ve- Authorities believe Authorities in Oregon ed Border Enforcement Andersons death. Andersons family was hicle and collide head-on she crossed the Canadian continued to follow leads Team received a tip that Keating was arrested relieved to hear that the with an oncoming vehicle. border in 1998 with her for several years in hopes a local woman, who was in Minnedosa on April 4th fugitive had fi nally been Anderson died at the scene two children, ages one and of locating Keating to stand originally from Oregon, and was issued deporta- captured and released a and several other motor- three. trial. was bragging at a bar about tion documents two weeks statement via the state ists involved experienced Offi cials are unclear During her time how she had escaped be- later. She was detained in police, “While there is no minor injuries. of the exact time or the de- in Manitoba, Keating ing prosecuted for a DUI Winnipeg, MB, as a fl ight price to be put on repay- Keating was indicted tails of Keatings entrance had numerous run-ins wreck that killed a woman risk until June 12th where ment for taking a life, and it in Linn County on fi rst- to Canada but explained with authorities, includ- a number of years ago. she was deported to North certainly won’t bring Jewel degree manslaughter, that in the late 1990s it was ing a conviction for im- Manitoba RCMP con- Dakota and barred from back, we are thankful that DUI, reckless driving and unnecessary to produce paired driving. But, de- tacted border offi cials re-entering Canada. fi nally after 16 years of run- three counts of recklessly passports upon border spite her encounters with which found that there was Last week Keating re- ning, hiding and torment, no Jean McPherson liv- turned to an Oregon court our families will have some ing as a legal immigrant in room where a judge set closure; knowing that Jean Canada. her bail at $5 million. Ac- Teresa Keating is in cus- Canadian authorities cording to a motion fi led tody and justice will be CADURCIS NEWS further identifi ed Keat- in Linn County the Dis- served.” ing by tracing the fi nger trict Attorney’s Offi ce will By DOREEN TROTT ily on the passing of Eva Mike, Maria, Rose- prints and mug shot she be seeking an enhanced (Hales) Shelvey of Bran- mary and Jasper Lea of ongratulations to don, age 108. Winnipeg; Shirley Met- CCandice Bramley and Word has been re- calfe of Brandon and Bar- Tanner Babee who were ceived of the death of Ar- ry and June Humphries married in Minnedosa on thur Lindenberg of Bran- of Clanwilliam visited July 20th. don. The Lindenberg last week with Malcolm A number from the family farmed where Ken and Shirley Rose. 7KHSHUIHFW area attended the funeral and Sherrie Sharpe now Donna and Tanya :HGGLQJ for Harold Proven at Da- reside and began their Northam and children vid Proven’s farm in the seed business on that Electra and Sam Bohner valley. Our sympathy to land. They were very ac- of Airdrie, AB visited last Jane McKinnon on this tive in Cadurcis Church. week with Don and Mar- LQYLWDWLRQLVWKHVWDUWRI passing of a cousin and Jim and Nancy Greer garet Northam. Sam is re- to other members of the entertained a large num- maining for a visit. Proven family. ber of family, friends and Condolences also to neighbours at the farm the extended Hales fam- on Sunday. VRPHWKLQJEHDXWLIXO
FRANKLIN NEWS ,QYLWDWLRQVDQG (QYHORSHV By BERYL PARROTT ily held a Family Reunion Darryl Holyk and Karen at the Franklin Hall on the Dalgarno on their recent (QYHORSH6HDOV on and Beryl Parrott weekend of the 13th of marriage. May you enjoy Rvisited Jim Parrott and July. many happy years to- Sally Sykes in Oshawa, ON Dennis and Irene Mag- gether. 6FUROO5LQJV and at the cottage at Glam- wood visited with Patrick, Th ought of the Day: our Lake, ON after spend- Leanne, Seth and Camryn “People with many inter- ing two days in Th under Magwood at Rocky Rapids, ests live, not only longer, 7KDQN\RXQRWHV Bay due to the fl ood in the AB recently. but happier.” Toronto Airport. Congratulations to We also visited Phyllis .HHSVDNHERRNPDUNV Williams in Gravenhurst, ON, Laura Parrott in Ot- tawa, saw the Parliament Minnedosa 3ODFH&DUGV buildings etc and drove across the border into Lions Club &RQIHWWL&DUGV Gateneau, QC. Zachary Congratulations Parrott and Sarah Ferencz met us at Pappa’s Restau- 3HUVRQDOL]HG rant on the “Danford” in Gerri Cooke $500 Toronto on the 15th of July. Cathy & Leonard Wark $300 QDSNLQV On the 16th of July we vis- Kathy & Gord Lane $200 ited with George and Beth Budd at Lakefi eld, ON. We 3HUVRQDOL]HG The Minnedosa Tribune saw the Locks on Fenelon Winners of the July, 2013 PDWFKERRNV Falls and the Lift Lock on 14 3rd Avenue SW the canal at Petersbor- Lions Club 200 Draw DQGER[HV ough, ON. Th e Henderson Fam- 204-867-3816 5) 14 Friday, August 2, 2013 Th e Minnedosa Tribune Uses for water from dehumidifi ers
the top of the slurry, and garden. Do not use this or not I can recycle food get hair off the items, and paper fi bres cannot sepa- water on plants grown for containers such as Kraft onto the fi lter, but I would Solutions and rate from oils during the consumption because of Dinner boxes and empty like to try an alternative. pulping process. Essential- the risk of harmful con- waffl e boxes. Th ey do have So, my question is, how Substitutions ly, this contaminant causes taminants. You can also a recycling symbol on do you put the vinegar in By the entire batch to be ru- use dehumidifi er wa- them which says, “Made the dryer, or is it added ined. Th e easiest remedy ter to save on your water from 100% recyclable ma- to the wash rinse? I look REENA NERBAS for this problem is to cut or bill by pouring the water terial”. Does that mean they forward to hearing from tear out the soiled portions into your toilet tank until it were recycled previously you. I enjoy your column of your pizza boxes and is full after each fl ush. or does that mean they can very much and have re- Dear Reena, storage tub. Or use them garbage them. be recycled? Th omas ceived many useful tips. Being a bachelorette, for fl ower arranging, when Dear Reena, Candice I have several pizza res- using fl orist’s oasis (oasis is Dear Reena, Love your column and Dear Th omas, taurants on speed dial and the green foamy stuff they I have a dehumidifi er your book series. I was re- If cardboard has a re- Dear Candice, when the pizza arrives, use). Stick it to the bot- in my basement that needs cently married and now cycling symbol on it; add Add half cup white it often has a little plastic tom of your container and emptying every day during live in a small home. It is it to your blue box. Most vinegar to your wash white table looking item in it will stop the oasis from summer months. I’m won- my goal to recycle but I am cardboard can be recycled load (not the dryer). Your the centre of the pizza. Do slipping. Florists often sell dering if this water is good not clear on what is con- several times before the clothes will not smell of you have any ideas as to these items for this use. for anything such as water- sidered recyclable. Can fi bers become too weak to vinegar and you will save how I can reuse these little Additional Com- ing plants. Trevor you provide me with a list manufacture into a new yourself a pile of money pieces of plastic instead ment: Many people as- of items that may be re- product. Th erefore, it is as vinegar is cheap. Fabric of throwing them out? sume that pizza boxes are Dear Trevor, cycled? Signed, Newly a good idea to recycle all softener sheets and liquid Candace recyclable because they Dehumidifi er wa- Wed and Clueless of the cardboard items in fabric softener do a won- are made from corrugated ter should not be used as your home that carry a re- derful job in clogging up cardboard. However, what drinking water because it is cycling logo. the hoses in your washing Dear Candace, makes parts of them non- Dear Newlywed! I know exactly what classifi ed as grey water that Additional Note: A machine. Vinegar on the recyclable is what comes Congratulations and you are talking about, re- may contain traces of lead good rule of thumb is to re- other hand works to clean inside them, specifi cally, good for you that you are use them to keep plastic and other dangerous ele- cycle according to the list out your washing machine the grease and cheese taking steps to reduce your wrap off a frosted cake or ments. However, there are above. Plastic grocery bags hoses and leaves every- from pizza. Food is one of ecological footprint. Th e similar food item if you’re a few interesting uses for cannot be recycled but thing fresh and static free. the worst contaminants in following is a list of what bringing it somewhere for dehumidifi er water. Yes, they can be re-used over But don’t get your hopes the paper recycling pro- can be recycled: News- a party and don’t want to you can use it to water the and over again. If you have too high, let’s face it as long cess. Grease from pizza papers, aluminium food transport a reusable food plants in your home and an abundance of plastic as you have pets you will be boxes causes oil to form at and drink containers, glass food and beverage bags in your home, donate in a constant fur battle. An- containers, steel food and them to a second hand other great tip is to lightly beverage containers, PET store instead of throwing sponge your clothes with (#1 plastic) bottle, tele- them into the garbage. water before putting them phone books, magazines into the washing machine, and catalogues, boxboard, Dear Reena, this helps to remove some juice boxes, gable top bev- One of your previous of the fur. If you are desper- erage containers, HDPE columns suggests switch- ate, purchase clothes that Manitoba (#2 plastic) containers, #4, ing to white vinegar to re- match the color of your The Surveys Act #5 and #7 plastics (Gee, duce static cling. I am not dog, this will make pet hair can they make the number having much luck with much less obvious. Lastly, system more complicated dryer balls. I have two very be sure to empty your lint Public Notice please?). For more infor- hairy dogs; try as I might trap after each use. mation about recycling to clean off the hair be- In accordance with section 11 of the above act notice is hereby given that the original contact your local govern- fore the washing machine, Fabulous Tips Monument at the following location has been lost: ¼ N Section 8, Township 14, Range some ends up in the dryer. of the Week 17 WPM. A new monument to perpetuate the original location has been planted by Ken ment. : Baley, Manitoba Land Surveyor on May 13, 2013. Dear Reena, Fabric softener sheets still If you want to reuse Any person wishing particulars about the re-establishment of this monument is advised seem to work the best to a Styrofoam egg carton to contact the following: Please tell me whether here’s a neat little trick. For Ken Baley or Examiner of Surveys young children who have Manitoba Land Surveyor Land Title Office class parties, fi ll each cup th 100-158 11 Street 276 Portage Ave. with Jell-O and refriger- Brandon, Manitoba, R7A 4J4 Winnipeg Manitoba, R3C 0B6 Phone 204-727-0651 Phone 204-945-2281 ate them until they are set. Kids can pop the Jell-O out and enjoy a yummy treat. Gently exfoliate your THE TOWN OF MINNEDOSA skin by rubbing it with brown sugar. Keep a con- HOLIDAY tainer near your shower. Brown sugar is the product Any person having an objection to or having any evidence which he desires to give GARBAGE COLLECTION ROUTES against confirmation of the re-establishment of this lost corner is to submit any such that many spas use; it fl ows objection or evidence in writing verified by affidavit to the Registrar General within ***TO BE OUT BY 8:00 A.M.*** easily down the drain and thirty days from the publication of this notice in the Minnedosa Tribune. leaves skin feeling soft. 021'$<$8*867 12*$5%$*( Where no objection to or evidence against the confirmation of the re-establishment &2//(&7,21 of this lost corner is received by the Registrar General within thirty days after Publication of this notice, or where any such objection is subsequently withdrawn in If your label reads writing, the Registrar General shall confirm the re-establishment of this lost corner. 78(6'$<$8*867 1257+(1' LQFOXGHV%UDQGRVDDUHD 13 /08 /31 Registrar General It’s time to renew! Manitoba Justice :('1(6'$<$8*8676287+($67 Land Title Office 276 Portage Ave. LQFOXGHV%LVRQ+LOOV$UHD Winnipeg, Manitoba R0M 0B6 Call 867-3816
Reference: Altus File # 164926 )5,'$<$8*867 6287+:(67 The Minnedosa Tribune Friday, August 2, 2013 15
TO PLAPLACECE AN AD REAL ESTATE COMING EVENTS BY PHONEPHONE CCallall 867-381867-38166 Hours to pplace,lace, correct or cancel ads: Monday - Friday 9 a.m. - 4 p.mp.m.. Minnedosa Service to BY MAIL CCLASSIFIEDLASSIFIED ADVERTIADVERTISINGSING 1RZ%XLOGLQJ Seniors Congregate Meal Th e Minnedosa Tribune,Tribune, P.O. Box 930,930, Program serving supper Minne Minnedosa,dosa, ManitobaManitoba R0J 1E0 meals for seniors at the 6FHQLF5LGJH(VWDWHV Townview Manor 6th fl oor BYBY FFAXAX 204-8675171204-8675171 Tuesdays, Th ursdays, Sun- NEW HOME FOR SALE &RQGRV days starting at 5:00 p.m. BY E-MAIL [email protected]@minnedosatribune.com Beautiful, open-concept 1308 $8.00 dine in, $10.00 de- sq. ft. bungalow fi nished livered. Call 204-867-2198 top-to-bottom built in 2010. Th e Minnedosa Tribune Ltd. reserves the right to after 1:00 p.m. on day of the Home features walk-out delete any words or phrases deemed by Th e Minnedosa meal or call 204-867-5190 basement, 3 + 2 bedrooms TribuneTribune Ltd. to be objectionable, or to refuse to publish anyany for all other inquiries. and 3 bathrooms located in a advertisement. Th e Minnedosa Tribune Ltd. shall not be Service to Seniors newly developed residential responsible for any loss or damage to any advertiser or third Menu: area of Minnedosa. Nicely party resulting from the failure of an advertisement to appear August 4th: landscaped back yard in Th e Minnedosa Tribune Ltd.Ltd. oror fromfrom anyany error or omission Roast beef and gravy, rolls, overlooks the Town from the in anyany advertisement which is published. potatoes, vegetables, salad, deck or from the brick patio pickles, dessert, tea and RATESRATES area below. In-fl oor heated coff ee double attached garage. OPEN HOUSE August 6th: $9.00 fforor fi rst 40 worwords,ds, additionaladditional wordswords .10 each.each. Includes main fl oor laundry Baked ham with apple pair as well as stainless ReRepeatpeat ads - Half Price. Saturday 2 - 3:00 p.m. sauce, rolls, potatoes, steel kitchen appliances. vegetables, salad, pickles, Classifi ed DisplaDisplayy - $9.00/col. inch each insertinsert.. Too many extras to list. dessert, tea and coff ee (Incl. logo, box & bolding, and centering)centering).. $338,000.00 8QLWV$YDLODEOH August 8th: Call or text 204 867-7405 or Roast pork loin with gravy, HappHappyy Snaps: ((Birthday,Birthday, Engagement,Engagement, Wedding,Wedding, Birth, & 204 867-7154 GraduationGraduation)-)- $16.00 for the fi rst 20 words and the picture. )RUGHWDLOVFDOO rolls, potatoes, vegetable, (18-2x) salad, pickles, dessert tea OObituaries:bituaries: $6.50 perper col.col. inch.inch. BRIDAL and coff ee Reach the entire province (50 weeklweeklyy newspapers) $189.0$189.000 3HWHU+DUULVRQ (12-tfn) WWestmanestman and Eastman: $119.00 SHOWER RI6XWWRQ+DUULVRQ5HDOW\ Communities in All AAdsds ppluslus 5% G.S.T. Come and Go bridal Bloom. Th e judges are com- shower in honour of Kristin DeadlinesDeadlines Taman, bride-elect of Ryan ing on August 14th to tour our town and surrounding ClassifiClassifi ed advertisements must be submitted no later Hyrsak, to be held on Satur- tthanhan noon TuesdaTuesdayy for insertion in the followingfollowing Friday’sFriday’s day, August 10th from 2:00 – area. Looking for volunteers ededition.ition. AALLLL CLASSIFIED ADVERTISEMENTS MUST BE 4:00 p.m. at the home of the to join us for Town Clean Up PREPAID BEFBEFOREORE ININSERTION.SERTION. groom’s parents, Delmar and COMING EVENTS on August 8th at 7:00 p.m. at Th e Minnedosa Tribune is not resresponsibleponsible for Karen Hrysak, 165 3rd St. S.E. Armitage Park. Bring your typograptypographicalhical errors pupublishedblished AFTER tthehe fi rst insertion, nor gloves! We supply garbage ddoesoes it assume responsiresponsibilitybility fforor errors pupublishedblished as a resuresultlt ooff You are invited to a brid- Have an upcoming event Elphinstone Lions Club, bags and water. an aadvertisementdvertisement placed,placed, changed,changed, or cancecancelled,lled, by tetelephone.lephone. al shower on Sunday, August you’d like to let everyone 8th annual yard sale. Saturday, To ensure yyourour aadvertisementdvertisement appearsappears correctlycorrectly pleaseplease susubmitbmit iitt 11, 2013 in honour of Ayn know about? Get the word August 17, 2013, 10:00 a.m. in pperson,erson, by ffax,ax, maimail,l, or emaiemail.l. Lewandoski, daughter of Len out there with a Coming – 2:00 p.m. at the lions park. RECYCLING and Pam, engaged to Tom Event listing in Th e Tribune. Bad weather in the hall. Tables FOR SALE WANTED Cameron, son of Stew and Ads starting at $9.00 plus tax. $10.00 each or 3 for $25.00. To Kathy (of Forrest, MB) at the (tfn) book a table phone 204-625- Sandy Lake Community Hall 2423. No outside food conces- Selling something? Let Looking for something? at 2:00 p.m. Everyone Wel- UCT Bingo at Ukrainian sions. Lunch Available. (21-2) our readers know! Place an Our readers may have it! Place come! (21-2) Hall, Tuesday nights. Doors • aluminum ad in Th e Tribune Classifi eds an ad in Th e Tribune Classi- open at 6:00 p.m. Early bird at Newdale Horticultural • brass starting at $9.00 plus tax. (tfn). fi eds starting at $9.00 plus tax. Join us for a bridal show- 7:00 p.m. followed by regular Society fl ower show. Wednes- • zinc CAMPER (tfn) er in honour of Kassandra games. License #3359 B1 and day, August 14th, 2013. Doors • steel Kurt, bride-to-be of Ryan • e-waste 3359 BO. (47-tfn) Open at 2:00 p.m. Roast Beef • lead FOR SALE GARAGE SALES Synchyshyn on Sunday Au- supper from 5:00 – 7:00 p.m. • catalytic converters gust 11th from 2 – 4 p.m. at Combined PAL/Hunter Adults $10.00 Children (6- • stainless steel 2005 Ameri-Camp Sum- 345 2nd St. S.E Minnedosa. Ed Course at Tanner’s Cross- 12yrs) $5.00 5 and under • batteries mit Ridge 30 foot long, bump- Garage sale fundraiser • copper Please accept this as your in- ing School, Minnedosa, Sat- FREE. Everyone Welcome! er hitch-Queen bed(separate for Robyn Dragan’s 11 month vitation. urday, August 24th, 2013, 9:00 (21-2x) www.urbanmine.ca room)- Quad bunks (separate mission trip. If you have any a.m. to 4:00 p.m. $50.00 for 204.774.0192 room)-Sleeps 8- Large Fridge- items to donate, please drop Hunter Ed, $60.00 for PAL, Bethel Lutheran Society 72 Rothwell Road expandable kitchen table- off at 215 2nd St. N.W. or call PAINTER Winnipeg, MB $100.00 for both. Call Mike Annual Meeting will be held Pull out sofa bed- Large awn- 204-867-0468 or 204-867- (1 block south of IKEA) Bonner 204-848-7582 for in- on Tuesday, August 20 at 7:30 ing-Sewer, water, propane 1978. Garage sale will take Qualifi ed Painter with formation. p.m. at the church. All inter- The trusted name in and cable hookups. Delivery place at the Minnedosa Cal- 25 years experience. All work ested parties are invited to at- metal recycling Available. $13,499 OBO 204- vary Church, 52 2nd Ave S.W. guaranteed. Call Blaine at tend. 573-1412 or 204-761-7803 on August 17th at 9:00 a.m. (x) 204-874-2399. (43-tfn) 16 Friday, August 2, 2013 The Minnedosa Tribune BIRTH HELP WANTED CARD OF THANKS IN MEMORIAM ANNOUNCEMENT We would like to thank In Loving Memory of everyone who brought Tom Podruski fl owers, food and came to visit Oct 31/1950-Aug 3/2010 us just to be there for us, in our time of sorrow. It was greatly If tears could build a stairway appreciated. May God Bless And memories were a lane you all. ~Elsie Drozda and We would walk *(1(5$/0$1$*(5±675$7+&/$,5&223 family (x) right up to heaven And bring you back again 7KH&RRSHUDWLYH5HWDLOLQJ6\VWHP &56 LVDXQLTXHPXOWLELOOLRQGROODURUJDQL]DWLRQEDVHGRQ WKHIXQGDPHQWDOSULQFLSOHVRIFRRSHUDWLRQ,WLVFRPSULVHGRIDQHWZRUNRIDSSUR[LPDWHO\ We would like to express No farewell words DXWRQRPRXVUHWDLOFRRSHUDWLYHVDFURVV:HVWHUQ&DQDGDDORQJZLWKWKHLUEUDQFKRSHUDWLRQVDQG )HGHUDWHG&RRSHUDWLYHV/LPLWHG )&/ )&/LVWKHZKROHVDOLQJPDQXIDFWXULQJDUPRIWKH&56 our heartfelt thanks to every- were spoken ZKLFKSURYLGHVWKHUHWDLOFRRSVZLWKDUDQJHRISURGXFWVDQGVHUYLFHV6WUDWKFODLU&RQVXPHUV&R one for all the lovely fl owers, No time to say goodbye LEBOUTILLIER RS/WGLQYLWHVDSSOLFDWLRQVIRUWKHSRVLWLRQRI*HQHUDO0DQDJHU Mark and Megan cards, food, visits and phone You were gone before 5HSRUWLQJWRDQHOHFWHG%RDUGRI'LUHFWRUVWKH*HQHUDO0DQDJHULVUHVSRQVLEOHIRUDOODVSHFWVRI calls at this diffi cult time in the we knew it LeBoutillier and big sister, WKH&RRS¶VRSHUDWLRQLQFOXGLQJPDUNHWLQJPHUFKDQGLVLQJILQDQFLDOPDQDJHPHQWKXPDQ UHVRXUFHVDQGPHPEHUDQGERDUGUHODWLRQV7KHRSHUDWLRQLQFOXGHV)RRG+RPH&HQWUH*HQHUDO loss of our mom. Th ank you for And only God knows why Brooke of Carberry MB 0HUFKDQGLVH /LTXRU/RWWHU\ $JUR3HWUROHXPDQG3XPSV are excited to announce your thoughtfulness and kind- Our hearts still ache 7KHVXFFHVVIXOFDQGLGDWHVKRXOGKDYHSULRUUHWDLOPDQDJHPHQWH[SHULHQFHZKLFKLQFOXGHV nessis greatly aappreciated in sadness the arrival of their newest RYHUVHHLQJDODUJHVWDIIFRPSOHPHQW7KHLQGLYLGXDOPXVWDOVRKDYHGHPRQVWUDWHGVWURQJ OHDGHUVKLSH[FHSWLRQDOFRPPXQLFDWLRQDQGLQWHUSHUVRQDOVNLOOVDQGVWURQJSODQQLQJDQG and will always be remem- And secret tears still fl ow family member on RUJDQL]DWLRQDOVNLOOV bered. God Bless all. ~Nick What it meant to lose you May 15, 2013, a boy, 6WUDWKFODLU&RQVXPHUV&RRSRIIHUVDFRPSHWLWLYHVDODU\DFRPSUHKHQVLYHEHQHILWVSDFNDJH Kale Steven. KRXVLQJDQGH[FHOOHQWRSSRUWXQLWLHVIRUDGYDQFHPHQW and Mabel Stebeleski (x) No one can ever know But now we know Proud grandparents are 7RDSSO\SOHDVHVHQGDFRYHUOHWWHUDQGUpVXPpWRWKHHPDLODGGUHVVEHORZRU Th ank you does not seem Murray & Gwen LeBoutillier you want us 6WUDWKFODLU&RQVXPHUV&RRSHUDWLYH/WG enough to say for the last fi ve of Minnedosa MB and %R[ To mourn for you no more 6WUDWKFODLU0E years of care given Don. To To remember all Ed & Cindy Cuthill 5-& Pete, Eric and Keith for the ex- of Moosomin. $WWQ'DUUHQ5R]GHED the happy times HPDLOGBUR]GHED#KRWPDLOFRP tra time you spent with him; to Proud great-grandparents Life still has much in store :HWKDQNDOODSSOLFDQWVIRUWKHLULQWHUHVWEXWRQO\WKRVHFDQGLGDWHVFRQVLGHUHGIRUDQLQWHUYLHZ his coff ee buds, sons-in-law, Since you’ll never be forgotten are Jim & Nellie LeBoutillier ZLOOEHFRQWDFWHG and grandkids who helped We pledge to you today and Doreen Lochhead of WK &ORVLQJ'DWHIRU$SSOLFDWLRQVLV0RQGD\$XJXVW him get from point A to B; to Minnedosa MB, A hallowed place Drs Roche and Khandelwal Shirley Cuthill, Ruth Gray within our hearts for all your care and pep talks; and Gil Gray of Moosomin. Is where you’ll always stay to all the doctors and staff at BGH and St. Boniface; to Barb, Love your Family: NOTICE Jason and the rest of the am- Ken & Edna, bulance staff of Minnedosa; to Scott, Kerri, Logan, 0,11('26$&20081,7< the special nurses, housekeep- Bailee & Jaxon Kingdon Electric is now ing, kitchen, lab, reception and Jodi, Mark, Dylan & Keira working exclusively on the home care staff at Minnedosa projects of one general con- &+,/'&$5(&223(5$7,9( Hospital; to Nathan and Rick at Neil Davies tractor and so will not be ac- the Minnedosa Funeral home, April 1, 1927 – July 31, 2007 cepting work from any other to all the honorary pall bearers, Husband, Father customers. I apologize for any Elgin Hall, Lois MacDonald, and Grandfather inconvenience, and would Shirley Martin and grandchil- like to thank past customers dren for making the funeral Th ough your smile for their support. (21-2x) service special; to my family is gone forever and special friends for all your And your hands Th ank you to Bob Grie- help; to Heather Brasseau and we cannot touch der for his SILVER SPONSOR 0LQQHGRVD&RPPXQLW\&KLOG&DUH staff for the lunch; to all the Still we have so DONATION and we apologize &RRSHUDWLYHLVORRNLQJIRUFUHDWLYHÀH[ people and family who sent many memories for the omission in the paper food, cards, fl owers, and do- Of the one that we last week. Your donation like LEOHDQGHQHUJHWLFFDVXDOVWDII7KLVSRVLWLRQ nations...Th ank you again. ~ loved so much all other donations received LVVXEMHFWWRD&ULPLQDO5HFRUG&KHFNDQG Brenda Taylor, Sherri, Sandy, Your memory is our keepsake, are very much appreciated. &KLOG$EXVH5HJLVWU\&KHFN6HQGUHVXPHV Cathy, Stacey and families. With which we’ll never part, Minnedosa Ag Society God has you in his keeping, WRRQHRIWKHDGGUHVVHVEHORZ Th e family of Teenie Pas- We have you in our hearts %R[ tershank would like to express DAYCARE 0LQQHGRVD0DQLWRED5-( our heart felt gratitude to the people who provided support In loving memory PLQQHGRVDFKLOGFDUH#ZFJZDYHFD Hilda, Doris, Edna and Little Sprouts Childcare at this diffi cult time. Your acts families Home is STAYING in Minne- of kindness through cards, dosa!!! I currently have one In- fl owers, phone calls, gifts of fant/Preschool spot and three food are greatly appreciated. SHINDALA School-Age spots available Special thanks to Fr. Emil Frank passed July 14, 1989 starting ASAP. I am a licensed McTavish’s Ice Cream Kardasinec for his beauti- Craig died June 27, 1980 ECE II, and provide tons of out- /(602))$7,1& Parlour at Clear Lake requires ful service, the pall bearers, cross bearers, Ernie Malchuk door play as well as develop- &ODVV'ULYHUZDQWHG+DXOLQJ full-time or part-time help. A day of remembrance and choir, alter server Peter mentally appropriate activities. For interview, phone 1-204- Sad to recall. I also provide two snacks and a *UDLQRIZRUNZLWKLQ 848-7366. (19-3x) Mikow. Also thanks to Robert Ewanyshyn for his violin solo Without farewell hot home cooked lunch daily. Th ey left us all. We go on fi eld trips within 0DQLWRED&RPSHWLWLYHZDJHV of amazing grace during the Your presence we miss walking distance of my house, interment. Th e church ladies )D[UHVXPHWR Your memory we treasure. and often spend all day explor- for preparing and serving the ing outside! I am open 7:30 RU3KRQH/HVDW delicious lunch. Th e people Loving yous always that took such good care of Forgetting you necer. a.m. - 5:00 p.m., Monday-Fri- day. Please call Karen at (204) Mom at the Sandy Lake Per- 867-3626 or email shaash79@ sonal Care Home. Special Forever remembered yahoo.ca, for more information HAVE A FASTER thank you to the palliative Mom and wife Irene, or to book a spot! ( 16-tfn) care ladies that stayed with Brian, Bruce and Jill, 7KH0RXQWDLQ*ULOO5HVWDXUDQW TURNOVER RATE! mom when we couldn’t be Brianna and Ryan DWWKH(ONKRUQ5HVRUWLV there, you were all awesome. Little Wonders Country Advertise your car in and Ryan and Ashley Daycare near Erickson has QRZKLULQJIRU Th anks to Rae’s Funeral Ser- and Jamie and various spots available for )$//:,17(5 the Tribune vice for their kind and caring great grandchildren August and September. I also 6(59,1*326,7,216 Classifi eds! professional services. Your Madison and Madyson have one full time infant/pre- 6WDII$FFRPPRGDWLRQV kindness will not be forgotten. DUHDYDLODEOH school spot available late Au- 867-3816 ~ Edward, Sylvia, Helen gust. If you would like more 3OHDVHVHQGUHVXPHWR and Ed, Mabel and Nick and 6WHSKDQLH3LFDUG adsales@ families. info please call Lynne at 204- VWHSKDQLH#HONKRUQUHVRUWPEFD 636-2931 (21-5) minnedosatribune.com The Minnedosa Tribune Friday, August 2, 2013 17 MCNA PROVINCE IN MEMORIAM OBITUARIES WIDE CLASSIFIEDS
DIANE SLATER PASTERSHANK Reconditioned, obsolete, and (nee McNabb) hard-to-fi nd batteries. SOLAR It is with great sadness that our panels, inverters, and acces- In Loving Memory of Diane Slater who was born on May 27th, family announce the passing of sories. Th e Battery Man Wpg. 1942 and passed away July 5th, 2013 at the age of 71. Teenie Pastershank on Tues- 1-877-775-8271 www.battery- Diane lost her courageous battle with cancer at Health Sci- day, July 9th, 2013 at the Sandy man.ca ence Centre Hospital with her daughters at her side. Lake Personal Care Home at Diane will be lovingly remembered by her daughters the age of 95. DISCONNECTED PHONE? Melody (Gord) Boszko, Shelli (Doug Carlyle) Falconer, Sherri Teenie was born in the Har- Phone Factory Home Phone (Rick) Desrosiers and her grandchildren: Leah, Lyndsay, Brett, rison area on January 26, 1915. Service. No One Refused! Free Ecko, Shawn and Nathan, Sister Sandi McNabb and niece She attended schooling at the Activation! Low Monthly Rate! Victoria and nephew William and extended family. Martin Dale School. Teenie Calling Features and Unlim- She was predeceased by her parents Donald and Olive married Frank Pastershank ited Long Distance Available. McNabb and also by her late husband Don Slater. in Olha, MB on June 14, 1932. Call Today! 1-877-336-2274. Diane’s greatest pleasure was her yearly travels to Mexico in Th ey farmed at Wisla , Manitoba www.phonefactory.ca. particular Boca Beach. So much so that it was one of her wishes until 1937, then moved to Elphinstone. Bertha “Bun” Rudy MANUFACTURED HOMES some of her ashes be spread with Don’s, overlooking the beach Frank and Teenie moved to Minnedosa in 1971 when they re- April 26, 1917 – at Boca, Mexico. tired from farming. August 3, 2012 HOMES, COTTAGES & More. Donations in memory of Diane may be made to Friends For Teenie was devoted to her husband, family, friends. She RTMI - Ready to Move in. Call In loving memory of our Furry Friends Animal Rescue, Suite 208-740 Rosser Ave. Bran- picked many pails of wild fruit for her family over the years. mother. 1-888-733-1411; rtmihomes. don, MB R7A 0K9 or Cancer Care Manitoba. Also was a very avid gardener and provided many jars of fruit, com. Red Tag Sale on now! vegetables and pickles. Th ank you mother for all ANNE WALL For many years she enjoyed playing Bingo and cards with MOBILE HOMES that you have done, family and friends. You took great care, of your Anne was born on February 10, Teenie was predeceased by her late husband Frank of New 2013 SRI mobile home daughters and son. 1928, daughter of Johan and 58 years, infant son Larry, her parents Joeseph and Mary models AVS-20631 and AV- You loved us all Helena Wiebe, on a farm near Kristalovich ands her nine siblings, three sister-in-laws and 667 are now onsite for view- from the very start, Horndean, Manitoba. three brother-in-laws. ing. Custom order your new With your warm, kind On July 20, 1952, she married Teenie is survived by her son, Edward (Sylvia) Pastershank, home now for fall delivery. and loving heart. the person she would continue Daughters, Helen (Ed) Antosen, Mabel (Nick) Stebeleski: Five Glendale Mobile Home Sales, Th ank you mother, to love for 61 years – Henry grandchildren, Nine great grandchildren and four great great Brandon 204-724-7907 for being strong, Wall. Th ey made their fi rst grandchildren. She is also survived by sisters, Lavinia, Regina, While trying to teach us home in Morden, Manitoba, Brothers, Nick, Joe and numerous nieces and nephews. SERVICES right from wrong. where they began raising their Th e funeral service was held Saturday, July 13, 2013 at the four children. Th e family moved Sandy Lake Holy Ghost Ukrainian Catholic Church with Fr. If anytime, we had Notre Dame Used Oil Prov- to Erickson, Manitoba in 1968 and Emil Kardasinec offi ciating. Interment followed at the Catholic ince Wide Collection, used a problem, began farming. Cememtery. If friends so desire, donations maybe made to the oil over 500 L, used oil fi l- You were there to help Anne enjoyed farming; she worked Sandy Lake Personal Care Home tub fund. ters, containers, antifreeze, us solve them. side by side with Henry and was attached to the land and the Rae’s Funeral Service of Shoal Lake was in care oof arrange- batteries. Ecocentres, Rms, You’d lift us up, when we animals. She and Henry enjoyed travelling to visit family and ments. Businesses, Farms. Phone were feeling blue, friends or just for the adventure. Vichnaya Pomyat! 1-204-248-2110, www.notre- Th ank you mother, for we Anne was a loving wife, mother, grandmother, great-grand- dameusedoil.com could always count on you. mother and friend. She was gentle, patient, kind, tender- You were such an hearted and forgiving. She was quick with a smile and had a MCNA PROVINCE WIDE CLASSIFIEDS STEEL BUILDINGS awesome mother, witty sense of humour. She loved life. Th e love you showed Anne passed away peacefully with her family at her side Tues- Suite including Pillow-Top STEEL BUILDING SIZZLING was like no other. day, July 23, 2013, at the age of eighty-fi ve. AUTOMTOIVE Bed set $900). 12 Drawer SUMMER SAVINGS EVENT! Th ank you mother for your She was predeceased by her sister Elizabeth and brothers Queen Storage Bed $495! 5 20X22 $4,188. 25X24 $4,598. dear sweet love, John and Jacob. She leaves to mourn her passing her husband Guaranteed approval drive piece 42” round drop leaf set 30X36 $6,876. 32X44 $8,700. Now you’ll watch over us from Henry; daughters Joan (Brock), Gladys (Dwight), Leona (Mur- away today! We lend money $459. SOLID RUSTIC OAK Ta- 40X52 $12,990 47X70 $17,100. heaven above. ray) and son Loren (Sandy); grandchildren Lauren, Lyndie, to everyone. Fast approvals, ble Set 60” to 96” (No Veneer) One end wall included. Pio- Kristin, Dana, Jacob, Colin and Erik; great-grandchildren Isaac, best interest rates. Over 500 6-high back padded chairs neer Steel 1-800-668-5422. Remembered with love, Levi, Grace, Gabriella, Ava, Aaron, Jeremiah, Brayden, Raina, vehicles sale priced for im- $2,295 ($4,200 value)! Leather www.pioneersteel.ca Keith, Myrna, Frank and Danika, Chrissy, and Giana; sisters Agatha and Helen (Peter); mediate delivery OAC. 1-877- 3-Piece Set! Sofa, Love Seat & Grace, Bobbie and Stewart, STEEL BUILDINGS/METAL brothers Neil (Kathy) and Abe (Lenore); sisters and brothers- 796-0514. www.yourapprove- Chair. Sacrifi ce $1,495, Store Joan and Cliff BUILDINGS 60% OFF! 20x28, in-law; and many nieces and nephews. donline.com. Value $3,100. (Can Separate) (x) 30x40, 40x62, 45x90, 50x120, Anne was loved. She will be missed by all who knew her. Call: 204-571-1971. Brandon. FARM MACHINERY 60x150, 80x100 sell for bal- “And you know the way to the place I am going.” Bun Rudy 2004 Mustang, Dark Red, ance owed! Call 1-800-457- Service was at Hilltop Baptist Church, in Erickson, Manitoba, RUBBER TRACKS mini ex- August 3, 2012 98,000 KMs, 3.8 litre, V6 Stan- 2206 www.crownsteelbuild- Sunday, July 28, 3:00 p.m. cavators, tracked loaders, Mother and Grandmother dard Trans, Saftied, Beauti- ings.ca Memorial donations may be made to the Mennonite Central dumpers, trenchers, horizon- ful Condition. $7,000 Firm. Committee or World Vision. tal drills. Let’s see what we In tears we saw you sinking Baldur, MB 204.535.2276 or Rae’s Funeral Service, Erickson, were in care of arrangements. can do! Trackmasters Canada BUILD UP We watched you fade away. 204.245.0165 No Trades. Our loving hearts were broken Ltd. 1-866-553-0090. Calgary YOUR When you fought Tribune Printing 403-771-6008. Vancouver Advertisements and state- so hard to stay. 604-218-2825. ments contained herein are CLIENTELE But when we saw you sleeping the sole responsibility of FINANCIAL SERVICES So peacefully and the persons or entities that free from pain. MoneyProvider.com. $500 post the advertisement, and We could not wish you back Loan and +. No Credit Re- the Manitoba Community To suff er that again fused. Fast, Easy, 100% Se- Newspaper Association and cure. 1-877-776-1660. membership do not make We love and miss you Mum any warranty as to the ac- Love Th e Family FOR RENT curacy, completeness, truth- (x) fulness or reliability of such Approximately 1300 sq. ft. re- advertisements. For greater tail space for rent in Crystal information on advertising City. Available immediately. conditions, please consult the Contact Jack Lewis 204-873- Association’ s Blanket Adver- Book We Do It All! 2441 or Bill McKitrick 204- tising Conditions on our web- Your Spot Social Tickets, Raffle Tickets, Business 873-2091. site at www.mcna.com. Cards, Receipt Books, Flyers, Posters, Advertise with the Colour Copying FOR SALE BATTERIES FOR EVERY- Today THING Automotive, farm, Minnedosa Tribune SAVE! NEW! WRAPPED! New construction, ATV, marine, 867-3816 Bed Line - Queen Pillow- cycle, golf carts, solar. Phones, 204-867-3816 Top Bed Set $395! (King set tools, radios, computers, etc. $595.00) (6-piece Bedroom 18 Friday, August 2, 2013 The Minnedosa Tribune PROPERTIES FOR SALE
³/LYLQJLQ\RXU &RPPXQLW\´ ACCOUNTING Rick Taylor 867-7551 AUTO CONSTRUCTION [email protected] ALLARD M & M PRAIRIE CONCRETE Minnedosa - 867-3853 YAKUBCHAK AUTO BODY Ready Mix Concrete All Auto Body Repairs Concrete forms, Rebar, Wire Mesh, WIRCH Weeping Tile, Concrete Sealer, Snap Ties CERTIFIED GENERAL Ph: 867-2083 All at Competitive ACCOUNTANTS 5 Main St. North prices VW6W1(0LQQHGRVD WK6W1( VW6W1: 7KLVVTIWEXQJDORZKRPHLV 8QLTXHEHGURRPEDWKIDPLO\KRPH George Allard, C.G.A.* ELOHYHOKRPHIHDWXUHVEHGURRPV Gateway Street BA SSW O O D ORFDWHGLQDJUHDWDUHDDQGIHDWXUHVD LQGHVLUDEOHODNHDUHD*UHDWSDWLRDQGGHFN IXOOEDWKV¿QLVKHGEDVHPHQWFHQWUDO BA SSW O O D IDPLO\URRPRIIWKHNLWFKHQODUJH ZLWKKRWWXERXWGRRU¿UHSODFHDQGEHDXWLIXO DLUDQGDLUH[FKDQJH+DUGZRRGWLOH Onanole, Mb EAVESTROUGH GLQLQJURRPDQGEDVHPHQWUHFURRP ¶[¶LQJURXQGSRRO9HU\ZHOOPDLQWDLQHG QHZFDUSHWQHZGRRUVDQGGHFNZLWK 848-7413 A U T O BO DY 0DLQÀRRUEDWKZLWKMHWWHGWXEDQG KRPHVLWVRQ¶ORWDQGIHDWXUHVVN\OLWPDLQ JODVVUDLOLQJ'RXEOHGHWDFKHGJDUDJH Howard Wirch, C.G.A* SLHFHEDVHPHQWEDWK)RUFHGDLUJDV EDWKZLWKSRXUHGPDUEOHVXUURXQGDQGVRDNHU ZLWKQHZVKLQJOHV IXUQDFHFHQWUDODLUDQGZDWHUVRIWHQHU WXE)LQLVKHGEDVHPHQWKDVDIDPLO\URRP 9-515 4th Ave A N D G LA SS 'RXEOHGHWDFKHGJDUDJH ODUJHEHGURRPSLHFHEDWKPHGLDURRP Shoal Lake, MB E-GLASS REPLACEMENT XWLOLW\VWRUDJHDQGIRRWFHLOLQJV 759-2680 & REPAIRS Dauphin Offi ce - 15 1st Ave S.W. Ɣ´$1'´FRQWLQXRXV Phone: 638-3005 WILD LIFE COLLISION EXPERTS SUH¿QLVKHGHDYHVWURXJK Fax: 638-5817 WEST ST., BASSWOOD *Denotes Professional Corporation ł6LGLQJł5RR¿QJ PHONE: 874-2270 ł6RI¿Wł)DVFLD ł&ORVHGFHOO 3RO\XUHWKDQH6SUD\IRDP ł%ORZLQ$WWLF :DOO 6WUDWKFODLU QG6W1: VW$YH1: )LEUH,QVXODWLRQ 6SDFLRXVEHGURRPKRPHRQODUJHORW 7KLVVTXDUHIRRWEHGURRP *UHDWVWDUWHUKRPHQHDUVFKRRO Ɣ)LUH5HWDUGHQW&RDWLQJ LQ6WUDWKFODLU/DUJHHQWUDQFHOHDGVWRWKH KRPHLVYHU\WLG\DQGZHOO 6KLQJOHVVLGLQJDQGDOOZLQGRZV Tax Service PDLQWDLQHG+RPHIHDWXUHVODUJH XSGDWHGVLQFH0DLQÀRRU & Accounting ● AC PFUHDO#OLYHFD VSUDZOLQJHDWLQNLWFKHQZLWKDQ EHGURRPVPDLQÀRRUXWLOLW\URRP EHGURRPDQGEHGURRPVXSSHUÀRRU DEXQGDQFHRIRDNFDELQHWV7KHGLQLQJ DQGFHQWUDODLUFRQGLWLRQLQJ1HZ /DUJHEULJKWNLWFKHQDQGODUJHOLYLQJ • Income Tax Filing URRPDQGVXQNHQOLYLQJURRPDUHYHU\ VKLQJOHVPRVWO\QHZHUZLQGRZV URRPZLWKKDUGZRRGÀRRU • Farm and Business QLFHZLWKORYHO\ZRRGZRUNDQG $SSOLDQFHVLQFOXGHG %LJIHQFHG\DUG • Accounting KDUGZRRGÀRRULQJ7KH¿QLVKHG • Payrolls EDVHPHQWKDVDVHFRQGNLWFKHQDQGFRXOG • Government form filing CONSTRUCTION ELECTRICAL VHUYHDVDPRWKHULQODZVXLWH7KLVKRPH LVLQH[FHOOHQWFRQGLWLRQDQGKDVEHHQ Phone 867-5550 QLFHO\XSGDWHGWKURXJKRXW Fax 867-5808 Clint Moffat 116 Main St. S. Minnedosa, MB R0J 1E0 & Sons Ltd. BURTON OFFICE Enterprises Ltd. 1(:/,67,1* 1(:/,67,1* 867-3356 Refridgeration Air Conditioning, WK$YH6: '0LQQHGRVD%HDFK • Sand & Gravel Products Heating & Electrical 9HU\VROLGVTIWEHGURRP 7KLVFR]\FRWWDJHDW0LQQHGRVD/DNHLV 70 Main St, S. /RW0LQQHGRVD%HDFK EXQJDORZZLWKDIHQFHG\DUGDQG DUHDOFKDUPHU.LWFKHQVXQNHQOLYLQJ • Excavating 30 Years &RWWDJHDW0LQQHGRVD/DNHZLWKQLFH WRZQYLHZ8SGDWHGZLQGRZVVLGLQJ URRPEHGURRPVDQGDSLHFH Minnedosa, MB. • Water & Sewer YLHZV7KLVEHGURRPSLHFHEDWK LQVXODWLRQQHZVKLQJOHVIHQFHDQGQHZ EDWKURRPDOODGGWRWKHOLYHDELOLW\ Experience!! FRPHVIXOO\IXUQLVKHGDWDQDIIRUGDEOH ODPLQDWHÀRRULQJ/RFDWHGRQDTXLHW 7KHGHFNRYHUORRNVDVPDOO\DUGZLWK Installations SULFH6FUHHQHGGHFNRYHUORRNVWKH VWUHHWFORVHWRVFKRRODQGGRZQWRZQ D¿UHSLW6XPPHUVDWWKHODNHFDQEH Personal Tax Returns • Site Preparation YDOOH\DQGODNH&RWWDJHLVZLQWHUL]HG DIIRUGDEOH Bus : 867-3950 DQGKDV$&DQGFDEOH79 Farm Returns • Landscaping Fa x: 867-2340 Business Returns • Snow Removal PRAIRIE MOUNTAIN Ph: 204-867-4657 Cash Back Gwen Usick Fax: 204-867-2150 Independently Owned [email protected] and Operated Broker/Realtor Phone: 867-5124 Parish Backhoe Services FINANCE ●Septic Systems ●Weeping tiles Catharine M Gijsbers. ●Water Sysyems ●Basements Minnedosa Certified General Accountant. All types of excavation Credit Professional Corporation - 213 2ND Street NE ● ● Box 385, Minnedosa MB R0J 1E0 Certifi ed in waste UnionMCU x Personal & Corporate Income Tax water management MCUMain line x Accounting and payroll services 867-6350 0LQQHGRVD 0LQQHGRVD 50RI2GDQDK 0LQQHGRVD 6WXQQLQJULYHUIURQW%GP 4XDOLW\%GP%XQJDORZ VTIWKRPHZLWKPXQLFLSDO 8SGDWHG%GP%DWK x AgExpert Analyst Certified Advisor Call: Ian Joanne Clarke %DWKKRPHGHVLJQHGIRU ZLWKDWWDFKHG26VLQJOHFDU ZDWHUEGPEDWKWULSOH VWRUH\FKDUDFWHUKRPH x V.I.P. Installer – Group trainer 867-6364 ZKHHOFKDLUDFFHVV&HQWUDODLU JDUDJH*'2RQDGHHSORW FDUJDUDJH QHZHUZLQGRZV )HDWXUHVVWDLUFDVHVWRPDLQ 874-2134 or 867-0383 JDV¿UHSODFHMHWWHGWXE FORVHWRGRZQWRZQ0DLQEDWK 7KHUHDUHIHQFHGSDVWXUHV VOHHSLQJDUHD QGWRPDLGV Tel: 867-3884 Cell: 867-0190 Susan Glasgow KDUGZRRGÀRRUVJDUDJH ODXQGU\+(JDVIXUQDFH ¶[¶VKHGEDUQVKD\ODQG TXDUWHUV9HUDQGDKV Email: [email protected] FDUSRUWIHQFHG\DUG¶[¶ FHQWUDODLUSDWLRYHJHWDEOH JURRPHGZDONLQJSDWK PXGURRPFHQWUDODLU 867-6353 GHFNPXFKPRUH JDUGHQ$UHDOJHP YHJHWDEOH IUXLWJDUGHQVDOO ¿UHSODFHGHFN PRUH Alayna McTavish 0/6 0/6 ORFDWHGRQDFUHV 0/6 0/6 867-6354 Debbie Strelczik Take a tour on realtor.ca or our website 867-6359 www.remax-prairie mountain-npwa.mb.com Book Lori McNabb 867-6360 www.suttonharrison.com This • Specializing in water & sewer installation & repair Harvey Wedgewood Louise McInnes • All types of excavation 867-6363 Spot • Basements, Demolition • Snow removal Carol Dalrymple 204-867-4346 • Gravel, Topsoil 867-6367 for • Sales of septic tanks Carol Taylor Tony 867-7582 867-6368 only Kirk 867-0180 Kim Robinson 867-6352 $13.74 Jeff Dusessoy 35,&(5('8&(' 867-6369 BIRCH Sylvia Firby '0LQQHGRVD WK$YH6: 0DLQ6WUHHW1 UG$YH6: 50RI0LQWR 6KDG\/DQH per CONSTRUCTION LTD. %HDFK5RDG VTIW VTIW VTIW )DEXORXVEHGURRP 2WWHU/DNH 867-6361 3ULYDWHEHGURRP EHGURRPRQD EHGURRPRQD EHGURRPRQD FKDUDFWHUKRPHRQ VTIWQHZO\ DFUHVZLWK Candice Brown FDELQ/RWVRI [IHQFHG QLFHO\KHGJHG ORYHO\WUHHGIHQFHG FUHHNDQG EXLOWFDELQRQD week! GENERAL XSJUDGHV FRUQHUORW FRUQHUORW FRUQHUORW LQJURXQGSRRO [ 867-6362 3DQRUDPLFYLHZ 6SDFLRXVIDPLO\ /RWVRIXSJUDGHV *UHDWORFDWLRQ WUHHGORW2ZQ CONTRACTORS KRPH 0/6 \RXURZQSODFHDW Brad Ross 0/6 0/6 0/6 3OHDVHVHH0/6IRU WKHODNH Commercial 867-6366 0/6 GLUHFWLRQVRUFDOORU WH[W 0/6 Residential Fax Working in your community to meet all 867-0400 867-6391 your real estate needs -- 0r 867-7506 “Your Home is Where My Heart Is” The Minnedosa Tribune Friday, August 2, 2013 19
GRAIN REAL ESTATE SELF-HELP SERVICES HAULING LEGAL PLUMBING Alexander CALL ME... FOR ALL YOUR T A C WAHOSKI REAL ESTATE NEEDS Drug Problem? Brian Horner Jackson Narcotics Ventures Inc. Grain & Fertilizer Law Office MECHANICAL LTD. PLUMBING Anonymous can help Waste Hauling Management & B-116 Main St S HEATING Meetings every Minnedosa, MB Tuesday & Contracting 867-3981 GAS FITTING (204)476-0002 http://www.ajaxlaw.ca AIR CONDITIONING Saturday at 7 p.m. Garbage Removal PETER HARRISON at Calvary Temple, Bin Rentals Construction Demolition 204-867-3121 Phone/Text 867-5444 221 Hamilton Street, 204-867-7182 SIMS & COMPANY or Renovating Law Office Neepawa, MB Household clean up 204-476-5185 www.suttonharrison.com Estate clean ups Norman H. Sims, Q.C. 76 Main Street South GORD KELLY RESTAURANT Ford Farms MINNEDOSA t867-2717 Plumbing & Heating SEPTIC Essential Choice Custom Grain Hauling Gas Fitting Body Balance Call Mark at Burgess Law ph: 867-2084 Registered Massage Therapy cell: 867-0346 Lakeside 204-867-0120 Office Dari Isle Reiki Master/Teacher Septic Service Indian Head Massage 51 Main Street S 204-867-3601 Potable water Pranic Healing & BodyTalk Book Minnedosa Call for pick-up delivery. 867-2935 or dine in. Book your portable 204-867-3983 toilets. This [email protected] 694 - 3 St. NE Minnedosa ! Homemade Small tool rentals. Spot Burgers! Bryon Gaiser for MLA Soft Ice Cream! 867-2416 LLEEOONNAA’’SS Cell: 867-7558 only STUDIO OF IMAGE LEANNE ROWAT, M.L.A. Family Hair Care Riding Mountain Constituency Book SALES $13.74 Waxing Pedicures Minnedosa This Darwin RANKIESRAINKE'S Manicures LCN Nails per 114 Main St. S. Sewage Service Pedique Tanning Office Hours Matthews’ Pedique Tanning Spot TV AND APPLIANCE Mon. - Fri. JIM BEAUMONT Massage week! 9:00 - 5:00 SALES AND SERVICE for Your Shaw Direct, 476-2483 Constituency 867-2287 LG, Samsung, Bell Owner/Operator 67 Main St. Ph: (204) 867-2297 Danby Dealer 67 Main St. HANDYMAN Fax: (204) 867-3641 only Cell: 476-6591 Winnipeg Computer Sales and Service Systems, Monitors & Dennis: 476-2766 Ph: (204) 945-0258 $13.74 Accessories JOHNSTON Fax: (204) 945-5921 Minnedosa, MB YARD CARE SERVICES per Phone 867-3164 23 Hour Service 204-868-0382 Book E-mail: [email protected] • Lawn Mowing & Trimming CREIGHTON’S week! • Yard Clean Up ●Handyman Service This SERVICES • Aerating & Power Raking ●Interior/Exterior SELF-HELP • Garden Tilling Renovations Spot PRINTING • Eavestrough Cleaning ●Cabinets, Countertops for Fences, Decks & More • Hedge Trimming ●All Flooring Mood • Small Branch Trimming ●Drywall and Taping ►Custom Bobcat Work only Disorders ► Snow Clearing • Window Washing ●Ceramic Tile Association • Other Odd Jobs ●Decks, Fences, Garages $11.07 Pierre Sr. 204-868-0266 More than just a of Manitoba Cory Johnston ▪ Minnedosa and More! per Newspaper! FULLY INSURED We offer a full line of Support Group (204) 476-4705 week! Custom Printing. www.johnstonyardcare.com Posters, Brochures, Invoices, Meetings held at St. Alphonsus Envelopes, Business Cards, Minnedosa Hospital Boardroom Book this spot Letterhead, Tickets, Invitations Catholic Church and MORE! We also provide every 2nd Tuesday of the month 142 4th St, NW. PAINTING Colour Photocopying, Photo TRADING $5.52/week Reproductions and Faxing. at 6:30 p.m. For more info call: Minnedosa, MBMB 867-3831867-3831 Visit us at: Lora Hay 826-2773 Mass Sunday 9:00 a.m. Call 204-867 3816 14 3rd Avenue S.W. #6350/1"*/5*/( Minnedosa, MB Connie Finlay 867-2556 Monday - Friday 9 a.m. to 12 noon & FRONTIER .YRNA$HARLES 1 p.m. to 4 p.m. Phone 867-3816 ALCOHOLICS TRADING STORE INSURANCE )OME ANONYMOUS $ELL If you like to drink and can That's your business 867-5551 If you want to stop and can't MINNEDOSA Need it Painted? People Helping People Gently Used Furniture Call T.H.E.M.! Book this spot That's our business. INSURANCE SERVICES Written Quotes • Insured - Committed to Caring - Clothing & Misc. Items Premium Finishes Book you winter jobs NOW! $5.52/week P.O. Box 36 Donations Drivers Licenses, Autopac Working Area: Phone (204) 857-6100 General Insurance From Brandon to Clear Lake or 867-3966 Estate Sales Bruce McNabb & Dave McDonald Cell 204-868-8088 Email: [email protected] Call 204-867 3816 Alanon - 867-3308 Fax (204) 857-8389 Residential, Farm, Commercial • Interior/Exterior [email protected] Pick-up & Deliveries 867-3946 Power Washing & Spray Painting Available • References Available Alateen - 867-5121 867-3401 Minnedosa www.centralplainscancercare.com Mtg. Times: 8:00 pm Tuesdays 20 Friday, August 2, 2013 Th e Minnedosa Tribune
/%7 Minnedosa Credit Union Community Owned, Community Minded Main Line 204-867-6350 Candice Brown - Consumer Loans 204-867-6362 Brad Ross - General Manager 204-867-6366 Alayna McTavish - Loans Clerk 204-867-6354 Carol Taylor - Member Service Manager 204-867-6368 Kim Robinson - Loans Clerk 204-867-6352 Harvey Wedgewood - Loans Manager 204-867-6363 Carole Dalrymple - Member Service 204-867-6367 Susan Glasgow - Finance Manager 204-867-6353 Joanne Clarke - Clearing/Accounting Clerk 204-867-6364 Lori McNabb - Agricultural Loans 204-867-6360 Jeff Dusessoy - Wealth Management 204-867-6369 Debbie Strelczik - Consumer Loans 204-867-6359 Fax 204-867-6391 Sylvia Firby - Consumer Loans 204-867-6361 Email info @minnedosacu.mb.ca Hours of Business Monday to Friday - 9:30 a.m. to 5:00 p.m. Saturday - 9:30 a.m. to 1:00 p.m. (We offer 41 hours of business to our members each week. How much time does your F.I. offer you?)
'(326,7*8$5$17(( 678'(170$67(5&$5' :KHQVHWWLQJXSDSSRLQWPHQWVRUDSSO\LQJIRU 7KH&UHGLW8QLRQ QHZVHUYLFHVDWWKH0LQQHGRVD&UHGLW8QLRQ :+(1<286$9($7$0$1,72%$ 6WXGHQW0DVWHUFDUGLVDJUHDWZD\WR DOZD\VEHSUHSDUHGWRVKRZSLHFHVRI,'RQH &5(',781,21<285'(326,76$5( VWDUWEXLOGLQJDFUHGLWUDWLQJZKLOHJRLQJ EHLQJSKRWR *8$5$17((':,7+287/,0,7%<7+( WRVFKRRO '(326,7*8$5$17((&25325$7,212) 0$1,72%$6,1&(:+(10$1, 6RPHRIWKHIHDWXUHVLQFOXGH 72%$·6),567&5(',781,2123(1('12 QRDQQXDOIHH 3(5621+$6(9(5/267$1<'(326,725 SXUFKDVHSURWHFWLRQ $1<,17(5(67($51('$77+( H[WHQGHGZDUUDQW\ &2175$&7('253267('5$7( 217+('(326,7 )RUPRUHLQIRUPDWLRQDQGWRJHWDQ DSSOLFDWLRQVWRSLQDWWKH &RQJUDWXODWLRQVWR:KLWQH\*ODVJRZIRU 0LQQHGRVD&UHGLW8QLRQ SURGXFLQJWKHQHZORJRIRUWKH 0XVWEH\HDUVRIDJHDQGHQUROOHGLQSRVW 0&8&RPSOH[&KHFNRXWWKHQHZORJRVLJQDW VHFRQGDU\VFKRRO WKHVLWHRIWKHIXWXUH&RPSOH[ 0,11('26$&5(',781,21 0\QDPHLV5KRQGD&XUOHDQG,KDYHEHHQDW &21*5$78/$7,21672285:,11(562) 678'(17/2$16 WKH&UHGLW8QLRQIRU\HDUV0\KXVEDQG 7+(52&.,17+(),(/'6&217(67 %UXFHDQG,KDYHFKLOGUHQ²7\OHUDQG 0LQQHGRVD&UHGLW8QLRQRIIHUVVWXGHQWORDQV 5HEHFFD,DPFXUUHQWO\D0HPEHU6HUYLFH VW&KDG0F9H\ RISHU\HDU RUSHUIDPLO\ WRD 5HSUHVHQWDWLYHEXWRYHUWKH\HDUVKDYHEHHQ QG6WHYHQ56PLWK PD[LPXPRI RUSHUIDPLO\ 5HFHSWLRQLVW/RDQV2IILFHUDQG/RDQV&OHUN UG0DUJDUHW5DSOH\ 7KHLQWHUHVWUDWHFKDUJHGLV3ULPH1R SULQFLSDOSD\PHQWVDUHPDGHZKLOHWKHVWXGHQW :$7&+)257+(',1*)5((52$'&5(: /RRNLQJIRUVRPHWKLQJWRGR$XJXVW/RQJ LVDWWHQGLQJVFKRROEXWWKHLQWHUHVWPXVWEH :HHNHQG"&KHFNRXWWKH0LQQHGRVD5RGHRRU SDLGXSWRGDWHDQQXDOO\$OOWKDWLVUHTXLUHG -XO\WKWKHGLQJIUHHPDUNHWLQJFDPSDLJQZLOO 5RFNLQ·WKH)LHOGV LVFRQILUPDWLRQRIHQUROOPHQWDQGDSDUHQW·V VWDUWLWVVXPPHUWRXUDFURVV&DQDGD²WUDYHOOLQJ 6RPHWKLQJIRUHYHU\RQH JXDUDQWHH IURP9LFWRULD%&WR$QWLJRQLVK1RYD6FRWLD ,QWKHFRXUVHRIGD\VWKLVYDQFRPSOHWH 678'(17&$0386$&&2817 :LWKWKHKLJKFRVWVRIHGXFDWLRQZHFDQKHOS ZLWKWRRQLHZKHHOULPVDQGHTXLSSHGZLWKD &RQJUDWXODWLRQV*UDGXDWHV WDNHWKHSUHVVXUHRIIWKHVWXGHQWDQGSDUHQWVE\ IXQFWLRQLQJ$70ZLOOYLVLWRYHUFLWLHVDQG :LOO\RXEHJRLQJWRSRVWVHFRQGDU\VFKRROWKLV VHWWLQJXSD0LQQHGRVD&UHGLW8QLRQ WRZQVDQGYLVLWRYHUSDUWLFLSDWLQJFUHGLW IDOO":DQWWRVDYHPRQH\LQVHUYLFHFKDUJHV" VWXGHQWORDQIRU\RX&RPHVHHRXUORDQV XQLRQVDORQJWKHZD\7KHFRPHGLFFUHZZLOO 7KH&$0386FKHTXLQJDFFRXQWDWWKH VWDIIIRUGHWDLOV KHOSHGXFDWHSHRSOHDERXWFUHGLWXQLRQVDQG 0LQQHGRVD&UHGLW8QLRQLVWKH UDLVHDZDUHQHVVDERXWWKHQDWLRQDOQHWZRUNRI DFFRXQWIRU\RX 7KH5HDO0DQLWRED3KRWR&RQWHVW VXUFKDUJHIUHHFUHGLWXQLRQ$70·VIURPVHDWR $UH\RXD6KXWWHUEXJDQGORYHWRWDNH VHD0D\EHZHZLOOVHHLWLQRXUFRPPXQLW\ 6RPHRIWKHEHQHILWVLQFOXGH SKRWRV"(QWHU\RXUVSHFLDOSKRWRDQGLWFRXOG IUHH$70DQG'LUHFW3D\PHQWXVDJH DSSHDULQWKH0DQLWRED&UHGLW8QLRQ )ULGD\-XO\WKWKH&UHGLW8QLRQKHOGWKHLU IUHHSHUVRQDOL]HGFKHTXHV &DOHQGDU&KHFNRXWWKHFRQWHVWGHWDLOVRQWKH QGPRQWKO\KRWGRJVDOHGXULQJWKHVXPPHU XQOLPLWHGWUDQVDFWLRQV ZHEVLWHZZZFUHGLWXQLRQPEFDDQGHPDLO\RXU UDLVLQJWREHGRQDWHGWRKHOSUHEXLOG SKRWRVWRFXLQIR#FXFPRUJ'HDGOLQHLV WKHRXWGRRUVNDWLQJULQNDW7DQQHU·V&URVVLQJ &RPHLQDQGVHHRQHRIRXU0HPEHU 1RYHPEHU 6FKRRO 6HUYLFH5HSUHVHQWDWLYHVIRUPRUH LQIRUPDWLRQ 0LQQHGRVD&UHGLW8QLRQ/LPLWHGZLOOEHFORVHG 6DWXUGD\$XJXVWUGDQG 0RQGD\$XJXVWWKVRRXUVWDIIPD\ HQMR\WKHORQJZHHNHQG
),)7,(6,1285$70
'XULQJ5RFNLQ·WKH)LHOGVRI0LQQHGRVD $XJXVW ZHZLOOEHSXWWLQJ ELOOVLQRXU$70(YHU\ZLWKGUDZDOKDVDQ RSSRUWXQLW\WRUHFHLYHDELOO&RPH DQGWU\WRPDNHRQXV