ELECTRICALS & FOOD PREP MACHINES
CHAPTER www.siahuat.com 04 .
04-001-00025(XX) 22.5 x 20.3 x 45cm 0.9ℓ 2hp 230V / 50Hz / 750-850W 04-001-00011 20.3 x 22.9 x 44cm 1.4ℓ 2 Speed 2hp 230V / 50Hz / 750-850W 04-001-00005 23 x 28 x 54cm 2ℓ 45000rpm 3.5hp 230V / 50Hz / 1500W Enclosure for Xtreme Series Blender: Electronic Blender w/ Timer & Sound Enclosure MX1500XTXSEE Electronic Blender w/ Timer Heavy Duty Bar Blender Drink Machine Advance Heavy Duty Bar Blender Drink Machine Heavy Duty Bar Blender 2 Speed Drink Machine Heavy Duty Bar Blender 2 Replacement Container Jug: 04-001-00002(XX) PC Jar w/ Blending Assy w/o Lid for MX1100/ PC Jar w/ Blending MX1500: 04-001-00007 Sound 04-001-00008(XX) Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. VITAMIX VITAMIX is programmed to mix the and GoTM Blending Station Touch The Vitamix heavy duty smoothie most popular drinks consistently every time. Even fruit, and mixtures, containing high percentages of ice and frozen and creamy notoriously hard-to-mix ice cream drinks turn out smooth chamber. Comes with one touch operation and sound reduction VITAMIX VITAMIX Drink Machine gives you extra the Vita-Mix The exceptional power of coffee drinks, cocktails, fruit extra smooth, frozen (not iced) creamy, shakes, ice cream specialty drinks and more. smoothies, frappes, granitas, cubed ice in three seconds. Crush almost two litres of ACCESSORIES • ACCESSORIES • • WARING WARING 4 Re-programmable, 2 step program Replaceable blending assembly. settings. LCD display screen for variable speed control.
04-001-00001 20.3 x 22.9 x 51cm 3hp Speed 37000rpm 2ℓ Variable 230V / 50Hz / 1200-1400W 04-001-00013(XX) 45.7 x 21.6 x 27.2cm 1.4ℓ 37000rpm 230V / 50Hz / 1300W 04-001-00010 20 x 24.7 x 44cm 1.4ℓ 230V / 50Hz / 1000W
Brushless Blender 62 Heavy Duty Food Blender Vita Prep 3 Vita Heavy Duty Food Blender Heavy Duty Blender Blending Station Advance Heavy Duty Blender Blending Station Replacement Container Jug: 04-001-00002(XX) Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Elec. Spec. Product Code Dimension Capacity ACCESSORIES • steel container with 2 handles and rubberized stainless steel lid. New steel container with 2 handles jar pad for easy cleaning. dishwasher-safe one-piece VITAMIX VITAMIX versatility with 3 speeds and pulse. Stainless Mechanical controls add a noise reducing cover for an improved customer experience. VITAMIX VITAMIX Advance has been engineered for perfection including The Blending Station for space saving. Touchscreen panel with 5 programmable functions. R&D panel with 5 programmable functions. Touchscreen for space saving. feature available using a software and a usb port for flashdrive. Brushless motor (permanent magnet rotor) which gives it a long lifespan, an excellent Pulse function. BPA-free jar. energy efficiency and a low noise level. 2500/15000rpm. SANTOS SANTOS Fits everywhere. Can be used in its standard version or in-counter version
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 164 blending assembly. timer. Comeswithsoundenclosureforminimalnoise.Replaceable Off, High,Low, StopandPulsecontrols. 30secondselectroniccountdown and more.EasytocleanelectronicmembranekeypadwithsimpleOn/ Great forsmoothies,bardrinks,soups,salsas,sauces,desserts,dressings WARING controls from1,500to20,000RPMandamaxpulseof30,000RPM. assembly formaximumpowerandefficiency. Revitupwithvariablespeed This heavy-duty, 3.5HP blenderteamsupwith The Raptor®bladeandjar Plug MX1200XTXEE WARING drinks perday. switch controlsfeatureHIGH,LOW, OFFandPULSE.Blendupto75 blade assemblyformaximumpowerandefficiency. Clearlymarkedpaddle This heavy-duty, powerful3.5HP blenderteamsupwith The Raptor®jar/ MX1000XTXEE WARING Elec. Spec. Capacity Dimension Type Product Code Add. Info Elec. Spec. Capacity Dimension Product Code Add. Info Elec. Spec. Capacity Dimension Product Code Electronic Blenderw/Timer &SoundEnclosureMX1100XTXSEE Commercial BlenderwithBPA-Free StackableContainer, UK Commercial BlenderwithBPA-Free Container, UKPlug
230V /50Hz1500W 1.4ℓ 23 x2854cm With Enclosure 04-001-00003 Paddle switchcontrols/copolyestercontainer 230V /50Hz1500W6.25Amps 2ℓ Variable Speed3.5hp 20 x21.545cm 04-001-00072 Paddle switchcontrols/copolyestercontainer 230V /50Hz1500W6.25Amps 2ℓ 3.5hp 23 x2247cm 04-001-00070 Without Enclosure 04-001-00004
clean upeasy. A removable,rubberizedjarpaddampenssoundandmakeswipe-down 2-speed, powerful1HP motorfeatureseasy-to-usetoggleswitchcontrols. your barisbusiest.Makethree16oz.margaritasin12secondsorless!Its The Waring BB300KBladeSeries1HP Blenderhasyoucoveredwhen WARING carrying andpouring,lidclampsforsecurity. 1-gallon stainlesssteelcontainermeansbusinesswithtwohandlesfor powerful 3.75HP motor andelectronickeypadcontrols. The durable, Chop, mixandshredlargeloadsthatneedlongblendingtimeswitha CB15K WARING and a30-secondelectroniccountdowntimer. electronic-membrane keypadwithHIGH,LOW, OFFandPULSEfunctions assembly formaximumpowerandefficiency. Featuresaneasy-to-clean, This heavy-duty, 3.5HP blenderteamsupwith The Raptor®jarandblade Plug MX1100XTXEE WARING Elec. Spec. Capacity Dimension Type Product Code Add. Info Elec. Spec. Capacity Dimension Product Code Add. Info Elec. Spec. Capacity Dimension Product Code Bar BlenderBB300K/BB300SK Commercial Blenderwith2HandlesStainlessSteelContainer Commercial ElectronicBlenderwithBPA-Free Container, UK
230V /50Hz 1.4ℓ 39 x2626cm Container Copolyester BB300K 04-001-00065 stainless steelcontainer Electronic keypadcontrols/2handles 230V /50Hz1800W 4ℓ 3.75hp16800-21500rpm 25 x66cm 04-002-00082 Membrane keyboard/copolyestercontainer 240V /60Hz1500W 2ℓ 3.5hp 23 x2247cm 04-001-00071
Container Stainless Steel BB300SK 04-001-00068
165 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-001-00059 50-80rpm 220-240V / 50Hz 04-001-00036 50.5 x 23.5 x 42cm 6.5ℓ 230V / 50Hz 04-001-00009 18 x 24.5 x 40cm 2ℓ 22000rpm 230V / 50Hz / 1500W Bar Blender with PC Container Automatic Centrifugal Juice Extractor J80 Ultra Cold Press Juicer Product Code Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. SANTOS SANTOS fruits, veggies, leafy New way of juicing, pressing very slowly all kind of and minerals.. greens, and preserving the vitamins, nutrients, enzymes, throughput of fruit and vegetables with a diameter of up to 79mm. ROBOT COUPE Pulp ejection juicer designed for making freshly-squeezed juice and vegetable juices. Patented automatic feed system for continuous MIKA ECONOMY ECONOMY MIKA Thermal protector & design to protect motor - Double safety protection Non-slip rubber feet. overload protector. .
.
04-001-00028 18.6 x 18.2 x 53cm Cup 0.56ℓ 230V / 50Hz / 120W 04-001-00027 18 x 28 x 50cm 1hp 16000-25000rpm 3 speed 230V / 50Hz 04-001-00030 59.6 x 23.5 x 53.8cm 7.2ℓ 230V / 50Hz Automatic Centrifugal Juice Extractor J100 Ultra
Electric Drink Mixer 54BK Heavy Duty Single Spindle Drink Mixer WDM120E Heavy Duty Single Spindle Capacity Elec. Spec. Product Code Dimension Elec. Spec. Product Code Dimension Capacity Product Code Dimension Capacity Elec. Spec. one malt cup. SANTOS SANTOS motor activation via Heavy duty variable speed drink mixer with automatic one solid agitator and bowl detection. Comes with one butterfly agitator, WARING WARING Includes 1 malt cup, butterfly efficiency. Single spindle for increased ice cream. and propeller agitator for hard agitator, Has a powerful, resilient commercial grade motor which operates at a speed of 3,000 rpm, this means that the juice oxidizes less quickly Producing a particularly smooth juice which is bursting with flavour ROBOT COUPE
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 166 feeding chute(79,5mmdiameter):noneedtocutfruitsandvegetables. (0.5 mm/0.02'').Fullstainlesssteelfood-zone(noaluminum).Wide Perfect filtrationforahighqualityjuice:largebasketwithveryfinesieve The Miracleeditionoffersahighefficiencyandisadaptedtointensiveuse. SANTOS with automaticpulpejection.Stainlesssteelbowlandbase. Extra-wide feedingchuteforeaseofuse.Very quiet andpowerfulmotor SANTOS construction. squeezer forallcitrusfruits. Aluminium castingandstainlesssteel Polycarbonate bowlwithwaterproofmotorblock.Comesuniversal SANTOS Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Type Product Code Elec. Spec. Capacity Dimension Type Product Code Centrifugal JuiceExtractorEzy-CleanSystemII68 Centrifugal JuiceExtractor50 Lever Automatic CitrusJuicer
220-240V /50-60Hz 140L/h 48 x3258cm 04-001-00031 220-240V /50Hz800W 100ℓ/H 47 x2645cm/Jug(H):20cm Standard Base 04-001-00032 230V /50Hz230W 30ℓ/H 1450rpm 30 x2038cm/Jug(H):13.5cm Grey Base 04-001-00038 Chrome Base 04-001-00033 Chrome Top /Base 04-001-00039
motor withautomaticpulpejection.Stainlesssteelbowlandbase. Produces morethanonelitreofjuiceperminute.Very quietandpowerful SANTOS Polycarbonate bowlwithchromebaseandwaterproofmotorblock. Comes with2extractingconesforlemons/orangesandgrapefruits. SANTOS Comes withuniversalsqueezerforallcitrusfruits. SANTOS Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Juice ExtractorHighOutputCentrifugal28 Citrus Juicerw/ChromeBase38C Mefra CitrusJuicerwithChromeBase71C 230V /50Hz1300W 100ℓ/H Container:7.5ℓ3000/6000rpm 33 x46.551cm/Jug(H):22.2cm 04-001-00034 240V /50Hz130W 30 x2035cm 04-001-00035 230V /50Hz40W 15ℓ/H 17 x23.631cm/Jug(H):13.5cm 04-001-00037
167 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-002-00079 Stainless Steel Container 16 x 16 x 38cm 1ℓ 0.5hp 18000-20000rpm 230V / 50Hz / 330W 04-002-00081 Stainless Steel Container 16 x 16 x 38cm 1ℓ 0.5hp 18000-20000rpm 230V / 50Hz / 330W
04-002-00079 04-002-00081
04-002-00078 Glass Container 16 x 16 x 38cm 1.2ℓ 0.5hp 18000-20000rpm 230V / 50Hz / 330W 04-001-00045 5 x 3.5cm 26 x 47 x 45cm / Chute Size: 230V / 50Hz / 600W 04-002-00080 Glass Container 16 x 16 x 38cm 1.2ℓ 0.5hp 18000-20000rpm 230V / 50Hz / 330W 04-002-00078 04-002-00080
Kitchen Blender 800G/800S Kitchen Blender 8011G/8011S Commercial Juice Extractor with Stainless Steel Container 6001X Commercial Juice Extractor Product Code Type Dimension Capacity Elec. Spec. Product Code Type Dimension Capacity Elec. Spec. Product Code Dimension Elec. Spec. WARING WARING zinc die-cast Single speed blender with durable, epoxy powder-coated jug. housing. Choice of stainless steel or glass blending WARING WARING 2-speed blender with durable, epoxy powder-coated zinc die-cast housing. Choice of stainless steel or glass blending jug. WARING WARING Bar Juice Extractor offers a compact 6001C Heavy-Duty The Waring® RPM induction motor to rapidly and effortlessly design and a powerful 3600 pulp-free juice from vegetables, fruits healthy, extract large quantities of and herbs. 04-001-00041 Chrome Base 11C
04-001-00058(XX) 43 x 50 x 102cm 1/2hp 230V / 50Hz / 373W 04-002-00077 21.5 x 23 x 61.5cm 4ℓ 0-18000rpm 04-001-00040 Color Base & Lid 12.5cm 30 x 20 x 35cm / Jug(H): 30ℓ/H 230V / 50Hz / 1300W Santosafe Blender with Stainless Steel Container 374LI Classic Citrus Juicer Dimension Capacity Elec. Spec. Product Code Capacity Product Code Dimension Capacity Elec. Spec. Product Code Type Dimension Sugar Cane Juice Extractor use while protecting the user. use while protecting the user. kitchen blender from Santos features a silent and reliable commercial kitchen blender from Santos features a silent and reliable capable of crushing hard ingredients High-resistance blades are motor. creates a vortex that such as ice while its variable speed up to 15,000 rpm The blender also has a pulse function can mix liquid and solid ingredients. The patented Santosafe locking system allows hand-free of 18,000 rpm. SANTOS SANTOS The Santosafe #37 Santosafe kitchen blender #37 (4Liters Capacity). SANTOS SANTOS for limes, lemons, oranges and grapefruits. Comes with 3 extracting cones waterproof motor block. Polycarbonate bowl with
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 168 cubes, whichiseasilyobtained. Produces soft,fluffyshavedice.Biggercapacity. Theshaverusesice Cube IceShaverPD-25 chute. shaved icetextureisavailablewiththebladeadjustmentknobnear Easy operation-frontswitchselectionforcrushingorshavingice. The HATSUYUKI Available inwhitewithblackspots. Shaves snowiceblocksintoextremelythinandsmoothlayeredice. Snow IceSlicerPDOM-PKD Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code
Ice CubeShaverMachine 230V /50Hz250W 5kg 0.3hp2.2-14kg/min 28 x4065cm 04-001-00049 220V /50-60Hz1Ph 1.4-1.7kg/min 30.6 x40.242.9cm 04-001-00062 230V /50Hz Output: 0.12kg/min Max iceblocksize:17x17cm0.25hp 42 x3269cm 04-001-00047
and safety. Includesdrainagehose,acatch tray. obtained. Automatic cutoffwhenlidisopen,providingenergyefficiency Produces soft,fluffyshavedice. Theshaverusesicecubes,whichiseasily Cube IceShaverPD-22 the shavingtable.Lightnetweight. CE mark.Lownoise,Energysavingmachine.Wideandopenspacebelow User-friendlymodel withice-liftupdeviceandwideice-receivingspace HATSUYUKI Can beusedforiceblocks.Idealcoldshavingdesserts. Block IceShaverWhite Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Block IceShaver 230V /50Hz185W 1kg 0.25hp2.2-14kg/min 40 x2846cm 04-001-00050 230V /1Ph50-60Hz 35.5 x40.256.5cm 04-001-00060 230V /50Hz1 19kg 42 x3989cm 04-001-00069
169 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-001-00054 23.6 x 35.3 x 47.4cm 1kg Output: 1.5kg/min 230V / 50Hz / 130W 04-001-00052 42 x 25 x 36cm Drawer Capacity: 1ℓ 230V / 50Hz / 600W
Ice Shaver 09 Compact Ice Crusher IC20 Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. WARING WARING All of button. Choose coarse or fine ice, crushed in just one touch cleaned with hot removable parts can be put in a dishwasher or easily soapy water. SANTOS SANTOS disc to make flaked ice or delivered with an adjustable Powerful and sturdy, for easy cleaning and maintenance. crushed ice. Design allows
04-001-00055(XX) 26 x 26.5 x 20.5cm 100g 230V / 50Hz / 25W 04-001-00053(XX) 50 x 22.8 x 30.5cm 230V / 50Hz / 25W 04-001-00051 35.3 x 23.6 x 47.4cm 1.2kg Tank: 230V / 50Hz / 130W
Ice Crusher 53G Stainless Steel Dry Ice Maker Machine Stainless Steel Glass Cooler Machine Elec. Spec. Product Code Dimension Capacity Dimension Elec. Spec. Product Code Capacity Elec. Spec. Product Code Dimension LACOR Allows manufacturing dry ice pellets of 100 g at the time and the amount which is required for safe and controlled manner. The freeze is perfect for any local adapts to all types of surfaces, taking up The freeze is perfect for any local adapts to all types hotel or restaurant. a minimum of space. Perfect for use in home, kitchen, LACOR Available in Grey. Available SANTOS SANTOS with blue lighting. Perfect for cocktails. Crushes ice. Hands free use,
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 170 ROBOT COUPE bell, knifeandwhisk. processing andanoptimumqualityend-product.Spacesavingeasytouse. All stainlesssteelremovabletube, the machinesandmaterialsusedintheirconstructionguaranteeasturdymachine.Powerfulmotorforfast The performanceintermsofhygiene,easeuse,multiplefunctions,longerlife,andprofitability ROBOT COUPEPOWERMIXERS 04-002-00013 04-002-00017 04-002-00024 04-002-00032 04-002-00033 Product Code 9ℓ COMBI
Mini MP Combi Ultra Power MixerMP450 Combi Ultra Power MixerMP350 CMP300 Combi Compact PowerMixer MP240 Combi Power MixerMini MP190 Combi Power MixerMini Description
12ℓ Ø12.5 xH89cm Ø12.5cm xH80.5cm Ø12.5cm xH70cm Ø7.8cm xH53.5cm Ø7.8 xH47cm Dimension 15ℓ COMBI 45cm 35cm 30cm 24cm 19cm Length Tool Mixer CMP
36.5cm 43cm 43cm 24cm 34.5cm Length Tool Whisk 30ℓ Mixer 1500-9000rpmWhisk250-1500rpm Up to100L Variable speed Mixer 1500-9000rpmWhisk250-1500rpm Up to50L Variable speed Mixer 2300-9600rpmWhisk500-1800rpm Up to30L Variable speed Whisk 350-1500rpm Variable speed2000-12500rpm Whisk 350-1500rpm Variable speed2000-12500rpm Capacity 50ℓ
COMBI
MP Ultra . The designof
230V / 50Hz / 500W 230V / 50Hz / 440W 230V / 50Hz / 350W 230V / 50Hz / 270W 230V / 50Hz / 250W Electric. Specs 100ℓ 171 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 400ℓ Electric. Specs 230V / 50Hz / 220W 230V / 50Hz / 270W 230V / 50Hz / 310W 230V / 50Hz / 400W 230V / 50Hz / 440W 230V / 50Hz / 440W 230V / 50Hz / 500W 230V / 50Hz / 750W 230V / 50Hz / 850W 230V / 50Hz / 1000W 300ℓ
MP 200ℓ LARGE 100ℓ Capacity speed 1500-14000rpm Variable speed 2000-12500rpm Variable speed 2300-9600rpm Variable Up to 15L speed 2300-9600rpm Variable Up to 45L 1 Speed 9500rpm Up to 50L speed 1500-9000rpm Variable Up to 50L speed 1500-9000rpm Variable Up to 100L 1 Speed 9000rpm Up to 200L 1 Speed 9000rpm Up to 300L 1 Speed 9000rpm Up to 400L 50ℓ Mixer Tool Length 16.5cm 24cm 25cm 35cm 36cm 36cm 46cm 55cm 58cm 74cm 73ℓ
45ℓ CMP Ø9.4 x H61cm Ø9.4 x H71.8cm Ø12.5 x H72.5cm Ø12.5 x H72.5cm Ø12.5 x H82.5cm Ø12.5 x H92.5cm Ø12.5 x H97cm Ø12.5 x H113cm Dimension Ø6.1 x H43cm Ø7.8cm x H52cm 30ℓ COMPACT 15ℓ 12ℓ
9ℓ Mini MP MINI Power Mixer MP350 V.V Ultra Power Mixer MP350 V.V Ultra Power Mixer MP450 V.V. Power Mixer MP550 Ultra Power Mixer MP600 Ultra Turbo Power Mixer MP800 Description Power Mixer Micromix Blender Power Mixer Mini MP240 V.V. Power Mixer CMP250 V.V. Power Mixer CMP350 V.V. Power Mixer MP350 Ultra 5ℓ
04-002-00012 04-002-00005 04-002-00002 04-002-00001 04-002-00025(XX) 04-002-00015 04-002-00016 04-002-00039 04-002-00034 04-002-00026(XX) Product Code ROBOT COUPE
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 172 PMDH 250 DYNAMIC • • ACCESSORIES MFAP 2000 DYNAMIC (DYNAMIX, JUNIOR,SENIOR,MASTERandSMXranges)withacapacityfrom1to300litresadapteachuse. Stick Blenderleaderandspecialist,DYNAMICoffersthelargestwidestrangeonmarket.5ranges DYNAMIC COMMERCIAL HANDMIXERSANDWHISKS FT 97 DYNAMIC Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Ricer Attachment 04-001-00008(XX) Whisk Attachment: Master CombiMixer(Detachable) Senior Mixer(Detachable) Master WhiskMixer(Non-Detachable) 230V /50Hz460W Ricer: 0-600rpm Whisk: 0-900rpm Mixer: 0-9500rpm Ricer (L):43cm Mixer (L):41cm Whisk (L):25cm Ø12.2 xH75.3cm 04-002-00007 230V /50Hz300W Mixer: 0-9500rpm Mixer (L):30cm Ø9.7 xH64cm 04-002-00021 230V /50Hz460W 900rpm Whisk (L):24.5cm Ø11 xH65cm 04-002-00018 : 04-001-00009(XX)
PMX 98 DYNAMIC MX 022 DYNAMIC MF 2000 DYNAMIC Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Senior Mixer(Non-Detachable) Junior CombiMixer(Detachable) Master CombiMixer(Detachable) 230V /50Hz300W Mixer: 0-9500rpm Mixer (L):30cm Ø9.7 xH64cm 04-002-00022 230V /50Hz250W 0-9500rpm /0-2000rpm Whisk: 1-5ℓ Mixer: 5-25ℓ Mixer (L):22.5cm Whisk (L):18.5cm Ø9.4 xH53cm 04-002-00023 230V /50Hz460W Whisk: 0-900rpm Mixer: 0-9500rpm Mixer (L):43cm Whisk (L):25cm Ø12.2 xH75.3cm 04-002-00010
• ACCESSORIES MX 021V DYNAMIC PMF 250 DYNAMIC MDH 2000Plus DYNAMIC Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Whisk Tool: 04-002-00020(XX) Junior PlusMixer(Detachable) Senior CombiMixer(Detachable) Master CombiMixer(Detachable) 230V /50Hz250W 5-25ℓ 0-9500rpm Mixer (L):22.5cm Ø9.4 xH50.5cm 04-002-00027 230V /50Hz300W Whisk: 0-900rpm Mixer: 0-9500rpm Mixer (L):30cm Whisk (L):20.5cm Ø9.7 xH64cm 04-002-00019 230V /50Hz460W Mixer: 0-9500rpm Whisk (L):41cm Ø12.2 xH72cm 04-002-00011
173 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
1-10ℓ 0-9500rpm 230V / 50Hz / 180W 04-002-00030 Ø7.2 x H44.5cm Mixer (L): 18cm 04-002-00331 L60cm 75-300ℓ 220-240V / 50-60Hz / 925W Mini Hand Mixer with Standard Blade Super Mixer Turbo (Detachable) Super Mixer Turbo Capacity Elec. Spec. Product Code Dimension Product Code Dimension Capacity Elec. Spec. DYNAMIC MX 010 DYNAMIC SMX 700
04-002-00038 Ø9.5 x H42.5cm Mixer (L): 19cm 1-8ℓ 0-13000rpm 230V / 50Hz / 250W 1-10ℓ 0-9500rpm 230V / 50Hz / 180W 04-002-00029 Ø7.2 x H44.5cm Mixer (L): 16cm 04-002-00330 L68cm 75-300ℓ 220-240V / 50-60Hz / 1000W Dynashake with Emulsifying Mini Hand Mixer with Emulsifying Blade Super Mixer Turbo (Detachable) Super Mixer Turbo Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. DYNAMIC Knife DYNAMIC MD 95E SMX 800 DYNAMIC
1-4ℓ 0-13000rpm 230V / 50Hz / 220W 04-002-00037 Ø7 x H39.5cm Mixer (L): 16cm 75-300ℓ 220-240V / 50-60Hz / 850W 04-002-00332 L53cm 04-002-00028 Ø9.4 x H50.5cm Mixer (L): 22.5cm 5-25ℓ 9500rpm 230V / 50Hz / 250W Dynamix Standard with Emulsifying Super Mixer Turbo (Detachable) Super Mixer Turbo Junior Mixer Standard (Non- Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Elec. Spec. Dimension Capacity Product Code DYNAMIC Knife DYNAMIC SMX 600 DYNAMIC Detachable) MX 020
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 174 to reducevibrationandensurequietoperation. loads. Itisenergyefficientsupplyingmorepowerwithlesswatts.Balanced Powerful 200watt AC motorkeepsconstant,precisespeedunderheavy handle everykitchenproject. Aerating blade,BlendingChoppingbladeandSlicingto Handbuilt inSwitzerlandwith4stainlesssteelinterchangeableblades: BAMIX ROBOT COUPE duty guaranteesdurabilityandreliability. Pulse controlallowsyoutomaintaintheprecisecutthatrequire.Industrialinductionmotordesignedforheavy recommended formoussesandsmooth-texturedmousses. giving consistenthighqualityend-productsinafewminutesforthelongestpreparation. The 3000rpmspeedis Designed toprocessalltypesoffoodandwillmix,grind,chop,kneadpureewithspeedefficiency ROBOT COUPETABLE-TOP CUTTERMIXER Elec. Spec. Capacity Dimension Product Code 04-002-00058(XX) 04-002-00064(XX) 04-002-00059 04-002-00065(XX) 04-002-00057 04-002-00061(XX) 04-002-00072 04-002-00074(XX) Product Code Electric ImmersionBlender
Tabletop CutterMixerR10E Tabletop CutterMixerR5A Plus Tabletop CutterMixerR10V.V. Tabletop CutterMixerR5V.V. Tabletop CutterMixerR10 Tabletop CutterMixerR6 Tabletop CutterMixerR3 Tabletop CutterMixerR2 Description 230V /50Hz200W 14000-18000rpm Up to Up to20ℓ Mixer (L):25cm Ø8.5 xH39.5cm 04-002-00040 04-002-00074
230V /50Hz350W 18000-22000rpm Up to Up to30ℓ Mixer (L):35cm Ø7 xH49.5cm 04-002-00041 04-002-00065
34.5 x5666cm 28 x3549cm 34.5 x5666cm 22.6 x30.446cm 34.5 x5666cm 28 x3552cm 21 x3240cm 20 x2835cm Dimension
comfortable touse. quickly, whilethelightweight,ergonomicconstructioniseasyand Its 7-inchfixedshaftandaggressivestainlesssteelbladedesignworks or pan. applications, suchaspuréeingfruitorwhippingupeggsinashallowbowl The Waring® WSB33Ximmersionblenderisperfectforquick,light-duty WARING 04-002-00059 Elec. Spec. Capacity Dimension Product Code 11.5ℓ 5.5ℓ 11.5ℓ 5.5ℓ 11.5ℓ 7ℓ 3.7ℓ 2.9ℓ Capacity Mini Mixer(Non-Detachable)WSB33E 2 Speed 1500 / 3000rpm 3 Phase 2 Speed 1500 / 3000rpm 3 Phase Variable Speed300-3500rpm Variable Speed300-3500rpm Variable Speed300-3500rpm 2 Speed 1500 / 3000rpm 3 Phase 1 Speed1500rpm 1 Speed1500rpm Speed
230V /50Hz100W Up to13.5ℓ2Speed Ø7.2 xH38cmMixer(L):17.5cm 04-002-00043 04-002-00072 400V / 50Hz / 2600W 400V / 50Hz / 1200W 230V / 50Hz / 2600W 230V / 50Hz / 1300W 230V / 50Hz / 2600W 400V /50Hz1300W 230V /50Hz650W 230V /50Hz550W Electric. Specs , 175 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 380V / 50Hz / 4400W / 50Hz / 380V 230V / 50Hz / 750W 1300W / 50Hz / 230V 1300W / 50Hz / 400V 5400W / 50Hz / 400V 9000W / 50Hz / 400V 400V / 50Hz / 11000W Electric. Specs 230V / 50Hz / 900W 400V / 50Hz / 3000W 400V / 50Hz / 4400W 1400W / 50Hz / 230V 1500W / 50Hz / 230V 2200W / 50Hz / 230V 2600W / 50Hz / 230V Electric. Specs 400V / 50Hz / 4400W 230V / 50Hz / 4400W 400V / 50Hz / 10000W 04-002-00051 Variable Speed 300-3500rpm Variable 1 Speed 3000rpm 2 Speed 1500 / 3000rpm Phase 3 3000rpm / 1500 Speed 2 Phase 3 3000rpm / 1500 Speed 2 Phase 3 3000rpm / 1500 Speed 2 Phase 3 3000rpm / 1500 Speed 2 Speed 1 Speed 3000rpm Phase 3 3000rpm / 1500 Speed 2 Phase 3 3000rpm / 1500 Speed 2 Speed 300-3500rpm Variable Speed 300-3500rpm Variable Speed 300-3500rpm Variable Speed 300-3500rpm Variable Speed 2 Speed 1500 / 3000rpm 3 Phase 2 Speed 1500 / 3000rpm 3 Phase 2 Speed 1500 / 3000rpm 3 Phase 04-002-00046 04-002-00066 20ℓ 3.7ℓ 5.5ℓ 5.5ℓ 28ℓ 45ℓ 60ℓ Capacity 4.5ℓ 15ℓ 20ℓ 5.5ℓ 7ℓ 8ℓ 11.5ℓ Capacity 20ℓ 20ℓ 45ℓ 37 x 61.5 x 68cm 38 x 63 x 78cm 28 x 35 x 50cm 28 x 35 x 53.5cm 31.5 x 54.5 x 60.5cm 31.5 x 54.5 x 68cm 38 x 63 x 78cm 24.2 x 30.4 x 44.4cm 28 x 35 x 50cm 28 x 35 x 50cm 72 x 60 x 125cm 76 x 60 x 140cm 81 x 60 x 140cm Dimension 24.2 x 30.4 x 44.4cm 38 x 63 x 76cm 38 x 63 x 76cm 76 x 60 x 140cm Dimension 04-002-00060 04-002-00052 / 04-002-00053 04-002-00071 Vertical Cutter Mixer R20 Vertical Cutter Mixer R20E Vertical Cutter Mixer R45A Vertical Description Table Blender & Mixer Blixer 15 Blender & Mixer Blixer Table 20 Blender & Mixer Blixer Table 5 V.V. Blender & Mixer Blixer Table 6 V.V. Blender & Mixer Blixer Table 8 V.V. Blender & Mixer Blixer Table 10 V.V. Blender & Mixer Blixer Table 20 V.V. Blender & Mixer Blixer Table 3D Blender & Mixer Blixer Table Plus 5A Blender & Mixer Blixer Table Plus 5A Blender & Mixer Blixer Table & Mixer Blixer 30 Blender Vertical & Mixer Blixer 45A Blender Vertical & Mixer Blixer 60A Blender Vertical Description 4 Blender & Mixer Blixer Table
04-002-00046(XX) Product Code 04-002-00052(XX) 04-002-00053(XX) 04-002-00048(XX) 04-002-00045(XX) 04-002-00066 04-002-00067 04-002-00051(XX) 04-002-00060 04-002-00055(XX) 04-002-00073 04-002-00054(XX) 04-002-00068 04-002-00063 04-002-00062(XX) Product Code 04-002-00071 04-002-00056(XX) ROBOT COUPE the strictest hygiene standards (NSF). the strictest hygiene A safety device fitted to the lid prevents access to moving blades and an integral motor braking device ensures motor braking device blades and an integral access to moving to the lid prevents safety device fitted A in compliance with and cleaned, can be easily removed into contact with food parts which come Any operator safety. The Blixers® will easily realise your pureed, raw or cooked, semi-liquid, liquid or pasty meals. With their large With their large liquid or pasty meals. or cooked, semi-liquid, your pureed, raw will easily realise The Blixers® types of mixed and to prepare all models make it simple these built in scraper, leak proof lid, with capacity and feeding. food, even for tube liquidized ROBOT COUPE BLENDER & MIXER BLIXER & MIXER BLENDER COUPE ROBOT kneading foodstuffs in a minimum of time. Less than 5 minutes are needed to realise even the longest preparation kneading foodstuffs in a minimum of time. Less than 5 minutes are needed to built with a removable bowl and All stainless steel machine for space saving, such as smooth-textured mousses. and reliable use and Control panel designed for a simple tilting seal for easier cleaning and to empty the bowl easily. equipped with a timer for a better preparation control. ROBOT COUPE VERTICAL CUTTER MIXER CUTTER COUPE VERTICAL ROBOT vegetables and smooth textured mousses, as well as for grinding and The cutter allows the processing of meat, ROBOT COUPE
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 176 Stainless SteelContainerR301UD/Ultra ROBOT COUPE Industrial inductionmotorforheavydutyuseguaranteesdurabilityandreliability Less than2minutesareneededtomakeabowlofmayonnaise,steaktartare,carrotpureeorfruitcompote. They canperformanynumberoftasks,whichyouwillgraduallydiscoverasusethem. selection ofdiscs,grate,slice,julienneandforR402biggermodels,dicemakeFrenchfriestoperfection. It willbeareliableandtimesavinginvestment. They easilychop,grind,knead,mixandthankstotheircomplete for establishmentsservingfrom10to400covers. Efficient, robustandfast,therangeofRobot-CoupeFoodprocessorswillsatisfyallProfessionalsrequirements ROBOT COUPEFOODPROCESSORS ROBOT COUPE ROBOT COUPE Elec. Spec. Capacity Dimension Type Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Food ProcessorwithVegetable Slicer Attachment & Food ProcessorStainlessSteelCutter BowlR401 Tabletop FoodProcessorV.V. 230V /50Hz650W 3.7ℓ 1500rpmSinglePhase 32 x3055cm R301UD 04-002-00095 230V /50Hz700W 4.5ℓ 1500rpmSinglePhase 32 x30.457cm 04-002-00097(XX) 230V /50Hz1500W 7ℓ 42.6 x48.188cm 04-002-00091
32.5 x3055cm PLC Housing R301UD Ultra 04-002-00096(XX)
ROBOT COUPE ROBOT COUPE ROBOT COUPE Capacity Dimension Type Product Code Elec. Spec. Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code 04-002-00092 Cutter &Veg SlicerR201XL /R201XL Ultra Tabletop FoodProcessorR402A Tabletop FoodProcessorR211XL Ultra . 2.9ℓ 1500rpmSinglePhase 22 x2849.5cm PLC Housing R201XL 04-002-00092(XX) 230V /50Hz750W 4.5ℓ 500/1500rpm 32 x30.459cm 04-002-00098 230V /50Hz550W 2.9ℓ 22 x3644.5cm 04-002-00094 230V /50Hz550W
04-002-00093 Stainless SteelHousing R201XL Ultra 04-002-00093(XX)
177 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-003-00002 25.8 x 31.2 x 29.6cm 2ℓ 26 speeds 60-12500rpm 25°-190°C 230V / 50Hz / 2300W 04-002-00100 38 x 35 x 66.5cm 5.5ℓ 1000rpm 400V / 50Hz / 1000W 04-002-00088 31.5 x 21 x 35.5cm 2.0ℓ 220-240V / 5800W 04-002-00365 32.6 x 32.6 x 34.1cm 2.2ℓ 220-240V / 50-60Hz / 1500W Vegetable Processor R502E Vegetable 20-in-1 Functions Food Processor Gastro Food Processor White / Green Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. HOTMIXPRO It has a powerful motor (1500W), capable of very high speeds (up to 12'500 rpm), and it can cook up to 190°C (374°F) with degree-by-degree temperature control (1°C increments). ROBOT COUPE BRAUN handling and Easy to store, easy to use – compact design for convenient – makes cooking space saving storage. Less noise, more convenience Environmentally friendly and cost saving thanks to a instead of noisy. easy, high efficiency motor with low power consumption. Whether for kneading, whipping, grating, slicing, shredding and even more – it comes with 7 different accessories to satisfy any food preparation desire. THERMOMIX blending, steaming, For weighing, mixing, chopping, milling, kneading, cooking, whisking, precise heating, stirring and emulsifying.
22 x 26 x 45cm 3.3ℓ 220-240V / 50-60Hz / 1400W 04-002-00357 230V / 50Hz / 600W 04-002-00101 25.5 x 29 x 40cm 3.35ℓ 1hp 1800rpm 04-002-00099 38 x 35 x 66.5cm 5.5ℓ 300-3500rpm Slicer: 300-1000rpm R-mix Reverse Speed 60-500rpm 230V / 50Hz / 1300W Mix ingredients gently. To With R mix function. Feed Attachment Kit: 04-002-00105 Feed Shredding Disc: 04-002-00104 Tabletop Food Processor R502 V. V. Food Processor R502 V. Tabletop 14-Cup Food Processor Whipping Disc: 04-002-00103 Commercial Food Processor WFP14SE Sealed Reversible Continuous Adjustable Slicing Disc: 04-002-00102 Product Code Dimension Capacity Elec. Spec. disc, Cuisinart gives you multiple food processors in one! The SealTight™ The SealTight™ disc, Cuisinart gives you multiple food processors in one! Advantage System keeps your kitchen counters clean from spills whether mixing, processing, or pouring, and the removable parts are all dishwasher safe for your convenience. The Cuisinart Elite Collection® 2.0 14 Cup Food Processor boasts a 1300 watt peak power motor to power through your favorite recipes with ease. With innovative design solutions including a 4½ cup work bowl nested inside the 14 cup bowl, adjustable slicing disc, and a reversible shredding CUISINART Dimension Capacity Elec. Spec. Product Code Add. Info. Capacity Elec. Spec. Product Code Dimension • • ACCESSORIES • • efficient motor, innovative design and robust construction. efficient motor, grinding, mixing and pureeing a large range of foods in excellent time. It grinding, mixing and pureeing a large range of foods of prep and manual features an extra large feed chute for the reduction bowl demonstrates chopping time whilst the scratch and break-resistant dishwasher-safe whilst high quality and a long user life. Its components are It has powerful and the pulse function allows excellent processing control. WARING WARING food processor which is capable of chopping, light duty commercial A ROBOT COUPE
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 178 Movable standsformodelsCL52and CL55. FitsGastronoms1/1pans. ROBOT COUPE processing. of thepusherhasbeenconceivedforabetterusecomfortandfast Machine CL55equippedwithamobilestand.Nodiscincluded. The shape CL55E ROBOT COUPE removed forcleaning,thusmaintainingthehigheststandardsofhygiene. making frenchfries,aswellguaranteeingawidevarietyofslicing,gratingandjuliennecuts. 5x5x5 mmto25x25x25mm)withoptimumqualityandprecisioneverytime.375rpmsingle-speedapplianceidealforprocessingdelicatefoodstuffs,dicingor Immensely strong,durable,andeasytoclean.Comprehensiverangeof48discsforslicing,ripplecutting,gratingcuttingintosticks,stripsordice(from ROBOT COUPE Elec. Spec. Capacity Dimension Product Code Product Code 04-002-00117 04-002-00116 04-002-00115(XX) 04-002-00114(XX) 04-002-00113(XX) 04-002-00112 04-002-00111 04-002-00110 Product Code
04-002-00110 Stainless SteelMobileStand Vegetable PreparationPusherFeedHeadwithStand Vegetable PreparationMachine Vegetable PreparationMachineCL20D Vegetable PreparationMachineCL40 Vegetable PreparationMachineCL50Ultra Vegetable PreparationMachineCL50EUltra Vegetable PreparationMachineCL50UltraPizza Vegetable PreparationMachineCL50Gourmet Vegetable PreparationMachineCL50E Vegetable PreparationMachineCL52E Description 04-002-00109(XX) 400V /50Hz1100W Up to1200kg/hHooperCapacity:4.2ℓ Machine Only:38x3292cm 04-002-00107(XX) 04-002-00111
04-002-00112 32.5 x30.457cm 32 x30.459cm 35 x3259cm 38 x3061cm 38 x30.561cm 39 x3161cm 38 x30.559.5cm 36 x3469cm Dimension • • • • • • • GRATING DISC: Safety switch:themachinestopswhenopeningdrawerorlever maintenance (removablehousinganddisc). chocolate, peanutsanddriedfruits.Itsnewdesignfacilitatescleaning A widerangeofdiscsisavailabletogratehard and softcheese, SANTOS Add. Info. Elec. Spec. Capacity Dimension Product Code Grating Grating Grating Grating Grating Grating Grating Disc#02(2mm):04-002-00119(XX) Cheese Graterwith1Disc04-002-00119 All partswhichcomeintocontactwithfoodstuffscaneasilybe DiscFonduefor#02:04-002-00125(XX) DiscParmesanfor#02:04-002-00124(XX) Disc#06(8mm):04-002-00123(XX) Disc#05(6mm):04-002-00122(XX) Disc#04(4mm):04-002-00121(XX) Disc#03(3mm):04-002-00120(XX) Up to50kg/h1500rpm Up to200kg/h500rpm Up to500kg/h2Speed375rpm Up to500kg/h375rpm Up to500kg/h375rpm Up to500kg/h375rpm Up to500kg/h375rpm Up to750kg/h375rpm Capacity 04-002-00116 Ø3mm Beige Standard disc:Grater 230V /50Hz600W Drawer Capacity:1ℓ1500/1800rpm 42 x2536cm 04-002-00118 04-002-00117
230V /50Hz400W 230V /50Hz500W 400V /50Hz600W 230V /50Hz550W 230V /50Hz550W 230V /50Hz550W 230V /50Hz550W 230V /50Hz750W Electric. Specs .
179 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-002-00127 22 x 19.5 x 39cm x 12.4cm Grinding chamber Ø17.4cm 25000rpm 230V / 50Hz / 1800W 04-002-00128(XX) 40 x 40 x 63cm Grinding stone: Ø9.2cm 1hp Output 10-25kg/h 2800/3600rpm 230V / 50Hz / 746W 230V / 50Hz / 150W 04-002-00129 14 x 20 x 22cm 0.75ℓ 0.75hp
Chopper Grinder WCG75E Grinding Machine TS-08 Soya Bean Grinder
Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Elec. Spec. Product Code Dimension Capacity TINSO grinding small amount material into 150 to 200 The machine is suitable for mesh. TINSO milk, etc. Applies to beancurd, spiced & dried bean curd, soybean WARING WARING WCG75 Pro Prep® Chopper Grinder is engineered for the The Waring® professional kitchen to give you the right tools for specific tasks with no tainting of flavors. It is perfect for prep jobs and finishing touches. Grind spices and hard foods such as Parmesan and Romano cheeses, hard chocolate, nuts, coffee beans, peppercorns, allspice, celery seed, mustard seed and more.
25 x 32 x 55cm Drawer capacity: 0.8kg Hooper capacity: 1kg 230V / 50Hz / 650W 04-002-00126(XX) 04-001-00056(XX) 25 x 32 x 55cm Capacity: 1kg Drawer Capacity: 0.8kg Hooper 230V / 50Hz / 600W 04-001-00061 240mℓ 500W 04-001-00057(XX) 39.7 x 19.8 x 57.7cm Hooper Capacity: 2.2kg 220-240V / 50Hz / 1100W Pepper Grinder with Drawer #01P Coffee Grinder w/ Drawer 01 Coffee Grinder w/ Drawer Coffee Grinder Milk Frother Capacity Elec. Spec. Product Code Dimension Dimension Capacity Elec. Spec. Product Code Product Code Capacity Elec. Spec. Capacity Elec. Spec. Product Code Dimension SANTOS SANTOS sturdy and powerful shop coffee grinder for coffee and dry Traditional spices. Easy to use and efficient, the coffee grinder #01 will give you a high quality grinding. Ideal for shops, supermarkets, coffee roasters, bakeries. spices. Ideal for shops, supermarkets, coffee roasters and bakeries. Easy spices. Ideal for shops, supermarkets, coffee grinder will give a high quality grinding. to use and efficient, this SANTOS SANTOS shop coffee grinder for coffee and dry sturdy and powerful Traditional LACOR guarantees a fresh ground coffee with all its flavours. The automatic coffee grinder # 55 dispenses the precise dose of coffee The automatic coffee grinder # 55 dispenses the Ideal appliance for bars, for 1 or 2 espressos, directly into the filter holder. the traditional hotels, restaurants, and coffee shops, it stands beside coffee grinder # 55 1, 2, or 3 groups espresso machine.The automatic SANTOS SANTOS
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 180 creams andmore. for liquidprocessingupto1.5cupsmakepastes,dressings,sauces, bowls withconvenientstoragelids.Sealedclear-viewoperatinglidallows Includes twofullyremovableanddishwasher-safe,stainlesssteelgrinding peppercorns, cinnamon,nuts,garlic,herbs,andotherdrywetblends. The 3-cupcapacityWaring® WSG60Wet/Dry PowerGrinderisperfectfor WARING Dishwasher safe. time, andtheheavydutysuctionfeetkeepslicerinplaceeverytime. Exclusive staggeredbladecartidgeensuresaperfectlyslicedtomatoevery EDLUND • • ACCESSORIES available quickconnectbases.Dishwashersafe. Able tomovequicklyandeasilyfromwalltablemountingwiththe EDLUND Dimension Slicer Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Other 04-002-00138 Table Portable Basew/SuctionCupFeetforTitan: Commercial SpiceGrinderWSG60E Tomato LaserSlicer Dicer Titan Max-CutFDW-038 Spares& Accessories availableuponrequest.
47.7 x30.529.2cm 5mm 04-002-00134 230V /750W 3 Cup Ø8.5 xW6.5H11.5" 04-002-00130 230V /50Hz550W 24 x6176cm10mmdicing 04-002-00137 6.5mm 04-002-00135
10mm 04-002-00136
of the ARC. of wash guardensuressafehandlingandtheallstainlesssteelconstruction strawberries forfasterbulkslicing. The quickchangebladecartridgewith product tobesliced,aswellforloadingsmallersoftproductslike The uniquePusher/Hopperallowssafeandperfectpositioningofthe EDLUND quick workofanentirepotatoupto60countinsizeminimizewaste. Simplyloadthepotato,applysteadypressure,andfrycutterwillmake NEMCO • ACCESSORIES: firm-fleshed ones,likecarrots,celery, onions,courgettes,andapples. potatoes. Tailored toawidevarietyoffruitandvegetables,including just afewturnsofthehandles.Easilymadecoleslaw, rösti,andgrated Create tagliatelle,spaghetti,andjulienne-cutfruitvegetableswith L' TELLIER Add. Info. Dimension Slicer Product Code Elec. Spec. Dimension Product Code Dimension Product Code 04-002-00153(XX) Motor Kitfor#N7001Vegetable SlicerLeRouet: Chip Twister FryCutter55150B Fruit andVegetable Slicer Arc
Turning Vegetable SlicerLeRouet Choose from1/4’’, 3/8’’ or1/2’’ diceorfries 24 x5166cm 5mm 04-002-00131 230V /50Hz 43.8 x25.422cm 04-002-00154(XX) 37 x1425cmSlice Thickness 2/3/6mm 04-002-00152 6.5mm 04-002-00132
10mm 04-002-00133
181 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-002-00157 27 x 14 x 22cm 04-002-00158 25 x 10 x 13cm 12x12 / 10x10 / 9x9mm 04-002-00155(XX) 62 x 36 x 52cm 1500rpm 230V / 50Hz / 650W Automatic Sieve Juicer C80 Stainless Steel Potato & Vegetable Chipper with 3 Blades Stainless Steel Potato & Vegetable Vegetable Slicer Vegetable
Product Code Dimension Product Code Dimension Blade Grids Product Code Dimension Capacity Elec. Spec. Cut vegetable- and fruit spirals, spaghettis and rings. Ideal for carrots, Cut vegetable- and fruit spirals, spaghettis and rings. with 3 interchangeable apples, cucumbers, potatoes, cabbages, salad etc., slicing units and non-slip feet. WESTMARK Strong suction cup foot ensures a safe grip. Easy to change attachments 3 serrated blades and slicer attachments for different cutting widths. WESTMARK ROBOT COUPE extract fruit pulp or separate fibres from Strain soups, bisques or sauces, vegetables.
04-002-00160 5.5mm 04-002-00163(XX) Belt Type 41 x 35 x 51cm 1/4hp 230V / 50Hz / 186W 04-002-00159 4mm 42 x 20 x 21cm 04-002-00156(XX) 89 x 49 x 87cm 1500rpm 230V / 50Hz / 900W 04-002-00174(XX) 0.1 to 4mm
Automatic Sieve Juicer C120 Stainless Steel Truffle Mandoline Slicer Stainless Steel Truffle Elec. Spec. Product Code Type Dimension Capacity Product Code Thickness Slicing Dimension Product Code Dimension Capacity Elec. Spec. Slicing Thickness Slicing Product Code Spring Onion Cutter Manual Tomato Slicer Manual Tomato ensure easy cleaning and durability. Continuous feed hopper for ease of Continuous feed hopper durability. ensure easy cleaning and removed and All parts in contact with food are easily use and time saving. are dishwasher safe. ROBOT COUPE fruit purees, vegetable mousses, sauce The machine produces juice, are made of stainless steel to All parts soups. bases, bisques and fish For truffles and mushrooms. Tempered stainless steel blade for thinner and Tempered stainless steel blade For truffles and mushrooms. perfect slices. Cut thickness from 0.1 to 4 mm. Stainless steel. MATFER MATFER
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 182 • ACCESSORIES: blade andcorrugatedblade. French friesandjulienne. Table edgesupport,2cuttingbladeunits,smooth Adjustable slicesthicknessandwaflecuts.Smoothorembossedslices, L. TELLIER • • • • • ACCESSORIES: three differentthicknesses1/8”,3/16”or3/8”. and wafflecuts.Thethreejuliennebladescreateclassicstripsin and cabbagetolemonspotatoes. The serratededgecreatescrinkle edge oftheslicingbladeisidealforavarietyfoodsfromcarrots The safetyguardorpusherprotectshandsfromtheblade. The straight The mandoline’s slicingbladehasbothastraightedgeandserratededge. composite fiberglass.Bladesarecraftedfromhighcarbonstainlesssteel. Frame andsafetyguard/pusheraremadeofheatresistant,nonporous MATFER • ACCESSORIES: start cycleforproductthickness,whilemaintainingcompletesafety them perfectforslicingcookedchickenbreastsfajitas,caesarsalads,orlargerbeefsteaktomatoes. The new350XL Seriesofslicersaredesignedtohandlelargeritemsandmorethem. The opening,bladeassembly, andpusherare11⁄2′′ largerwhichmakes EDLUND Add. Info. Dimension Product Code Product Code Elec. Spec. Dimension Slicing Thickness Product Code 04-002-00342 Stainless SteelGuardwithPlasticHandle: Pads (Setof4pc) Reversible Blade Cutting Block Cutting Block Cutting Block(3mm):04-002-00169(XX) Replacement Blade Assembly andPusherInsertavailableuponrequest Mandoline 2000with3BladesandPusher Electric FoodSlicer Stainless SteelClassicMandoline (10mm):04-002-00171(XX) (5mm):04-002-00170(XX) : 04-002-00172(XX) : 04-002-00173(XX) 60 BladesN2460 41 x134.5cm 04-002-00166 04-002-00168 230V /50Hz 29.2 x31.843.2cm 5mm withSliceBlade#356 04-002-00186(XX)
.
6.5mm withSliceBlade#354 04-002-00184(XX) matchstick potatoes,andchips. slices, Wafers andcrisps,Julienne-cutitems, Angel hair, Thin-cut chips, Ideal for:Variable-thickness slicesoffruitandvegetables,Waffled Carriage L. TELLIER • ACCESSORIES: of juice.Ithasallthefeaturesforanefficientandsafeworkdaily citrus (lemons,oranges,kiwis,etc.) The horizontalcutavoidsalargeloss garnish salads,hamburgers,sandwiches.Works alsoverywellforcutting Provides quickandeasyaccesstoregular5.5mmtomatoslices.Ideal L. TELLIER Add. Info. Dimension Product Code Dimension Slicing Thickness Product Code Set of11 Blades:04-002-00192 Stainless SteelMandolinewithTable StandwithoutProtective Stainless SteelTomato SlicerCTX55 The newpusherdesignallowsoperatorstoadjustthe 44 Blades 41 x13.54.5cm 04-002-00356 48 x2032cm 5.5mm 04-002-00191
Without BladeandInsert 04-002-00177(XX) Guard 38 Bladeswithout 04-002-00335 .
183 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
White 04-002-00201 45 x 26 x 14cm 04-002-00194 230V / 50-60Hz / 100W Apple Dream with Screw Clamp Electric Knife EM3965 Product Code Dimension Product Code Elec. Spec. Colour WESTMARK the core The peeler peels, cuts into spiral discs and also removes The suction cup offers stability SEVERIN food which is conventionally cut or chopped Slides effortlessly through blades with no residue dishwasher-safe cuts cleanly and precisely, safety on-off switch finger protection. guarantee easy cleaning
. 04-002-00200 40 x 50 x 90cm 15kg 500kg/h Tank: 1400rpm 1.5hp 230V / 50Hz / 900W
4mm 04-002-00197 39 x 12.5 x 21cm 04-002-00199 32 x 42 x 80cm 8kg 250kg/h Tank: 1400rpm 1.0hp 230V / 50Hz / 550W 04-002-00193(XX) 32.5 x 38.5 x 58cm Cuts 6 Wedges Professional Apple Peeler Tomato Wedger CAX106 Wedger Tomato Stainless Steel Potato Peeler Product Code Dimension Thickness Slicing Capacity Elec. Spec. Product Code Dimension Product Code Dimension Add. Info. L. TELLIER about 40 kg/hr Peel, cut and remove the core of the apples. Speed: The machines are endowed with speed reduction unit with belt drive, and The cover made in the multigrip belt is quiet, safe and easily adjustable. The transparent glass or transparent polycarbonate allows the processing. automatic outlet device and water inled is of Ø 50 mm for potato peeler. The turning plate of potato peeler is made in silicon carbon or aluminium. S.A.P S.A.P foot, it allows to easily recover the freshly cut quarters in a tray to be placed the freshly cut quarters in a tray to be placed foot, it allows to easily recover Its stainless steel design guarantees all the underneath (not supplied). and reliability. guarantees of NF food standards L. TELLIER sections allows cutting of tomatoes Tellier in The tomato and citrus cutter and quickly in regular quarters. Mounted on and citrus fruit automatically
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 184 store apre-madesaladandkeepitfreshfordays. Lid separatesforeasycleaninganddrying.Spinnercanalsobeusedto Retractable cordandbrakesystemremovesexcesswaterwithease ZYLISS treatment tohindermoldgrowth. polypropylene plastic,anditspartshaveundergoneanantibacterial the flipofaswitch. Theinterior, outside,andtopareallmade ofdurable accommodate 5gallonsofproduct,anditrunsatasinglespeedwith can dryeightheadsoflettuceinlessthan60seconds.Itsinterior Rotating 500timesperminute,theDynamicEM98electricsaladspinner DYNAMIC leaves gettingcaughtinthegears. splashing, removingtheriskofcontaminationordamagecausedbysalad Sealed covergivingtheaddedbenefitofawater-tightlidtoprevent DYNAMIC Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Capacity Dimension Product Code Easy SpinSaladSpinner Electric SaladSpinnerEM98 Manual SaladSpinnerwithSealedCoverSD92 5ℓ Large 04-002-00358 230V /50Hz200W 20ℓ Max:Upto8HeadsofLettuce Ø43 x60cm 04-002-00206 20ℓ Max:Upto8HeadsofLettuce Ø43 x50cm 04-002-00207
2.5ℓ Small 04-002-00359 Made ofstainlesssteel.Dishwashersafe. LACOR Crankshaft handle.Patentdesign,innovativebrakeseffectivelyimprove JIWINS Polypropylene (Food-safeplastic). Aluminum handle. for anintensivedailyuse.Outsidecontainer, topandinnerbasketin Fast andefficient,itrespectstheproduct’s fragility. Heavydutyconstruction DYNAMIC A-STAR hygiene standardsofFDA. the servicelifeofgearSealedrotatingsystemtoensurefoodsafety. Meets Capacity Dimension Product Code Capacity Dimension Product Code Capacity Dimension Colour Product Code Capacity Dimension Product Code PP SaladSpinner Stainless SteelSaladSpinner PLC SaladSpinner Manual SaladSpinnerSD99/SD92 4.5ℓ Ø24cm 04-002-00208 Heads ofLettuce 10ℓ Max:Upto4 Ø33 x42cm 04-002-00204 (SD99) 6.2ℓ Ø26 x17.2cm 04-002-00202 18.9ℓ Ø46.5 x56.5cm 04-002-00337
Green
Heads ofLettuce 20ℓ Max:Upto8 Ø43 x50cm 04-002-00205 (SD92) 04-002-00203 9.5ℓ Ø39.5 x47cm 04-002-00338
White 185 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 04-002-00216 42 x 24 x 30cm Ø19.5cm 230V / 50Hz / 132W #195 w/ coil switch . specifically designed
04-002-00215 43 x 29 x 43cm Ø22cm 230V / 50Hz / 150W #220
04-002-00225 68 x 47 x 76cm Ø32cm 2 x 230V / 50Hz / 370W 04-002-00229 45 x 28 x 46cm Standard Mouth Ø5.2cm 600kg/h 2.2hp 230V / 50Hz / 1850W 04-002-00214 55 x 36 x 45cm Ø25cm 230V / 50Hz / 245W #250 Meat Slicer with 1 Knife & 1 Plate Accessories available upon request Product Code Dimension Blade Elec. Spec. Product Code Dimension Capacity Elec. Spec. Meat Slicer Machine S.A.P S.A.P structure, covered Hygienic, robust, easy to clean and use. Cast alloy Gear motor consisting entirely with stainless steel. Self-ventilated motors. oil bath gearbox. of 4 hardened steel gears enclosed in a leak-proof The mincing unit can be Stainless steel hopper and meat collection tray. All machine parts can be easily disengaged by simply turning a lever. cleaned using a damp cloth. ACCESSORIES • 04-002-00213 60 x 33 x 50cm Ø30cm 230V / 50Hz / 300W #300 04-002-00218 40 x 28 x 36cm Ø22cm 230V / 50Hz / 110W Sirio Galaxy #220SR 04-002-00218 04-002-00212(XX) 71 x 57 x 47cm Ø35cm 230V / 50Hz / 300W #350 Red
04-002-00219(XX) Ø30mm
04-002-00217 38 x 25 x 31cm Ø19.5cm 230V / 50Hz / 110W Galaxy #195VG Vera 04-002-00211 70 x 46 x 60cm Ø35cm 230V / 50Hz / 300W #350 04-002-00217 Meat Slicer Machine with Safety Ring and Silver Table Bolt Safety Ring and Silver Table Meat Slicer Machine with Black Anodized Meat Slicer Machine Black Accessories available upon request Manual Meat Slicer with Blade Blade Colour Product Code ACCESSORIES • FAC FAC Produced to support all kinds of duty in slicing and the construction material specifically designed to simplify use, used is always of the highest quality. maintenance and cleaning. Elec. Spec. Model Ref. Product Code Dimension Blade Blade Elec. Spec. Model Ref. Product Code Dimension Essedue slicers are produced to support all kinds of duty in slicing and the construction material used is always of the highest quality material used is always of the highest to support all kinds of duty in slicing and the construction Essedue slicers are produced security during work are designed to reflect food safety and absolute All material and protections used in slicers and cleaning. to simplify use, maintenance preventing all possible risk. ESSEDUE ESSEDUE the construction material Produced to support all kinds of duty in slicing and specifically designed to simplify use, used is always of the highest quality. maintenance and cleaning.
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 186 of afeedscrew, blade,plateandhandwheel. cleaning, itdisablesallthemachinefunctions. The cuttingsystemconsists machine’s safetysystemdetectsthatthehopper hasbeenremovedfor hopper canberemovedtomakecleaningeasierandfaster. Whenthe complete withsafetymicroswitchandlargecapacitymincingunit. The Meat mincermadeentirelyofstainlesssteel,withalargecapacityhopper S.A.P complies withthestrictestECsafetystandards. with ageartransmissionandeasilyremovablestainlesssteelblades, for meatcontainingbonesorfrozenmeat. The machine,whichisequipped for tenderizingslicesofraworcookedmeat,butisnotsuitableusewith Cuts themeatfibrestotenderizewithoutruiningit.Itcanbeused S.A.P Meat SlicerMachine Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Aluminium Tenderizer INTM Meat Slicerwith1Knife&Plate 230V /50Hz2200W Output 1200kg/h3.0hp Neck: Ø11.5cm withsafetynet 40 x7393cm 04-002-00228(XX) 230V /50Hz150W Max Thickness 2cm Cutting Capacity:15x2cm Surface Dimension:16x38.5cm 44 x1748cm 04-002-00227 230V /50Hz400W 54 x3547cmBladeØ27.5cm 04-002-00226
• • • • ACCESSORIES: Funnels. hopper. The idealdeviceformeatmincingingeneral.Optionaltools:Filling Manufactured withstainlesssteelcase AISI 304,mincingunit,trayand S.A.P tensioner, portionsetterforcutsincorporated. nitro paintedoranodized.Work tableinstainlesssteel,adjustableblade frozen fishandmeatindustries.Castmetalmachinebodyfinishedin TYPE OFUSE:Butchersshops,fishmongers,restaurants,canteens, S.A.P • ACCESSORIES Elec. Spec. Capacity Product Code Model Ref. Elec. Spec. Capacity Dimension Product Code Stainless SteelKnifeforTC22PMCE 04-002-00241(XX) 04-002-00240(XX) 04-002-00239(XX) 04-002-00238(XX) 04-002-00237(XX) 04-002-00236(XX) 04-002-00235(XX) Plate forTC22PMCE Sausage FunnelsforTC22MCE 04-002-00233 Filling Setw/3Funnels&1PropellerStopforTC22PM: Accessories availableuponrequest Meat Mincerwith1Kniife&PlateTC22PMCE Aluminium BoneSaw
04-002-00221
230V /50Hz1100W 250kg/h Platehole4.5mm1.5hp 04-002-00232 SM183AEX Anodised BoneSaw 230V /50Hz750W 1.0hp Max CutHeight:32cm 22.5cm Usable CutHeight: 41 x41cm Working Table: 53 x4291cm 04-002-00221 :
: 04-002-00234(XX)
: 04-002-00242(XX)
04-002-00222 SM155VECO 230V /50Hz750W 1.0hp Max CutHeight:25cm 15cm Usable CutHeight: 33 x33cm Working Table: 44 x3781cm 04-002-00222(XX)
187 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-002-00259 30 x 30 x 71cm 7ℓ 2 Speed 04-002-00258 59 x 23 x 24cm 5ℓ 2 Speed 04-002-00249 63 x 30 x 46cm Grater Mouth 14 x 7.5cm Mincer output: 160kg/h Grater output: 40kg/h 1.0hp 230V / 50Hz / 750W
Stainless Steel Vertical Sausage Filler INV7 Stainless Steel Vertical Stainless Steel Sausage Filler Meat Mincer Grater with 1 Kniife & 1 Plate TG12PMCE Meat Mincer Grater with 1 Plate for Meat Mincer Grater TC12PMCE (Ø4.5mm): Plate for Meat Mincer Grater TC12PMCE (Ø4.5mm): 04-002-00250(XX) Accessories available upon request Product Code Dimension Capacity Product Code Dimension Capacity Product Code Dimension Capacity Elec. Spec. S.A.P S.A.P The sausage fillers have two Extremely robust, easy to handle and use. speeds and interchangeable funnels for different types of sausage. S.A.P S.A.P sausage filler machine has a unitized bearing structure with This SAP overgear the stroke of stainless steel movement and gears to reduce and made of metal to ease the the piston.The manual sausage filling machine is The sausage filling bag filling and piston extraction operations respectively. AISI 304/S. pipe is made of food grade stainless steel S.A.P S.A.P AISI 304, mincing unit, tray and steel case Manufactured with stainless in general. Optional tools: Filling The ideal device for meat mincing hopper. Funnels. ACCESSORIES: • • -
04-002-00340 230V / 50Hz / 850W 04-002-00243 42 x 26 x 48cm Inox Mouth Ø70mm Standard Mouth Ø52mm 100kg/h Plate hole 4.5mm 1.0hp 230V / 50Hz / 750W 04-002-00255 27 x 12 x 16cm Plate Ø4/5/8mm Stainless Steel Meat Mincer
Meat Mincer with 1 Kniife & 1 Plate TC12PMCE Meat Mincer with 1 Kniife Filling Set w/ 2 Funnels & 1 Propeller Stop for TC12PM: Filling Set w/ 2 Funnels & 1 Propeller Stop for TC12PM: 04-002-00244 Accessories available upon request Product Code Elec. Spec. Capacity Elec. Spec. Product Code Dimension Product Code Dimension Electric Meat Mincer • ACCESSORIES: • S.A.P S.A.P AISI 304, mincing unit, tray and steel case Manufactured with stainless in general. Optional tools: Filling The ideal device for meat mincing hopper. Funnels. and bake with this Stainless Steel meat mincer. It has three interchange and bake with this Stainless Steel meat mincer. funnel for A able mincing plates (hole sizes 4 mm, 5 mm, and 8 mm), making sausages, and a baking attachment for shaping dough. Its strong suction base ensures a secure hold on the worktop for safe use. WESTMARK make sausages, or somewhere in the middle, finely, Mince meat coarsely,
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 188 non-rusting aluminumalloy. Makes uniformhamburgerpattieseverytime.Die-cast,polishedfinishof ALEGACY Ideal forshapingburgers. FISCHER 28mm. with 4wheelsforeasyhandlingand3stainlesssteelfunnels:12,20, cylinder isremovableandadjustable,makingcleaningeasier. Equipped cylinder inaverticalpositionthroughmechanicalsafetydevice. The during fillingoperation.Loadedfromabovebyrotatingandlockingthe regulator ofthepistonallowoperatortoworkfluidlyandinfreedom used fortheprocessingofporkandbeef. The kneecontrolandthespeed The verticalhydraulicsausagefillersaremadeinstainlesssteeland S.A.P Product Code Dimension Product Code Dimension Elec. Spec. Capacity Dimension Product Code Stainless SteelHydraulicVertical SausageFillerINV/ID22M
Round SteakFormer Aluminium RoundHamburgerPress
Ø10 x5cm 04-002-00262 Ø10 x9cm 04-002-00261 230V /50Hz370W Piston reversaltime22min Min. Emptyingtime64min 22kg 0.5hp 52 x57119cm 04-002-00256(XX)
Manual HamburgerPress secure holdontheworktopforsafeuse. Chopped meatpressingmachinesforhamburgerssuctionbaseensuresa FISCHER kinds ofsausages. gears andtheyareequippedwiththreechangeablefunnelsfordifferent working, themaximumefficiencyandlonglife. Thesausagefillers havetwo and theaccuratemanufacturingofallmechanicaldetailsensureaperfect aluminium pistonwithspecialfinishing,thesolidrack,precisiongears sausage. The 18/8 AISI 304stainlesssteelcylinder, thefoodapproved equipped withthreefunnels,arereallythebestforstuffinganykindof models by-handsausagefillers,size7-14litersverticalorhorizontal, Exceptionally strong,veryeasytobehandledandoperated,thefour S.A.P Dimension Product Code Dimension Product Code Capacity Dimension Product Code Stainless SteelVertical SausageFillerINV14 Round HamburgerPressforSteak
Ø10 x26cm 04-002-00263 Ø10 x13.5cm 04-002-00260 14ℓ 2Speed 27kg 35 x87.5cm 04-002-00257(XX)
189 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
Type Angelo Capelli d’ Trenette Lasagnette Pappardelle Angelo Capelli d’ Spaghetti Reginette Lasagnette Reginette
04-002-00282 Ø10 x 13.5cm 230V / 50Hz 04-002-00272 19 x 18.5 x 16cm Detachable Dimension Thickness 1.5mm Thickness 4mm Thickness 12mm Thickness 32mm Thickness 0.8mm Thickness 2mm Thickness 12mm Thickness 44mm Motor for Imperia & Titania Simplex Cutter for 04-002-00272 Manual Noodle Machine Product Code Dimension Elec. Spec. Product Code 04-002-00274 04-002-00275 04-002-00276 04-002-00277 04-002-00278 04-002-00279 04-002-00280 04-002-00281 Product Code Dimension Add. Info. Overall preparation time is also significantly reduced. *Can be used with 04-002-00272 and 04-002-00273 IMPERIA IMPERIA The Electric Motor has two speed buttons, one speed for kneading the This attachment makes pasta and one speed for cutting the sheet of pasta. pasta making easier as two hands can be used to handle the dough. IMPERIA IMPERIA IMPERIA IMPERIA steel pasta machine is precision The Imperia " iPasta" chromium-plated and built to last. With the Imperia and its sturdy engineered in Italy, 6 different thick-nesses and you can make pasta dough in “Duplex” cutter, and fettuccine. two types of pasta: tagliatelle
Lasagnette Spaghetti Type Angelo Capelli d’ Tagliatelle Trenette Fettuccine
04-002-00273 18 x 13 x 20.5cm 150mm Non-Detachable 04-002-00265 32.5 x 22 x 27.5cm Roller 22cm Thickness 12mm Thickness 2mm Dimension Thickness 1.5mm Thickness 2mm Thickness 4mm Thickness 6.5mm Simplex Cutter for 04-002-00265 Manual Noodle Machine Manual Commercial Noodle Machine Manual Commercial Noodle 04-002-00268 04-002-00269 04-002-00270 04-002-00271 Product Code 04-002-00266 04-002-00267 Dimension Add. Info. Product Code Dimension Product Code IMPERIA IMPERIA engineered in Italy, sturdy and built to last. Producing a 150mm leaf in 6 engineered in Italy, thicknesses which is then cut to 2mm (tagliatelle) or 6,5mm (fettuccine). IMPERIA IMPERIA chromium-plated steel pasta machine is precision Titania The Imperia Rolls different pasta to varying thickness – chromed steel structure – Rolls different pasta to varying operations. stainless steel rollers – manual IMPERIA IMPERIA
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 190 Heat-treated gearandalloy. Professionalmotor. Thermal overloadprotection.Lastingandhighpressureresistantgrease. TINSO Heat-treated gearandalloy. Professionalmotor. Clutchgeartechnique. Thermal overloadprotection.Lastingandhighpressureresistantgrease. TINSO Pastries, Croissant,Pies,Biscuit,Pita, Tortillas andetc. Various thicknessadjustmentandfinalcanbefixed.For TINSO Elec. Spec. Capacity Dimension Product Code Add. Info. Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Electric DoughMixerwithoutSafetyGuard Planetary DoughMixerTable Top Dough Sheeter 230V /50Hz210W 8ℓ/1kg 150-630rpm1/3hp 30 x4055cm 04-002-00290(XX) With SafetyGuard 230V /50Hz210W 150-630rpm 1/3hp 8ℓ/1kg 30 x4055cm 04-002-00291 415V /50Hz 1hp Roller: 88x63.5cm Conveyor: 63x290cm 300 x96110cm 04-002-00285(XX)
& SafetyGuard With 1Bowl,3Fittings 230V /50Hz250W 150-630rpm 1/3hp 10ℓ/1.5kg 36 x4761cm 04-002-00292
flat beater)toensureallmixingrequirementscanbemet Thermal overloadprotection.Combinedwith3fittings(whisk,stirringhook, Heat treatedgearandalloy. PowerfulHighEfficiencyindustrial motor. TINSO fine. Stronganddurable.Lowmaintenancerate. Adjustablespace. Dough PressMachinedischargesairofthedoughandmakesbread TINSO With safetyguard.Safetyloafpusher. TINSO Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Capacity Dimension Product Code Planetary DoughMixer Dough Press Bread SlicerMachine 750W 230V /50Hz 3 Speed1hp 80/168/310rpm 30ℓ/6kg 60 x46101cm 04-002-00287 3/4hp Roller 30cm 38 x4836cm 04-002-00286(XX) 230V /50Hz186W 31 knives Standard 12mm1/4hp 68 x6373cm 04-002-00304
370W 230V /50Hz 3 Speed1/2hp 110/225/475rpm 20ℓ/3kg 60 x46101cm 04-002-00288
230V /50Hz186W 27 knives Standard 12mm1/4hp 62 x6361cm 04-002-00305(XX)
.
250W 230V /50Hz 3 Speed1/3hp 130/278/430rpm 10ℓ/1.5kg 40 x3873cm 04-002-00289
191 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines Grey 04-002-00297 White 04-002-00296 37 x 28 x 41cm 4.8ℓ
Planetary Dough Mixer KPM50 Professional Planetary Dough Mixer KPM50 Product Code Colour Dimension Capacity KITCHENAID enough for nearly any task or recipes, stirring 10 Speeds Control. Powerful dough or whipping cream kneading bread wet and dry ingredients together, hook or wire dough The beater, incorporation. Delivers thorough ingredient giving incredible bowl coverage for fast and whip rotates around the bowl, complete mixing. White 04-002-00295 04-002-00317 23.5 x 23.5 x 13cm 230V / 50Hz
Silver Metallic 04-002-00294 04-002-00316 23.5 x 14.5 x 14cm 230V / 50Hz Empire Red 04-002-00293 41.9 x 28.7 x 3.1cm 6.9ℓ 230V / 50Hz / 325W Planetary Dough Mixer KM7990X Professional Planetary Dough Mixer KM7990X Stainless Steel Seaweed (Nori)) Dryer Capacity Elec. Spec. Product Code Colour Dimension Elec. Spec. Product Code Dimension Wire guard and stop switch. For increased safety in a commercial Wire guard and stop switch. construction, high precision metal gears and environment. Full metal body quiet and durable. metal control knobs. Stable, KITCHENAID KITCHENAID
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 192 minute. usage operations.Requires85P.S.I at1.5to2C.F.M. Opens 8to12cans/ Heavy Dutyairpoweredcrownpunchforfoodprocessorsandheavy EDLUND slower secondspeedforsmallercanspreventsspillingofliquids. hospitals oroperationsthatneedtoopenmorethanonesizeofcans. The These countertopelectriccanopenersareespeciallysuitedforschoolsand EDLUND Opens 8to12cans/minuteandup400cansperday. standard size#10roundcan.ComeswithMagneticLidremoversystem. Each machineiscompletewithknifeandguardringlocatorforone EDLUND Model Ref. Elec. Spec. Capacity Product Code Model Ref. Elec. Spec. Capacity Dimension Product Code Model Ref. Capacity Product Code
Heavy Duty Air PoweredCrownPunchCanOpener Electric CanOpener Air PoweredCrownPunchwithMagneticLid#610M #625 230V /50Hz cans perday Opens upto2000 04-002-00312(XX) #203 230V /50Hz 75 cansperday 2 Speedsopensupto 13 x1830.5cm 04-002-00306 #610M Opens upto400cansperday 04-002-00310(XX) #625A cans perday Opens upto3000 04-002-00313(XX) #266 75 cansperday 1 Speedopensupto 04-002-00307
slower secondspeedhelpspreventspillagewhileopeningsmallercans. assemblies thatcanberemovedwithouttoolsforeasycleaning. The This modelisequippedwith2speedmotorandfeaturingknifegear The onlyNSFCertifiedelectriccanopenerforheavyvolumeoperators. EDLUND automatically. The cabinetandcrusher boxcanbethoroughlycleaned. and automaticallydropthecanintoareceptacle. The cyclinderrecycles This powerfulunitwillcrushupto10cansperminuteathicknessof1.25” EDLUND Requires 85P.S.I at1.5to2C.F.M. operations. Opens8to12cans/minuteandup2000cansperday Heavy Dutyairpoweredcrownpunchforfoodprocessorsandheavyusage #625M EDLUND Model Ref. Elec. Spec. Capacity Dimension Product Code Model Ref. Elec. Spec. Product Code Model Ref. Capacity Product Code Electric CanOpener Electric HydraulicCanCrusher Heavy DutyCanOpenerw/MagneticLidRemovalSystem #270 230V /50Hz 200 cansperday 2 Speedsopensupto 27 x3529cm 04-002-00308 CH5000 230V /50Hz1900W 04-002-00315(XX) #625M Opens upto2000cansperday 04-002-00311(XX)
#270C Gas ShockSlideBar 200 cansperdaywith 2 Speedsopensupto 28 x67cm 04-002-00309(XX) .
193 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines THE SOUS VIDE EXPERTS
BESSER VACUUM: MADE IN ITALY VACUUM Besser Vacuum is a second generation Italian company, specialized in the production of vacuum machines for professional and domestic use, smooth and embossed vacuum bags for cooking and preservation, sous vide cooking machines, traysealers and machines for polishing and sterilizing cutlery and glasses. With several partners in 85 countries and three head offices: one near Udine (Italy), one near Barcelona (Spain) and one in Querétaro (Mexico), Besser Vacuum company has created a strong specialized network which is able to follow its customers at the very best way.
www.besservacuum.com Mistral BESSER VACUUM Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code BESSER VACUUM BESSER VACUUM manufactured inrespectofgreeneconomyandcompliancewithsocialresponsibility. and first-classtechnicalcomponentswillgrantyoureliability, life-longresistanceanda100%safeproduct,wholly and powerofyourmostsuitablevacuumpackagingmachineforvaluedbusiness. vacuum packagingmachines.Choosefromourselectionofthefollowingmodelstofindperfectsize,dimension international regulations.BesserVacuum iscertifiedISO9001:2008.Besser Vacuum offersmorethan10modelsof material whichhasbeenthoroughlytestedandofbestquality, inaccordancewithallapplicablenationaland All BesserVacuum productsaremanufacturedbyhighlyqualifiedstaffinthecompanyproductionfloors,using BESSER VACUUM Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code Table ChamberVacuum Machinew/GasImplant Table ChamberVacuum Machinew/GasImplant Chamber Vacuum MISTRAL LCD Display 43 x22cm 42cm 16 /21m³/hBusch 04-002-00322 EOS LCD Display 33 x21.5cm 32cm 8m³/h Busch 04-002-00323 BREEZE Digital Display 27 x3519cm 26cm 6m³/h DVP 04-002-00348 Inclined Shelf Comes withmarinatingSensor, USBPrinter, GNpansSuctionPipeand (Customised Model) BESSER VACUUM Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code BESSER VACUUM BESSER VACUUM Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code Model Ref. TypeDisplay Chamber Dimensions Welding Bar(PistonSealBar) Pump Product Code
Table ChamberVacuum MachinewithSpecialOptions Table ChamberVacuum Machinew/GasImplant Table ChamberVacuum Machinew/GasImplant Appealing Italiandesign CUSTOMISED MODEL -MISTRAL LCD Display 43 x20cm 42cm 16m³/h Busch 04-002-00350 AUSTER LCD Display 27 x3519cm 26cm 6m³/h DVP 04-002-00324 GHIBLI LCD Display 53 x23.5cm 52cm 21 /25m³/hBusch 04-002-00321 195 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
e
04-002-00320 49 x 29.5 x 18cm Seal Bar 43cm 230V / 50Hz / 450W FRESH 04-002-00328(XX) 50 x 40 x 52cm 04-002-00327 36 x 15 x 8.5cm 230V / 50Hz / 1100W
Stainless Steel External Suction Vacuum Machine Machine Vacuum Stainless Steel External Suction Freeze Dryer Economy External Suction Vacuum Machine Economy External Suction Vacuum Product Code Dimension Elec. Spec. Model Ref. Product Code Dimension Product Code Dimension Elec. Spec. BESSER VACUUM BESSER VACUUM Fresh of small and medium businesses in the food Designed to meet the needs characterized by these external suction packaging machines are industry, and professional vacuum. Made in stainless compactness, ease of use and high-performance vacuum pump, they steel with multilevel welding sliced meats, cheese and vegetables. W are particularly suitable for use of embossed bags to guarantee the correct recommend the exclusive and the effective sealing of the vacuum bag. operation of the machine flavour and unusual mouthfeel and use as components to compliment your own culinary creativity. CLIFTON CLIFTON known as the Cliftonfreezdryer, This cutting edge benchtop freeze dryer, offers sophistication and simplicity of use. It allows innovation in texture, Through experimentation and creativity you have flavour and appearance. Create your own flaked or the opportunity to be unique in the industry. powdered mushrooms, bananas, tomatoes, strawberries etc, giving full LACOR significantly extend its Improve the conservation of perishable products to natural is extracted and life. So all the air vessel containing cooked food or from entering. isolated those food sealing container to prevent air
04-002-00326 0.6ℓ and 2.5ℓ 04-002-00325 38 x 18 x 11cm Seal Bar 33cm 220V / 240V 50Hz / 60Hz DIVA 04-002-00349 30 x 18cm Internal Dimension: 42 x Seal Bar: 33cm 230V / 50Hz / 380W MINI
Containers with Adaptor (Set of 2) Containers with External Suction Vacuum Machine Diva External Suction Vacuum Stainless Steel External Suction Vacuum Machine Vacuum Stainless Steel External Suction
Product Code Capacity Model Ref. Product Code Dimension Elec. Spec. Elec. Spec. Model Ref. Product Code Dimension or precooked food. They have a lid with a valve and a suction pipe that, or precooked food. allows connected to the machine on one side and to the jars on the other, The containers are the air to be perfectly extracted from the container. suitable for external suction machines which have a nozzle to extract air from the jar. BESSER VACUUM BESSER VACUUM These transparent and dishwasher-safe vacuum containers for food are particularly suitable for liquid and indicated for preservation of fresh and/ We recommend the exclusive use of embossed bags to guarantee the We sealing of the vacuum correct operation of the machine and the effective bag. Designed to meet the needs of domestic market, our external suction Designed to meet the needs of domestic market, our ease of use and packaging machines are characterized by compactness, meats, ABS line is particularly suitable for sliced The professional vacuum. pack liquid products. cheese and solid vegetables. Do not use it to vacuum BESSER VACUUM BESSER VACUUM compactness, ease of use and professional vacuum. Made in stainless compactness, ease of use double sealing and sector vacuum gauge, steel, display in 5 languages, for sliced meats, cheese and vegetables. With they are particularly suitable bags and vacuum machines it is also possible to seal cooking Top the Inox liquid products in jars. BESSER VACUUM BESSER VACUUM of small and medium businesses in the food Designed to meet the needs characterized by these external suction packaging machines are industry,
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 196 CLIFTON CLIFTON • • ACCESSORIES: CLIFTON baths areanindispensablepieceofequipmentforallleadingchefsworldwide. environment, toproduceconsistentlyperfectresults.Idealforsousvideandotherlowtemperaturecooking,these For consistentcontrolledcooking,Cliftonwaterbathsallowschefstocookinaprecisetemperature CLIFTON SOUSVIDEBATH Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Bi FoldLidfor04-003-00009 Immersion Grid28ℓforUnstirredBaths:04-003-00010(XX) Digital UnstirredSousVide BathwithDrainTap Digital UnstirredSousVide BathwithDrainTap Digital UnstirredSousVide BathwithDrainTap 230V /50Hz1250W 28ℓ 53.7 x33.236.5cm 04-003-00008(XX) 230V /50Hz1000W 14ℓ 36.1 x33.229cm 04-003-00013 230V /50Hz1500W 28ℓ 33.2 x53.829cm 04-003-00009 : 04-003-00011(XX) CLIFTON • ACCESSORIES: CLIFTON CLIFTON Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Immersion Grid8ℓforUnstirredBaths:04-003-00016(XX) Digital UnstirredSousVide BathwithDrainTap Digital UnstirredSousVide BathwithDrainTap Digital UnstirredDuobathwithDrainTap 230V /50Hz1250W 14ℓ 53.7 x33.224cm 04-003-00012(XX) 230V /50Hz800W 8ℓ 33.2 x2729cm 04-003-00015 230V /50Hz1600W 2 x8ℓ 60 x3229cm 04-003-00014 197 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines , ,
04-003-00020 For 1000mℓ
15 x 24 x 38cm 50ℓ 230V / 50Hz / 1650-2100W Range: 0.1°C - 95°C Temp Precision: ±0.1°C Temp 04-002-00351 04-003-00024 13 x 26 x 34cm 230V / 50Hz / 2000W Range: 20°C - 95°C Temp Precision: ±0.1°C Temp 04-003-00019 For 500mℓ Thermo-Circulator without Probe Thermo-Circulator Vacook Stainless Steel Flask Clip Dimension Capacity Elec. Spec. Product Code Product Code Dimension Elec. Spec. Product Code Capacity BESSER VACUUM BESSER VACUUM Professional thermal circulator for sous vide cooking made in stainless steel (Aisi 304), metal touch screen, LCD display for cooking time display offset for water temperature control and precision core probe, integrated App that allows remote Wi-Fi control up to a maximum of 10 machines at the same time, program that allows you to work with several cooking phases and delayed start to optimize time and costs. at the same time, program that allows you to work with several cooking at the same time, program that allows you to work phases and delayed start to optimize time and costs. CLIFTON CLIFTON spray bottles to a water bath. The clip is used to attach BESSER VACUUM made in stainless Professional thermal circulator for sous vide cooking cooking time display steel (Aisi 304), metal touch screen, LCD display for core probe, integrated offset for water temperature control and precision of 10 machines App that allows remote Wi-Fi control up to a maximum
04-003-00018 27cm
04-003-00021 Baths For 8ℓ Water 04-003-00017(XX) 47cm 04-003-00294 220-240V / 50-60Hz / 620W 04-003-00022 Stirrer Case: 12.2 x 15.3 x 20cm Guard: 12.2 x 13.2 x 14.8cm 230V / 50Hz / 1250W Display / Resolution: Digital LED/ 0.1°C / Ambient + 5°C - 95°C Range: Temp. Duration: 1 minute - 99 hours Timer
Foam Gun Holder Accessory Partition Divider Portable Clip-On Digital Immersion Circulator Sous Vide Water Bath (Semi Professional) Water Sous Vide
Carrying Case for 04-003-00022: 04-003-00023(XX) Product Code Capacity Product Code Dimension Elec. Spec. Product Code Add. Info. Dimension Elec. Spec. Product Code Used to attach the clips for the spray bottles to be firmly placed in the bath Used to attach the clips for the spray bottles to be to ensure a constant temperature inside the bottles. CLIFTON CLIFTON CLIFTON CLIFTON divider allows the working area of the bath to be This short stainless steel the food into different sections for They separate divided for portion control. cooking. easy identification when ergonomic, and has a user-friendly and intuitive control panel (includes the reset option). LACOR This cooker is made of stainless steel. Its design is compact and ACCESSORIES: • precise temperature controlled environment, to produce consistently perfect precise temperature controlled environment, to produce results. CLIFTON CLIFTON and want portability Space saving clip on stirrer unit for chefs who travel a tank up to 56 litres. or have limited space kitchens. Designed to clip onto chefs to cook in a For consistent controlled cooking, Clifton stirrers allow
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 198 for restaurants,caterers,coffeeshops, andgourmetshops. ventilated gelato-icecreamstorageand displaycasespecificallydesigned quick dispensingandserving. The NemoxPro100istheonly countertop Store yourfreshicecream,gelato,and sorbetsattheidealtemperaturefor Pro 100 NEMOX roll-ups, raisebreadormakehomemadeyogurt. Dehydrate fruits,vegetables,nuts,meatforjerky, fruitpureefor EXCALIBUR to 25l. interactive App. Suitableforallheat-resistant containersabletocontainup system thatallowsyoutocontrolthecookingprocessremotelybyusingan sous videcooking,equippedwithanLCDtouchscreenandaBluetooth in stainlesssteel(Aisi304),designedforthosewhoarebeginnerswith New immersionthermalcirculatorforsousvidecookingentirelymade BESSER VACUUM Dimension Product Code Elec. Spec. Capacity Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code
Table Top GelatoIceCreamStorage&DisplayCase4Magic 9 Tray Dehydratorwith26HrTimer Thermo-Circulator 230V /50Hz270W 4 x2.5ℓMagicPro 100 98 x50.536cm 04-003-00044 230V /50Hz600W 10 Trays 43.2 x48.331.8cm 04-003-00030 Temp Precision:±0.1°C Temp Range:0.1°C-95°C 230V /50Hz1100W 20ℓ 11.5 x935.5cm 04-002-00352
phases anddelayedstarttooptimizetimecosts. at thesametime,programthatallowsyoutoworkwithseveralcooking App thatallowsremoteWi-Ficontroluptoamaximumof10machines offset forwatertemperaturecontrolandprecisioncoreprobe,integrated steel (Aisi304),metaltouchscreen,LCDdisplayforcookingtime Professional thermalcirculatorforsousvidecookingmadeinstainless LACOR worry-free operation. ideal temperatureforoptimumdehydration,whilethedigitaltimeprovides just halfthetraysforsmallerbatches. The digitalthermostatmaintainsthe energy efficiencyallowingyoutheoptiontodehydratewithall9traysor dehydrate raw, whole-livingfoods. The quietdualfantechnologyprovides built withtechnologicallyadvancedsystemstoelegantlyandeasily SEDONA Elec. Spec. Colour Product Code Elec. Spec. Dimension Product Code Sous Vide Stick(SemiProfessional) 9 Tray DehydratorP9000
220-240V /50Hz800W 04-003-00293 230V /50Hz650W 43 x3750cm 04-003-00031 White 04-003-00288
Black , 199 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-003-00036 46.5 x 48 x 39.5cm 5kg / 7ℓ 70rpm 230V / 50Hz / 650W 5K 04-003-00035(XX) 58 x 53 x 45cm 7kg / 10ℓ 55-115rpm 230V / 50Hz / 800W 6K 04-003-00046 20.5 x 33 x 49.5cm 150mℓ 300mℓ / Ingredient Vol: Cup Vol: 230V / 50Hz / 600W Table Top Gelato Ice Cream Maker with Gravity Drain Gelato Ice Cream Maker with Top Table Table Top Professional Multifunction Machine Frix Air Professional Multifunction Machine Frix Top Table Product Code Dimension Max Production/Hr & Volume Weight Reduction Speed Elec. Spec. Model Ref. NEMOX and convenient, it grants the highest quality in Functional, powerful, fast preparation. Equipped with drain system for gelato/ice cream and sorbet easy cleaning. Product Code Dimension Capacity Elec. Spec. NEMOX FRIXAIR is easy and fun to use; it enhances the capabilities and fantasies With FRIXAIR you can offer an imaginative of the professional user. and with a and diverse menu to tease your customer’s palate every day, minimal effort. FRIXAIR speeds preparation of appetizers, entrées, main courses, and desserts. FRIXAIR is ideal for making mousse, sorbets, ice cream, sauces and soups, cocktails and hors d’oeuvres. 04-003-00034(XX) 45 x 59.5 x 105cm 10kg / 14ℓ 60-130rpm 230V / 50Hz / 1100W 10K 04-003-00043(XX) x 106cm 82 x 114 5 x 2.5ℓ 230V / 50Hz / 300W
Gelato Cart with Storage Case 5 Magic Pro 125 Gelato Cart Equipped with Automatic Storage, Stainless Steel Automatic Storage, Stainless Gelato Cart Equipped with Capacity Elec. Spec. Product Code Dimension Model Ref. Dimension & Volume Max Production/Hr Weight Reduction Speed Elec. Spec. Product Code temperature. of 3,0 L (3.3 qt) each. It is an ideal display for your production of gelato, of 3,0 L A ice-cream and sorbet, and is protected by a transparent oval cover. long electrical wire allows to move the cart. When disconnected from the outlet, gelato can be maintained for 15-30 min. depending from the room NEMOX The refrigerated cart is equipped with temperature control and holds 5 pans other tasks. – 4 Specific storage programs selectable depending on the different needs selectable depending on the different needs – 4 Specific storage programs and characteristics of the product. best results, make the These automatic programs, as well as ensuring the free to focus on machine completely autonomous, leaving the operator The machine is equipped with sophisticated software that manages its The machine is equipped normal manual function, the operator has at his functions. In addition to the disposal: (Gelato Classico – Semi-Soft Ice Cream – 4 Specific production programs – Granita – Shock freezing). NEMOX 10K Crea Case and Mixing Paddle
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 200 ROLLER GRILL Elec. Spec. Capacity Dimension Product Code ROLLER GRILL simply pressingapushbuttonbehindthestainlesssteelhousing. the stainlesssteelfryer. After identifyingthecauseofautomaticshutdown,safetythermostatmustberesetby thermostats areinstainlesssteel.Intheeventofoverheatingorinsufficientoil,safetythermostatautomaticallystops bulb-thermostat fortheregulationoftemperature(0-180°C)andwithadoublesafetythermostatpositivecutoff.Both consists ofanautomaticfilteringtheoilbysettlinganddecanting.Thiselectricfryerrangeisequippedwithaprecise oil atthebottomoftankandaboveresistancehasadifferential100°C. The coldzoneenablesyoutofrysuccessivelyinthesameoilforFrenchfries,fish,donuts,etc. ROLLER GRILLDEEPFRYER ROLLER GRILL • ACCESSORIES: ROLLER GRILL Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code 4ℓ BasketforRF3S,FD50&FD50D:04-003-00074 Single DeepFryerwithStainlessSteel Tap MF120R Single DeepFryerwithTap FD80R Single DeepFryerFD80 Single DeepFryerFD50 380V /36400W 12ℓ 35 x4735cm 04-003-00284 230V /50Hz3600W 8ℓ 15kg/h 30.5 x4536cmBasket:222610cm 04-003-00070 230V /50Hz3600W 8ℓ 15kg/h 28 x42.532cmBasket:222610cm 04-003-00069 230V /50Hz3200W 5ℓ 10kg/h 21.5 x42.532cmBasket:142610cm 04-003-00073 ROLLER GRILL Elec. Spec. Capacity Dimension Product Code ROLLER GRILL ROLLER GRILL • ACCESSORIES: ROLLER GRILL Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code 4ℓ BasketforRF3S,FD50&FD50D:04-003-00074 Double DeepFryerwithStainlessSteel Tap MF120DR Modular DoubleDeepFryerwithTap RFE8D Double DeepFryerFD80D Double DeepFryerFD50D This coldzoneatthebottomoffryer 380V /32x6400W 2 x12ℓ 72 x4735cm 04-003-00283 2 x(230V/50Hz3000W) 2 x8ℓ 40 x6046.5cmBasket:12.83214.5cm 04-003-00057 2 x(230V/50Hz3600W) 2 x8ℓ30kg/h 54 x42.532cmBasket:2(222610cm) 04-003-00062 2 x(230V/50Hz3200W) 2 x5ℓ20kg/h 39 x42.532cmBasket:2(142610cm) 04-003-00064 The temperatureofthe 201 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 04-003-00048 30 x 56.6 x 36.3cm Up to 7ℓ 220-240V / 50Hz / 3000W 04-003-00051/00048 04-003-00061 56 x 59 x 37cm 2 x 12ℓ 2 x (230 / 50Hz / 2800W) 04-003-00063 44.5 x 56 x 37cm 2 x 8ℓ 2 x (230 / 50Hz / 2800W) Double Deep Fryer Double Deep Fryer 04-003-00051 28 x 52 x 35cm Up to 6ℓ 220-240V / 50Hz / 3000W Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. PRO EQUIP PRO EQUIP PRO EQUIP PRO EQUIP 04-003-00050 04-003-00049 28.5 x 44.5 x 32cm Up to 5ℓ 220-240V / 50Hz / 3000W 04-003-00049
44.5 x 27.5 x 37cm 5ℓ 230 / 50Hz / 2800W 04-003-00075 04-003-00067 55.5 x 29 x 37cm 12ℓ 230V / 50Hz / 2800W 04-003-00072 44.5 x 28 x 37cm 8ℓ 230 / 50Hz / 2800W 04-003-00050 19.5 x 34.5 x 35cm Up to 3ℓ 220-240V / 50Hz / 3000W Single Deep Fryer Single Deep Fryer Single Deep Fryer Stainless Steel Deep Fryer Fry Basket for 04-003-00067: 04-003-00068 Capacity Elec. Spec. Product Code Dimension Dimension Capacity Elec. Spec. Product Code Capacity Elec. Spec. Product Code Dimension Dimension Capacity Elec. Spec. Product Code PRO EQUIP PRO EQUIP ACCESSORIES: • PRO EQUIP PRO EQUIP PRO EQUIP PRO EQUIP Built with full stainless steel body and thermal pipe, these deep fryers can give you perfect and fast fried food. They come with adjustable temperature control. They come you perfect and fast fried food. body and thermal pipe, these deep fryers can give Built with full stainless steel Safe and easy to maintain. CROWN
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 202 PRO EQUIP energy conservationduringlowvolumeperiods Ultra fast4minuteheatup.Conveyorspeedcontrol.Standbyfunctionfor WARING (1050°C). Doubleinsulationofthedoorwithtempered-glasswindow Independent cookingchambersforØ41cmpizzas.Infraredquartztubes ROLLER GRILL cooking preference.Comeswith6eggbaskets allows yourcustomerstoboiltheirowneggsforbreakfastaccording Essential foryourbreakfastbuffets,thisGastronormeggsboilerGN1/3 ROLLER GRILL Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Dimension Product Code Elec. Spec. Capacity Dimension Product Code Heavy-Duty CommercialConveyorToaster CTS1000E Conveyor Toaster Double PizzaOvenPZ430D Electric EggBoilerC060 230V /50Hz2300W 500 slices/hr 53 x36.541cm 04-003-00126 380V /50Hz6000WSinglePhase Internal Dimension:2x(4311 x43cm) 67 x5850cm 04-003-00077 43 x21.525.5cm 04-003-00076 230V /50Hz2700W 1000toasts/h 5cmopening 43 x4741.5cm 04-003-00124
. .
. (1550W top,1450wbottom)withprotectiongrid.Comesadeported no pre-heatingrequired.Heatingpower(halforfull).8infraredquartztubes Non-stop toastsfrombreadsandbunstowaffles,bagelsmuffinswith ROLLER GRILL (1050°C). Doubleinsulationofthedoorwithtempered-glasswindow Independent cookingchambersforØ41cmpizzas.Infraredquartztubes ROLLER GRILL preheating. 8quartztubes(1200Wtop,1450Wbottom) everything, waffles,bagelstomuffinsandevenfrombreadbunswithno Ideal forbreakfastbuffet,thisheavydutyversatileconveyortoastertoasts ROLLER GRILL control boxwitha1mcordforinstallationflexibility. Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Time Dimension Product Code Electric ConveyorToaster CT3000 Single PizzaOvenPZ430S Electric ConveyorToaster CT540B 230V /50Hz3000W Internal Dimension:43x11 x43cm 67 x5827cm 04-003-00079 230V /50Hz2650W 300-540 toasts/h Height: 8.5cm Cooking Area: 33x33.5cm 68 x5034.5cm 04-003-00125 230V /50Hz3000W 1min 30s Height: 7.9/11cm Cooking Area: 37x30cm 72 x4738.5cm 04-003-00083
. . 203 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-003-00131 TS3270 64 x 38 x 47.5cm Grill: 2 x (52 x 32cm) 2 levels 380V / 50Hz / 4000W . 04-003-00131
04-003-00130 TS1270 64 x 38 x 33cm Grill: 52 x 32cm 1 level 230V / 50Hz / 2700W 04-003-00105(XX) 80 x 64 x 59cm Area: 74 x 37.5cm Cooking 380V / 50Hz / 4500W 04-003-00103 80 x 64 x 59cm 70 x 37.5cm Area: Cooking 380V / 50Hz / 4500W Electric Quartz Movable Salamanders SEM800Q Electric Quartz Toaster Electric Glass Ceramic Movable Salamander with Plate Electric Glass Ceramic Movable 04-003-00130 Product Code Dimension Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Elec. Spec. (1050°C). Tray is fitted with handles for fast service Tray (1050°C). ROLLER GRILL ROLLER GRILL which minimise smoke Clean efficient quartz tubes with infrared elements up time saves on and odours, the speed of cooking and the rapid heat energy consumption without compromising on performance. ROLLER GRILL defrost, brown, glaze, grill, or toast To GN 1/1 size salamander toasters. in quantity your quiche, sandwiches with cheese, pizza, toasts with no preheating, smoke or odours thanks to the rays of infrared quartz tubes ROLLER GRILL ROLLER GRILL Detection System SEM800PDS powerful performance at the heart of your The SEM800-PDS puts versatile finishing, precise height adjustment system kitchen. Ideal for grilling and quality results on time every time. allows right heat to food giving -
. 2 areas 300 toasts/h 2 levels 230V / 50Hz / 2000W 04-003-00102 45 x 28.5 x 42cm Grill: 35 x 24cm
150 toasts/h 1 level 230V / 50Hz / 3000W 04-003-00101 45 x 28.5 x 30.5cm Grill: 35 x 24cm 04-003-00107 60 x 59 x 59cm Area: 49.5 x 37.5cm Cooking 230V / 50Hz / 3000W 04-003-00106 60 x 64 x 59cm 49.5 x 37.5cm Area: Cooking 230V / 50Hz / 3000W
Electric Toaster / Salamander Electric Toaster Electric Quartz Movable Salamanders SEM600Q Electric Glass Ceramic Movable Salamander with Plate Electric Glass Ceramic Movable Dimension Capacity Elec. Spec. Product Code Elec. Spec. Product Code Dimension Dimension Elec. Spec. Product Code an easy cleaning. toaster with 1 or 2 levels cooks or reheats all kinds of cheese sandwiches, pizzas, quiches, cheese/meat puffs, croissants. It even croque-monsieur, browns onion soups, toasts baguettes and bread etc. Instantly cooking at core with no smoke or odour thanks to the rays of the infrared quartz tubes (1050°C) Fast temperature rise in less than 30s. Removable back panel for ROLLER GRILL ROLLER GRILL Basic equipment for cafes, pubs and snack bars, the infrared quartz ROLLER GRILL ROLLER GRILL very quickly Infrared quartz tubes (1050°C) to grill and glaze plates with 4 lamps each. tem: The most precise regulation today for vitro-ceramic version. Precise The most precise regulation today for vitro-ceramic tem: and energy control. and various cooking. Flexibility As soon as the PDS (Plate Detection System) function is selectedhe As soon as the PDS (Plate heats up when the plate is in contact with vitro-ceramic plate automatically Automatic goes off when the tray is removed. the bar above the grid, and cooking and energy saving. Power control sys switch on, instantaneous ROLLER GRILL ROLLER GRILL Detection System SEM600PDS
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 204 Cook. EasyDefrost.More/LessSetting.SlowCookKey. ChildLock. Space-saving Design.3 Auto MenuKeys.2ReheatInstant Express DefrostKeywith3Menus.Wide272mm Turntable. Compactand SHARP Stainless Steel4-SlotsToaster cooking. CeramicInsideTMprotectsfrom scratchesanddiscolouration. Quick Defrostforfastthawingofmeat. Auto Cookprogrammeforeasy SAMSUNG on bothsides,forperfectresultseverytime. toast justonesidewhilewarmingtheother, orthe"bread"settingtotoast frozen waffles! Attheflipofaswitch,youcanselect"bagel"settingto toaster quicklyandeasilytoastsbreads,bagels, Texas toast,andeven The powerful,versatileWaring WCT850heavyduty4slotcommercial WARING Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Colour Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Stainless SteelTouch ControlMicrowaveOven Heavy-Duty 4-SlotsCombinationToaster WCT850K Solo MicrowaveOven 230-240V /50Hz800W 22ℓ 46 x3827.5cm 04-003-00100 230V /50Hz2300W 34 x2325cm 04-002-00354 230V /50Hz800W 23ℓ 48.9 x37.427.5cm 04-003-00098 230V /50-60Hz2800W Slot Width:5x1.2cm 22.8 x3033cm 04-003-00127 Black
Menu Keys.EasyDefrost.SlowCookKey. ChildLock. Alarm Function. Express DefrostKeywith3Menus.6MicrowavePowerLevels.2Reheat SHARP browning effects. Sensor maintainsoptimalhumidity. WideGrillenhancedgrillingand SLIM FRY™ techniqueforHealthierCrispycooking.SmartMoisture SAMSUNG Stainless Steel6-SlotsToaster racks areperfectforbagels,slicedbreadandmore levels foreachsetofslices.Fourextra-wideslotsandself-centeringbread 4-Slot Toaster. Electronicbrowningcontrolsletyousetseparate Toast upto225slicesperhourwiththeWaring® WCT708Medium-Duty WARING Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Stainless SteelTouch ControlMicrowaveOven 4-Slots Toaster WCT708E Stainless SteelWide GrillMicrowave Oven 230-240V /50Hz1100W 33ℓ 52 x44.731cm 04-003-00099 900W 32ℓ 52.3 x30.950.6cm 04-003-00097 46 x2925cm 04-002-00355 230V /50Hz1800W 225 toasts/h Slot Width:4.3cm 60 x4610cm 04-003-00128 230V /50Hz3000W
205 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines . Push button
04-003-00095(XX) MRC22S2 46 x 48.9 x 64.8cm 28ℓ 230V / 50Hz / 2200W 04-003-00114 79.5 x 72 x 60cm 04-003-00116 55 x 55 x 35.5cm Internal: 41.5 x 35 x 26.5cm 38ℓ / 4 levels 230V / 50Hz / 2400W Turbo Quartz Baking Oven with Steam FC110EG Turbo Stainless Steel Electric Convection Oven FC380TQ Commercial Microwave Oven MRC22S2 Commercial Microwave Oven . Product Code Dimension Capacity Elec. Spec. Product Code Dimension Product Code Dimension Capacity Elec. Spec. MENUMASTER distribution. Fast even cooking. Consistent Unique top and bottom energy Sealed in place ceramic cooking shelf. quality. results and excellent food Easy to clean. floor. No spills leak under the oven ROLLER GRILL ROLLER GRILL The Roller Grill FC110EG Technology. Perfect Baking through Controlled features a heavy duty turbine with auto reverse function. gratinating and The integral Quartz/infrared grill is perfect for browining circulated air grilling of meats etc whilst still benefiting from the quantity of water stream injection( requires water supply) applies a pre-set at high temperature enhancing the baking experience. defrosting ROLLER GRILL ROLLER GRILL Homogenous cooking ensuring Supplied with 3 cooking grids, 1 pastry tray. Associates convection, Reinforced insulation. a perfect circulation of air. ventilated bakery oven and Quartz, top quartz grill salamander, Turbo - , with more 04-003-00094 DEC18E2 34.3 x 41.9 x 54.9cm 17ℓ 230V / 50Hz / 1800W #266
Internal: 47 x 37 x 35cm 60ℓ / 4 levels 230V / 50Hz / 3000W 04-003-00115 59.5 x 61 x 59cm 04-003-00096(XX) RCS511TS 35.2 x 55.9 x 48.3cm 34ℓ 230V / 50Hz / 1100W 04-003-00093 DEC14E2 34.3 x 41.9 x 54.9cm 17ℓ 230V / 50Hz / 1400W #203 Multifunction Turbo Quartz Convection Oven Multifunction Turbo Commercial Microwave Oven RCS511TS Commercial Microwave Oven Commercial Microwave Oven
Elec. Spec. Dimension Capacity Product Code Dimension Capacity Elec. Spec. Product Code Elec. Spec. Add. Info. Product Code Dimension Capacity - Turbo Quartz : traditional oven associating top quartz and bottom ar Turbo - moured heating element to the ventilation system. Cooking time is reduced - Quartz grill : ventilated salamander essential to brown, broil or glaze. - Ventilated air : for homogeneous cooking of different meals at the same - Ventilated time pastry oven.The lower armoured heating element is running at - Ventilated full power. ROLLER GRILL ROLLER GRILL Unique in catering, the multifunction oven FC60TQ associates : MENUMASTER inside and Quick heating. Consistent results. Stainless steel construction environment. out. Durable, professional finish. Withstands the foodservice Faster cooking, steaming and re-therming. Excellent food quality Faster cooking, steaming required. throughput. No vent hood No costly hood. Economical installation, saves money. MENUMASTER
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 206 quick. 0.6 cu.ft.Nonstickcoatingcoverstheinteriortomakecleaningeasyand 260 °Ctemperaturerange.Precisetoastshadedial,tintedglassovendoor Stainless steelandindustrialstyledesignwith1500wattscapability, and CUISINART Roast DuckOven(Gas) Roast PigFurnace Elec. Spec. Capacity Dimension Product Code Dimension Product Code Dimension Product Code Convection Oven 220-240V /50Hz1500W 17ℓ 44 x2925cm 04-003-00303 110 x6060cm 04-003-00092(XX) Ø60 x125cm 04-003-00091(XX) , a perfectcirculationofair. Reinforcedinsulation Supplied with2cookinggrids,1pastrytray. Homogenouscookingensuring ROLLER GRILL provide evencooking. the slowburningofoaksawdustandthengetscooledinsmokeovento without dryingouttheproductorturningitcrispy. Smokeisproducedby Smoking iscarriedoutatlowtemperaturetoeliminateexcesswater ROLLER GRILL reduced by20%. hot airinside;comparedwithconventionalovensenergyconsumptionis less ofaconventionalovenanditshighefficiencyinthemovement Allows youtosavetimeandenergy, becausetheheatedvolume ismuch LACOR Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Electric ConventionHalogenGlassOven Stainless SteelElectricConvectionOvenFC280 Smoking OvenFM2 230V /50Hz1500W 28ℓ /2levels Internal: 32x32.526.5cm 46 x5535cm 04-003-00118 230V /50Hz250W Cooking Grid:40x60cm 71.5 x41.523cm 04-003-00087 230V /50Hz1400W 12ℓ 41 x3331cm 04-003-00119(XX)
. , 207 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines - -
. Gas 6400W 04-003-00144(XX) CDG400
Electric 380V / 50Hz / 7200W 86 x 50 x 24cm Crepe Surface: Ø40cm 04-003-00143(XX) CDE400 04-003-00140 43 x 44.5 x 23cm Crepe Surface: Ø40cm 230V / 50Hz / 2700W 04-003-00146(XX) 86 x 50 x 24cm Crepe Surface: Ø40cm 3600W 04-003-00139 Ø40 x 20cm 230V / 50Hz / 3600W Electric Double Crepe Machine Enamelled Plates Mobile Gas Single Crepe Machine with Enamelled Cast Mobile Electric Crepe Machine with Enamelled Cast Iron Crepe Machine with Enamelled Mobile Electric Single Crepe Machine Type Elec. Spec. Dimension Product Code Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. ROLLER GRILL ROLLER GRILL platform for The sturdy clean design gives the perfect front of house menu items, crepes, pancakes, chapatti, blini etc. but also for other enamelled cast iron plates give The hard griddled eggs for example. cooking surface good heat retention and provide a smooth, hard wearing requiring minimal oil and no pre-seasoning. PRO EQUIP PRO EQUIP ROLLER GRILL ROLLER GRILL Iron Plate CFG400 The simple design of the 400CFG gives you greater mobility without sacri fising performance. Specially designed with 8 point star shaped burners to The hard the perfect crepe. essential when making distribute heat evenly, enamelled cast iron plates make delicious, moist, golden pancakes but also chapatti, blini etc. ROLLER GRILL ROLLER GRILL Plate CFE400 High power output for outdoor use. Enam High capacity crepe machines. spiral heating element Delivered with spealer. elled cast-iron plate 400 mm. iron plate, thermostat 0 to 300°C, pilot light integrated under the cast - -
. .
42 x 40 x 13.5cm Crepe Surface: Ø40cm 230V / 50Hz / 2700W 04-003-00141 04-003-00145(XX) 45 x 50 x 24cm Crepe Surface: Ø40cm 3200W 04-003-00142 50 x 45 x 24cm Crepe Surface: Ø40cm 230V / 50Hz / 3600W 04-003-00138 50 x 45 x 24cm Crepe Surface: Ø35cm 230V / 50Hz / 3000W Gas Crepe Machine with Enamelled Cast Iron Plate Electric Crepe Machine with Enamelled Cast Iron Plate Electric Crepe Machine with Enamelled Cast Iron Plate Electric Crepe Machine with Enamelled Cast Iron Plate Machine with Enamelled Electric Crepe Mobile Single Crepe Machine Elec. Spec. Product Code Dimension Dimension Elec. Spec. Product Code Elec. Spec. Product Code Dimension Dimension Elec. Spec. Product Code PRO EQUIP PRO EQUIP 8 point star shaped burner positioned directly under the plate to distribute essential when making the perfect crepe. the heat evenly, ROLLER GRILL ROLLER GRILL CSG400 The key to the great performance of the 400CSG is the specially designed Enamelled cast iron plate produces moist pancakes, buckwheat cakes Enamelled cast iron plate produces moist pancakes, Asian cuisine for preparing Peking duck skins. Also popular in and more. Spiral heating ele Drawer for keeping dishes or pre-cooked crepes warm. essential when it comes to making the perfect ments distribute heat evenly, pancake. Includes wooden crepe spreader ROLLER GRILL ROLLER GRILL CSE400 ments distribute heat evenly, essential when it comes to making the perfect essential when it comes to making the ments distribute heat evenly, crepe spreader pancake. Includes wooden CSE350 produces moist pancakes, buckwheat cakes Enamelled cast iron plate for preparing Peking duck skins. Asian cuisine in Also popular and more. or pre-cooked crepes warm. Spiral heating ele Drawer for keeping dishes ROLLER GRILL ROLLER GRILL
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 208 the inside sausages separatefromtheuncooked.3padstoastbaguetteorbunon Store upto40sausagesinthe2-sectionbasketkeepingcooked ROLLER GRILL wooden T spreader, 1greasingpad. A musttoolkitforallRollerGrillcrepemodels.Contains2spatulas, ROLLER GRILL or home-madebatter. Delivered withfork mm) RollerGrillwaffleironsaccept deep-frozen, frozenprecookedwaffles batter. removable driptraysurroundingthebottomplatewillcollectanyexcess waffles in2.5minutes.Suitableforcookingfreshorfrozenwaffles. Highly conduciveironplatesspreadheatevenlyandgivegolden,crispy ROLLER GRILL plated rollsensureeasycleaninganddurability. Lengthoftherolls:40cm dogs perhour!Optimaloutputthanksto125Wpowerroll.Chrome- These rollergrillskeepupto20pre-cookedsausageswarm,i.e.96hot ROLLER GRILL Elec. Spec. Dimension Product Code Product Code Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code
2 McCainversionLiègemoulds,featuring 4x6squares(1518 .
Electric HotDogMachineCS3E Crepe Kit Double Waffle Iron Electric SausageRollerRG9 04-003-00154(XX) 230V /50Hz3200W 10 x172.2cm Waffle Size: 55 x4423cm 04-003-00148(XX) 230V /50Hz650W Glass Cylinder:Ø20x24cm 44 x3040cm 04-003-00132 230V /50Hz1100W 9 Rolls 54.5 x4624cm 04-003-00136
.
230V /50Hz3200W 10 x182.6cm Waffle Size: 55 x4423cm 04-003-00149 Basket forCS3E 04-003-00133
A
. plated rollsensureeasycleaninganddurability. Lengthoftherolls:40cm dogs perhour!Optimaloutputthanksto125Wpowerroll.Chrome- These rollergrillskeepupto20pre-cookedsausageswarm,i.e.96hot ROLLER GRILL Delivered withfork irons acceptdeep-frozen,frozenprecookedwafflesorhome-madebatter Brussels mouldsfeaturing3x5squares(2025mm)RollerGrillwaffle ROLLER GRILL Place belowsausagerollergrilltosavespace moved andtheGN2/3sizeinnercontainercanbewashedinadishwasher Keeps bunswarmtomakehotandsoftdogs. The drawercanbere ROLLER GRILL made batter. Deliveredwithfork. Grill waffleironsacceptdeep-frozen, frozenprecookedwafflesorhome- McCain versionLiègemoulds,featuring 4x6squares(1518mm)Roller ROLLER GRILL Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Dimension Product Code Electric SausageRollerRG7 Single Waffle IronGES10 Electric SausageBunWarmer CB20 Single Waffle IronGES20 . 230V /50Hz900W 7 Rolls 54.5 x3224cm 04-003-00135 230V /50Hz1600W Waffle Size:10x172.2cm 30.5 x4423cm 04-003-00147 230V /50Hz700W 54.5 x4622cm 04-003-00134 230V /50Hz1600W Waffle Size:10x182.6cm 30.5 x4423cm 04-003-00150
. - . . . 209 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines - - The aring®
04-003-00162(XX) 100 x 60 x 82.5cm 230V / 50Hz / 40W 04-003-00157 50 waffles/h 230V / 50Hz / 1400W 04-003-00153 30.5 x 44 x 23cm Size: Ø18.5cm x 2.6cm Waffle 230V / 50Hz / 1600W Waffle Wheeled Cupboard Waffle Single Waffle Iron Round Mould GES75 Iron Single Waffle Heavy-Duty Double Belgian Waffle Maker WW200E Heavy-Duty Double Belgian Waffle Product Code Dimension Elec. Spec. Product Code Capacity Elec. Spec. Product Code Dimension Elec. Spec. Wheeled and stainless steel carts for take-away concepts. The cabinet Wheeled and stainless steel carts for take-away concepts. base has large storage areas with a stainless steel adjustable shelf and it can be locked through a key lock on the sliding doors. Stainless steel cabinet, intermediate shelf, glass sneeze guard, a stainless steel plate, an illuminated display sign is customizable upon request. Switch, 2 sockets for connecting devices, 2 sliding doors with integrated handles and key lock. Cabinet mounted on 4 wheels, 2 with brake system. Delivered with no appliance. WARING WARING with the W Make your breakfast service an experience to remember Its space-saving vertical design Maker. WW200 Double Belgian Waffle to 50 thick, delicious waf cooks two waffles at a time, so you can make up die-cast housing, Triple-coated nonstick surfaces, heavy-duty, fles per hour. even results and embedded heating elements and a rotary feature ensure quick cleanup. ROLLER GRILL ROLLER GRILL ROLLER GRILL produces circular waffles as an attractive alterna Iron The GES75 Waffle each a The cast iron plate features 4 grids tive to the traditional rectangle. dia, 25mm thick, made up of 10mm squares. quarter of a circle 180mm 4 great tasting waffles in just a couple of minutes. GES75 will produce up to beneath both cooking plates giving rapid and The elements are seated cooking area. even heat across the whole -
100 x 60 x 82.5cm 230V / 50Hz / 40W 04-003-00161(XX) 04-003-00152 30.5 x 44 x 23cm 0.4cm Size: 25 x 25 x Waffle 230V / 50Hz / 1600W 04-003-00156 25 waffles/h 230V / 50Hz / 1200W Crepe Wheeled Cupboard Single Waffle Iron Grooved Mould GES40 Iron Single Waffle Heavy-Duty Single Belgian Waffle Maker WW180E Heavy-Duty Single Belgian Waffle Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. Capacity Elec. Spec. Product Code Cabinet base offers a large storage space for all the equipment needs. Lockable through a key lock and sliding doors with integrated handles. Glass sneeze guard. Illuminated display (85x60cm). Includes 2 sockets for connecting device. Cabinet mounted on 4 wheels, 2 with brake system. ROLLER GRILL ROLLER GRILL This wheeled and stainless steel concept cart can accommodate every kind holed space is meant for A of appliances to be placed on the work surface. Stainless Steel the Roller Grill built-in sauce or chocolate warmer WI/DP. Grooved mould comes with a wooden cone for making ice-cream cones Grooved mould comes with (squares 8 x 8 mm). ROLLER GRILL ROLLER GRILL fle is ready. Tripple-coated non-stick plates allow for easy removal of waffle Tripple-coated non-stick plates allow fle is ready. model saves counter and quick clean up. Small footprint of double waffle space! Makes 17.5cm Belgian-style waffles. WARING WARING Audio beep signals when waf Rotary feature for even baking and browing.
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 210 burgers, fish,paninisetc. provide aconstantevenheatmakingtheSAVOYE idealforcookingsteaks, moured heatingelementsforperfectheatdistribution. The castironplates food beingcrushedbytheweightoftopplateandisfittedwithar The fullyadjustablespringandcounterbalancedtopplatewillhelpprevent ROLLER GRILL sandwiches, hamburgers,steaksetc.andtoalternatecookingtypesbetweentheplates.2thermostats0-300°C.Deliveredwithascraperforeasycleaning. Particularly designedforfast-foodchains,franchisesandallplaceswithhighoutput,thecontact-grillsenableyoutoseizeinbigquantityeverykindof ROLLER GRILL cooking performance,flexibleoperationandeaseofcleaning. Roller Grill.Fullyequippedthroughdesignandtechnologyforoutstanding The latestinnovationinourcontactgrillrange,LePremiumisuniqueto PANINI-PREM Enamel-Coated CastIronHeatingPlatewithFullStainlessSteelHandle ROLLER GRILL Model Ref. Elec. Spec. Dimension Type Product Code Type Model Ref. Elec. Spec. Size Dimension Product Code Model Ref. Elec. Spec. Dimension Product Code Single ContactGrill Contact GrillwithGroovedOnTop Only Contact GrillforSandwichwithGroovedTop &Base, SAYORE-R 230V /50Hz2000W Cooking Surface:26x24cm 38.5 x3322cm Base w/ Grooved Top & 04-003-00167 Grooved on Top Only DOUBLE PANINI-L 2 x(230V/50Hz3200W) Double Cooking Surface:2x(3624cm) 83.5 x38.522cm 04-003-00163 PANINI-PREM 230V /3400W 40 x47.522cm 04-003-00285
SAYORE-L w/ Grooved Top only 04-003-00168 - Grooved on Top &Base PANINI-XLR 230V /50Hz3600W Single Cooking Surface:36x36cm 41 x6234cm 04-003-00165 the thicknessofsandwichtobecooked. upper-plates arecounter-balancedtoadapttheprofessionalcontract-grill glass-ceramic plates,oncethevitroceramiccontact-grillisclosed.Both grill contact. The frontoftheupperplatesavoidsshockbetween The leversystemallowsadailyusewithoutforcingthetopplateof The vitroceramiccontact-grillwasdesignedforcomfortofuseandsecurity: ROLLER GRILL savoury pancakes,articbread,blinis,wrap.Deliveredwithascraper food. Available withgroovedorflatbottomplateforomelettes,friedeggs, and thepressurespringisadjustablesoyoucanadaptcookingto cast-iron platesforperfectlyevencooking. The upperplateisself-balanced the wallplate.Fittedwithcastironplatesforperfectlyhighconductive Specially designedtocookPANINI. Featuring5brancharmscovering ROLLER GRILL Model Ref. Elec. Spec. Dimension Product Code Model Ref. Elec. Spec. Dimension Product Code
Glass CeramicSingleMulti-Grill Electric ContactGrillPANINI-R GVS335 13Amps 230V /2500W 39 x6026cm 04-003-00295 PANINI-R 230V /50Hz3000W Cooking surface:36x24cm 43 x38.522cm 04-003-00169 Grooved on Top Only PANINI-XLL Single 04-003-00166
GVD335 13Amps 230V /2x2500W 78 x6026cm 04-003-00296 . 211 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
Single 230V / 50Hz / 3200W PSR400G Gas Model 04-003-00183(XX) 04-003-00297 40 x 70 x 25cm Cooking Surface: 36.5 x 54.5cm 230-240V / 3500W / 15Amp Electric Steel Enamelled Griddle Plate Electric Steel Enamelled
Product Code Dimension Elec. Spec. ROLLER GRILL ROLLER GRILL duel zone electric griddle. Built around The PED700 is a high-performance plate, it provides a solid cooking platform for a 10mm thick steel cooking sausages, eggs etc. Unique 2 Zone heating. your griddle menu; burgers, With Decarbonised Plate 40 x 47.5 x 23cm Cooking Surface: 40 x 40cm Single 230V / 50Hz / 3000W PSR400E 04-003-00180 40 x 47.5 x 23cm Cooking Surface: 40 x 40cm Single 230V / 50Hz / 3000W PSR400EE 04-003-00182
. Built with a Incoloy heating element, for a homogenous temperature on the whole cooking . Built with a Incoloy heating element, for a homogenous 04-003-00173 Small 29.5 x 33 x 23cm Cooking Surface: 27 x 25cm 230V / 50Hz / 2000W
04-003-00176 With Cast Iron Plate 60 x 47.5 x 23cm Cooking surface: 60 x 40cm Double 380V / 50Hz / 6000W PSR600E Double 380V / 50Hz / 6000W PSR600EE 04-003-00175 60 x 47.5 x 23cm Cooking Surface: 60 x 40cm 04-003-00172 Large 38 x 41 x 23cm Cooking Surface: 30 x 38cm 230V / 50Hz / 2400W Electric Griddle Plate Electric Enamelled Steel Griddle Plate Size Elec. Spec. Model Ref. Product Code Add. Info. Dimension Model Ref. Dimension Size Elec. Spec. Product Code Elec. Spec. Product Code Type Dimension Specific steel griddle plate (10mm) to cook meat, bacon, fish, hamburgers, sausages, onions... and also for fried eggs and omelettes. Healthy and quick cooking Specific steel griddle plate (10mm) to cook meat, bacon, fish, hamburgers, sausages, onions... and element, for a homogenous temperature on the whole cooking surface. Built with a Incoloy heating with the mirror smooth plate for a direct temperature transfer. Removable drip tray. ROLLER GRILL ROLLER GRILL cooking with the mirror smooth plate for a direct temperature transfer cooking with the mirror smooth plate for a direct temperature surface. Removable drip tray. ROLLER GRILL ROLLER GRILL quick bacon, fish, hamburgers, sausages, onions... and also for fried eggs and omelettes. Healthy and Steel enamelled griddle plate (10mm) to cook meat, Panini Grill with Groove Top Only Panini Grill with Groove Top
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 212 With PowerfulInfra-RedBurners. High Temperature ResistantStainlessSteel.Rapid And EfficientGrilling RINNAI seconds) andhalvingtheoverallpowerthisgriddlecanbringrealsavings. efficient cookingtoyourkitchen.Bycuttingtheheatuptimes(230'Cin90 Built aroundourvitroceramicinfraredheatingsystemtobringenergy ROLLER GRILL included control-box isremovableandlavatrayenamelled.1pktofrock taste orsmell.Easytoclean:Lavarockscanbewashedindishwasher ing thefats. Alternate fish,meat,sausages,etc.withouttransmissionof embers, spreadingtheheatevenlyacrosscookingsurfaceandabsorb tasty andeasy-to-digestgrills.Lavarockreactsinthesamewayaswood 10 temperaturecontrolsettings.Electriclavarockgrillfornatural,healthy ROLLER GRILL Elec. Spec. Dimension Type Product Code Elec. Spec. Dimension Type Product Code Model Ref. Elec. Spec. Size Dimension Product Code Stainless SteelSingleInfraredGrill . Single GlassCeramicGriddle Electric GrillwithLavaRock 2500W 60.7 x2121.6cm LPG 04-003-00197(XX) 230V /50Hz1500W Cooking Surface:33x28cm 42 x15cm PS400VCL with FlatPlate 04-003-00184 140D 2500W) 2 x(230V/50Hz Double 59 x5030.5cm 04-003-00187(XX)
Town Gas 04-003-00196(XX) PS400VCR with GroovedPlate 04-003-00185 140 230V /50Hz2500W Single 30 x54.516cm 04-003-00188
, ,
- washable oiltray. Full stainlesssteelbody. Adjustable temperaturecontrol. Removable& CROWN PRO EQUIP PRO EQUIP washable oiltray. Full stainlesssteelbody. Adjustable temperaturecontrol.Removable& CROWN Elec. Spec. Dimension Product Code Temp. Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Dimension Product Code Elec. Spec. Stainless SteelBBQStove/GrillerSW200 Stainless SteelBBQStove/GrillerSW680 Electric GrillwithFlatCastIronTop Electric GriddlewithFlatSteelTop 230V /50Hz2500W Cooking Surface:55 x15cm 70 x2014cm 04-003-00192 Max temp300ºC Cooking Surface:38x38cm 45 x44.522cm 04-003-00186 380V /50Hz2800W Cooking Surface:60x40cm 60.5 x5226.5cm 04-003-00179 230V /50Hz2x1500W Cooking Surface:55x31cm 70 x3614cm 04-003-00191 230V /50Hz2800W
213 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
04-003-00202 58 x 66 x 69.5cm Spit Ht. 40cm For 15kg Meat 380V / 50Hz / 3600W GR40E
04-003-00201 58 x 66 x 87cm Spit Ht. 60cm For 25kg Meat 380V / 50Hz / 5800W GR60E
04-003-00200(XX) 58 x 66 x 104.5cm Spit Ht. 80cm For 40kg Meat 380V / 50Hz / 7200W GR80E Electric Gyros (Kebab) Grill Accessories available upon request Product Code Dimension Capacity Elec. Spec. Model Ref. ROLLER GRILL ROLLER GRILL with 3, 4 or 5 Incoloy heating elements with Electric models are equipped or full power and fire stones to accumulate the independent regulation, half fully hermetic: the motor is protected from any The bottom plate is heat. of meat. infiltration of fat or juice ACCESSORIES •
04-003-00203(XX) 58 x 66 x 64.5cm Spit Ht. 40cm For 15kg Meat Gas Gyros (Kebab) Grill Accessories available upon request Dimension Capacity Product Code • ACCESSORIES and independent controls with slow setting. LPG type. and independent controls ROLLER GRILL ROLLER GRILL 2 till 4 infrared burners with safety thermocouple Gas models are fitted with
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 214 High qualityinsulatedhandles.WithIndicatorlight. Brilliant polishedstainlesssteelfinishing. All-weldedconstruction.Rollededgesforaddedstrength.Non-dripheavydutytap.U.K.thermostatcontrolswitch. CROWN CCK base. boil protection.Stainlesssteelinnerpot.body Auto re-boilandkeepwarm.Removabletopcoverforeasycleaning.Dry MISTRAL Add. Info Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Model Ref. Elec. Spec. Capacity Product Code Stainless SteelWall MountElectricWater Boiler Stainless SteelElectricWater Urn Electric Thermal Airpot Electric Max. heatsetting110ºC 230V /50Hz2500W 40ℓ Ø32 x49.5cm 04-003-00217 230V /50Hz3000W 37.8ℓ 38 x2473cm 04-003-00215 MAP520 230V /50Hz750W 5ℓ 04-003-00222 22.7ℓ 34 x2155.5cm 04-003-00216 MAP380 3.8ℓ 04-003-00223 Max. heatsetting110ºC 230V /50Hz2500W 30ℓ Ø30 x49.5cm 04-003-00218 . 360°swivel Flame FailureSafetyDevice. Settings ForIndividual Tier. DigitalizedFunction.SelfDiagnosis Function. Various ModesForRice Cooking (Normal,Cereals,Porridge).Various RINNAI adjust thetemperatureofdrinks. water orteaalwaysatthedesiredtemperaturebyhavingpossibilityto events orinanycornerofyouroffice.Itisthebestoptiontoenjoycoffee, dimensions idealforcouplinginrestaurantswithbuffet,meetingrooms, Newly designedelectricdrinksdispenserwithtap Airpot Lacorwith LACOR Elec. Spec. Capacity Product Code Elec. Spec. Dimension Product Code Gas Automatic RiceCooker(3-Deck) Electric Airpot Max. heatsetting110ºC 230V /50Hz2500W 20ℓ Ø30 x43cm 04-003-00219 33700W 70 x72.7125cm 04-003-00237(XX) 220-240V /50-60Hz1500W 6ℓ 04-003-00286 Max. heatsetting110ºC 230V /50Hz2500W 10ℓ Ø25.5 x34.5cm 04-003-00220 10ℓ 04-003-00287 215 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines Ø46 x 42cm 9ℓ 230V / 50Hz / 100W SW9800-S 04-003-00233 Ø42 x 35cm 8ℓ 230V / 50Hz / 2300W SW8800-S 04-003-00236 04-003-00232 Ø37 x 32cm 4ℓ 25pax 23cups 230V / 50Hz / 1550W ER25A Ø35 x 46cm 8ℓ 220V / 50Hz / 100W S8000-S 04-003-00234 Ø39 x 35cm 6ℓ 230V / 50Hz / 1950W SW6800-S 04-004-00019 04-003-00231 Ø45 x 32cm 6ℓ 30pax 30 cups 230V / 50Hz / 1950W ER30A Stainless Steel Electric Rice Cooker / Warmer Stainless Steel Rice Warmer Dimension Capacity Elec. Spec. Model Ref. Product Code Dimension Capacity Elec. Spec. Model Ref. Product Code CROWN Automatic Non-stick inner pot. 2-in-1 rice cooker and rice warmer. keep-warm function. CROWN in wooden brown or stainless Available Automatic keep-warm function. steel finishing. 04-003-00230 Ø45 x 38cm 8ℓ 40pax 45cups 230V / 50Hz / 2300W ER40A 04-003-00229 Ø60 x 35cm 10ℓ 50pax 55cups 230V / 50Hz / 2600W ER50A 04-003-00227 Gas Town 04-003-00228 Ø50 x 29cm 12ℓ 70pax 230V / 50Hz / 3000W ER70A 04-004-00018 Ø35 x 46cm 8ℓ 220V / 50-60Hz / 92W 52.4 x 48 x 42cm 9ℓ 230V / 50Hz / 2300W 04-003-00226 LPG Non-Stick Electric Rice Cooker Wooden Design Rice Warmer S-8000 Wooden Design Rice Warmer Gas Rice Cooker RR50A Serving Size Elec. Spec. Model Ref. Product Code Dimension Capacity Elec. Spec. Product Code Dimension Capacity Capacity Elec. Spec. Product Code Type Dimension CROWN handles. control. Easy push-button operation. Durable insulated element. Full thermostatic control. Overheat safety Full bottom contact heating capacities to suit your cooking needs. in different Available to clean. Rice pot is washable & easy CROWN in wooden brown or stainless Available Automatic keep-warm function. steel finishing. CROWN gas. Town and for LP Available Rice pot is washable and easy to clean. Heat-resistance glass for burner protection.
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 216 digital timer;4mmthickvitroceramicglassplate. Two independentlycontrolled inductionzones;20pre-setdigitalcontrol; ROLLER GRILL safety fuse. 5 hourskeepwarm.Stainlesssteellidwithaluminium.Built-inthermal PANASONIC digital control;timer;4mmthick vitroceramicglassplate. Rated torunatfullpowerforup8hours withoutcuttingout.20pre-set ROLLER GRILL safety fuse. Auto shut-offfunction. 5 hourskeepwarm.Stainlesssteellidwithaluminium.Built-inthermal PANASONIC Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Size Elec. Spec. Dimension Product Code Rice Cooker Rice Cooker Double InductionCooker Digital InductionCooker 230-240V /2x3000W13Amps 40 x7019.5cm 04-003-00298 450W 3.6ℓ Int Ø32xExtØ38Ht33cm 04-003-00301 Single 230-240V /3000W 31.5 x3810.2cm 04-003-00279 220-240V /50Hz2500W 7.2ℓ Int Ø47xExtØ60Ht36cm 04-003-00300 Double 230-240V /2x3000W 59 x3810.2cm 04-003-00280 20 pre-setdigitalcontrol;timer; 4mmthickvitroceramicglassbowl. Fitted withasteelrimtobothsupport the panandprotectglass. ROLLER GRILL auto cookingfunction,removablepotforeasycleaning,temperedglasslid. Suitable forslowcooking,soup,porridge,dessert&stewing.Comeswith CORNELL safety fuse. Auto shut-offfunction. 5 hourskeepwarm.Stainlesssteellidwithaluminium.Built-inthermal PANASONIC vitro ceramicglassplate. a steelbaralongit’s front.20pre-setdigitalcontrol;timer;4mmthick At 4mmthicktheglassplatewillsupportupto20Kgandisprotectedwith ROLLER GRILL Elec. Spec. Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Dimension Product Code Slow CookerCSC150 Rice Cooker Digital InductionWokwithPan Digital ChocolateInductionCooker 230-240V /3000W 39 x4316.5cmWok Diameter:Ø30cm 04-003-00281 1400W 4.2ℓ Int Ø36xExtØ45Ht33cm 04-003-00299 230-240V /2500W 31.5 x3810.2cm 04-003-00278 230V /50Hz200W 1.5ℓ 23 x24cm 04-003-00246 217 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 04-003-00254 32.8 x 45 x 11cm 230V / 50Hz / 2800W 04-003-00289 39.5 x 33.8 x 11.7cm 220-240V / 50-60Hz / 3000W 04-003-00252 38.5 x 85.5 x 17.8 cm 230V / 50Hz / 2800W 04-003-00302 220-240V / 50Hz / 3000W Counter-Top Single Hob Digital Induction Stove Counter-Top Drop-In Single Hob Induction Stove Drop-In Single Hob Induction Induction Stove / Cooker with Pot Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. Product Code Elec. Spec. SAFICO PRO holding from 40 - Temperature level power setting. Glass touch control. 11 Safety lock. External RF sensor (optional). Timer. 220 c (5c / level). Induction Stove SAFICO PRO level power setting. 20 level temperature holding. Rotary power control. 16 MISTRAL MISTRAL Mistral Induction Cooker gives the maximum value out of its extremely useful features. Its amazing futuristic design is made out of only the finest material to ensure top grade quality. 04-003-00255 32.8 x 42.2 x 10.5 cm 230V / 50Hz / 2800W 04-003-00253 230V / 50Hz / 2800W 04-003-00250 Surface: 32 x 32cm 32 x 32 x 5.3cm Cooking 70-220ºC 230V / 50Hz / 1800W 230V / 50Hz / 1800W 04-003-00257 29 x 36 x 7cm Counter-Top Single Hob Induction Stove Counter-Top Counter-Top Single Hob Induction Wok Stove Counter-Top Drop-In Single Hob Digital Induction Stove Drop-In Single Hob Digital Wok for Induction Work #CW-28A: 01-001-01160 #CW-28A: for Induction Work Wok Dimension Elec. Spec. Product Code Product Code Elec. Spec. Temp. Elec. Spec. Product Code Dimension Dimension Elec. Spec. Product Code Rotary power control. 9 level power setting. 5 level temperature holding. SAFICO PRO ACCESSORIES: • SAFICO PRO Rotary power control. 16 level power setting. SAFICO PRO display or cooking. 9 heating power levels Suitable for built in buffet power settings. available or selection with Induction Stove with Touch Sensor Induction Stove with Touch
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 218 CROWN Easy removabletiers.Steamsfoodtoperfection.Safe&easymaintain. Stainless steelfinishing. Adjustabletemperaturecontrol.Indicatorlight. CROWN Aluminium SatayStove LACOR CROWN Product Code Add. Info. Dimension Product Code Add. Info. Product Code Elec. Spec. Capacity Dimension Product Code Dimension Add. Info. Dimension Product Code Burner withoutStand 2 RingCastIronBurner(LPG) A30 Electric 2-Tier SteamerSW80 High PressureCastIronBurner(LPG)2B 1 Ring Ø30cm 04-003-00267(XX) 2 Rings 04-003-00260 230V /50Hz3000W 20ℓ Ø45 x62cm 04-003-00244 65 x2014cm 04-003-00275 2 Rings Ø22cm 04-003-00262 Ø50cm 04-002-00268(XX) Ø70cm 04-002-00269(XX) CROWN Japanese Stove CROWN CCK CCK Add. Info. Dimension Product Code Dimension Product Code Dimension Product Code Dimension Product Code Add. Info. Product Code Metal Stove(ApolloStove)withBase Metal Stove(ApolloStove)withoutBase High PressureCastIronBurner(LPG)5B 4 RingCastIronBurner(LPG) A40 5 Rings Ø34cm 04-003-00261 30.5cm 04-003-00276 3 Rings 04-003-00259 32 x31cm 04-003-00265 30 x23cm 04-003-00263 30 x29cm 04-003-00266 26.5 x21.5cm 04-003-00264 219 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 04-003-00277 04-004-00007 47 x 37 x 27cm 26ℓ Max Heat Setting 110ºC 230V / 50W / 2000W (1/2+2x1/6) OR (1/2+1x1/3) size 24ℓ Max Heat Setting 80ºC 230V / 50W / 1500W GN 1/1 Size 04-004-00006 59 x 35 x 28cm 24ℓ 230V / 50W / 1200W GN 1/1 Size 04-004-00004 35.5 x 56.5 x 26cm Single Bain Marie Portable Gas Cooker ZA3 Electric 3-Compartment Sauce Warmer / Bain Marie Electric 3-Compartment Sauce Warmer Product Code Product Code Dimension Capacity Elec. Spec. Add. Info. Capacity Elec. Spec. Add. Info. Product Code Dimension Capacity Elec. Spec. Add. Info. Product Code Dimension IWATANI IWATANI container setting device. Safety joint. Automatic safety stop. Safety mechanism. Uses standard 8 oz butane Drip pan reversal prevention canister (Sold separately) CCK Stainless Steel Electric Bain Marie, Economy PRO EQUIP PRO EQUIP - - -
. 04-003-00272(XX) 79.5 x 64 x 91cm Inside Dimension: 60 x 54.5 x 68cm 8 Levels 230V / 50Hz / 1400W 04-004-00005 53 x 35 x 25cm 24ℓ 70ºC 230V / 50W / 1200W GN 1/1 Size 2 x 24ℓ Max Heat Setting 80ºC 230V / 50W / 3000W GN 2 x 1/1 Size 04-004-00002 67.6 x 56.5 x 26cm Proofing Cabinet EP800 Double Bain Marie Stainless Steel Electric Bain Marie Elec. Spec. Product Code Dimension Elec. Spec. Add. Info. Product Code Dimension Capacity Add. Info. Product Code Dimension Capacity Elec. Spec. Proofer to make the dough rise during 2 hours at 29°C. The steam produc rise during 2 hours at 29°C. Proofer to make the dough Electrovalves for humidifi in time and quantity. tion is automatically preset steel. Proofer mounted on 4 castors with brakes cation. Interior in stainless system. Grids not included ROLLER GRILL ROLLER GRILL Cooking technique suitable for melting delicate foods (chocolate), curdling traditional desserts (flan, pudding) or savory pastries (pate, fish cake), pre pare canning and making delicate sauces. In professional use, in addition, bath keeps hot prepared foods or sauces until serving time. LACOR PRO EQUIP PRO EQUIP
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 220 Electric SoupWarmer CCK CCK CCK Elec. Spec. Capacity Dimension Product Code Add. Info. Elec. Spec. Capacity Dimension Product Code Add. Info. Elec. Spec. Capacity Dimension Product Code Add. Info. Elec. Spec. Capacity Dimension Product Code Electric GN1/1SauceWarmer /BainMarie Electric 3-CompartmentSauceWarmer /BainMarie Electric 3-CompartmentSauceWarmer /BainMarie 230V /50W300W 5.7ℓ Ø26 x35cm 04-004-00022 GN 1/1Size 230V /50W2000W 24ℓ MaxHeatSetting110ºC 54 x3436cm 04-004-00010 GN 2x1/4+11/3Size 230V /50W2000W 25ℓ MaxHeatSetting110ºC 50 x2130cm 04-004-00008 GN 3x1/6Size 230V /50W2000W 40ℓ MaxHeatSetting110ºC 51 x2130cm 04-004-00012 CCK CCK Stainless SteelElectricSoupWarmer time withoutbain-mariefunction. This chocolateorsaucewarmercanheatup2pressurebottlesinthesame protective shellsandaremovabledisplayforpotofjam,honeyorspread. The doubleelectricwarmerWI/2isatable-topfittedwithblack ROLLER GRILL Elec. Spec. Capacity Dimension Product Code Add. Info. Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Add. Info. Electric 2-CompartmentSauceWarmer /BainMarie Electric 4-CompartmentSauceWarmer /BainMarie Electric DoubleFreeStandingWarm ItMachine 230V /50W2000W 25ℓ MaxHeatSetting110ºC 27 x22.532.3cm 04-004-00011 GN 1/2+1/3size 230V /50W800W 20ℓ MaxHeatSetting110ºC 47 x3634cm 04-004-00009 230V /50W300W 5.7ℓ Ø26 x35cm 04-004-00023 230V /50W340W 2 x1ℓ 31 x2125cm 04-004-00015(XX) GN 1x1/2OR21/4Size 221 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines 04-004-00039 32.5 x 17.6cm 40-100°C 230V / 50Hz / 200W For GN 1/3 04-004-00038 32.5 x 26.5cm 40-100°C 230V / 50Hz / 300W For GN 1/2 04-004-00036 48 x 40 x 7.5cm 40-90°C 230V / 50W / 450W 04-002-00345 47cm 220-240V / 50W / 1900-2250W 04-004-00031 38 x 18cm 230V / 50W / 2 x 100W 04-004-00037 53 x 32.5cm 40-100°C 230V / 50Hz / 450W For GN 1/1 Stainless Steel Electric Warming Plate Stainless Steel Electric Warming Glass Warmer with Stainless Frame for GN 1/1 Glass Warmer Stainless Steel Twin Coffee Warmer SW22 Coffee Stainless Steel Twin Double Hot Plate Product Code Dimension Temp Elec. Spec. Add. Info. Product Code Dimension Temp. Elec. Spec. Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. PRO EQUIP PRO EQUIP PRO EQUIP PRO EQUIP JUKI CROWN saving. Non-stick support plate. Safe & easy to High efficiency and energy only. maintain. Keep-warm function 04-004-00040 70.5 x 58 x 7.5cm 40-90°C 230V / 50W / 450W 04-002-00344 26cm 220-240V / 50W / 1250-1500W 04-004-00024 Ø42 x 38cm 10ℓ 230V / 50W / 450W 04-004-00035 55 x 35 x 4.5cm Up to 80°C 230V / 50W / 230W Glass Warmer with Stainless Frame for GN 2/1 with Stainless Frame for GN Glass Warmer Stainless Steel GN 1/1 Warming Plate with Ceramic Top Stainless Steel GN 1/1 Warming Single Hot Plate Product Code Dimension Temp. Elec. Spec. Elec. Spec. Product Code Dimension Temp. Product Code Dimension Elec. Spec. Capacity Elec. Spec. Product Code Dimension PRO EQUIP PRO EQUIP LACOR handles It has a thermostat adjustable in temperature , thermo-insulating plugs. on the sides for a better safe movement and non-slip JUKI Stainless Steel Electric Soup Warmer Stainless Steel Electric Soup
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 222 Daily outputisabout15kg Produces Icecubes.Makes12icecubes(10-15g)inapp.6-10minutes. NEMOX Towel Warmer Two DoorHot&ColdTowel Warmer HC-140 Elec. Spec. Temp. Dimension Product Code Capacity Dimension Product Code Capacity Dimension Product Code Ice CubeMakerTech 230V /50Hz150W Water Tank: 4.5ℓ Collecting Capacity:1.5kg(app.80icecubes) 36 x39.541.5cm 04-005-00001 For 70 Towels 45 x28.533cm 04-004-00044 For 140 TowelsFor 45 x3160cm 04-004-00042 . For 50 TowelsFor 42.5 x 28.5 x 27.5cm 04-004-00045
Two DoorTowel Warmer CN-140 supports whichcanbeeasilydisassembled. appliances iscompletelyinstainlesssteel AISI 304,asare thegratesand The electroniccontrolboardiseasytooperate. The construction ofthese setting. cycle areregulatedbytemperaturewiththeuseofacore-probeortime natural way. SOFT and HARDblast-chillingcyclesandshock-freezing Essential instrumentstograntthebestfoodpreservationinmost NEMOX Hot &ColdTowel Warmer HC-70 Elec. Spec. Capacity Dimension Product Code Capacity Dimension Product Code Capacity Dimension Product Code Shock FreezerFreezy 230V /50W218W 3 xG/N2/3 Trays 35ℓ 34 x36.426.7cm Internal Dimension: 59.5 x6138.5cm Freezy 5 04-005-00002(XX) 140 TowelsFor 45 x3160cm 04-004-00043 For 70 Towels 45 x28.533cm 04-004-00046
230V /50W600W 6 xG/N1/1 Trays 110ℓ 41.2 x6143cm Internal Dimension: 59.5 x7089.5cm Freezy 9 04-005-00003(XX)
223 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines
.
04-006-00008(XX) Plates Turning Negative Cold Display With 60 x 63 x 185cm Inside dimension: 54.5 x 54.5 x 120cm 360ℓ 230V / 50Hz / 800W 04-006-00005 80 x 73 x 60cm Internal Dimension: 65 x 55 x 29.5cm 2 levels 230V / 50Hz / 350W 04-006-00034 x 65 x 73.5cm 118.5 3 x 1/1 GN & 2 Glass Shelves +2° to +10°C 0.35kW, Stainless Steel Merchandiser Refrigerated Display Stainless Steel Merchandiser Stainless Steel Horizontal Refrigerated Display with LED Stainless Steel Horizontal Refrigerated Display with
Product Code Dimension Elec. Spec. Product Code Dimension Elec. Spec. ROLLER GRILL ROLLER GRILL VVF800 to keep The right equipment 60x40cm tray. Fits 2 x GN 1/1 tray and 2 The yoghurts, desserts, beverage. fresh your salads, fresh sandwiches, is warranting an inside temperature of +4 +10° ventilated refrigerated group of 29°C) and an automatic defrosting system. C (at an ambient temperature not included Tray White-cold LED lighting. ROLLER GRILL ROLLER GRILL Light CD1200 04-006-00007(XX) Plates Turning Positive Cold Display With 60 x 63 x 185cm Inside dimension: 54.5 x 54.5 x 120cm 360ℓ 230V / 50Hz / 690W
360ℓ 230V / 50Hz / 690W 04-006-00006(XX) Postive Cold Display With Fixed Grids 60 x 63 x 185cm Inside dimension: 54.5 x 54.5 x 120cm 04-006-00032 80 x 73 x 60cm 2 x 1/1 GN & 2 Glass Shelves +2° to +10°C 0.35kW, 04-006-00001(XX) 131.4 x 70.2 x 116.5cm x 41.57 x 5ℓ Internal Dimension: 119 230V / 50W / 730W Electric Ventilated Positive Cold Display with Fixed Grids RD60F Electric Ventilated Stainless Steel Horizontal Refrigerated Display with LED Stainless Steel Horizontal Refrigerated Display with Gelato and Ice Cream Display Freezer 7 Magic Pro Gelato and Ice Cream Display Elec. Spec. Dimension Capacity Product Code Type Dimension Elec. Spec. Product Code Elec. Spec. Product Code Dimension Negative refrigerated display cabinets keep your ice creams and frozen desserts between -5°C and -20°C ROLLER GRILL ROLLER GRILL to + 10°C. Positive cold refrigerated display cabinets keep pies, fruit salads or drinks at right temperature of +2°C ROLLER GRILL ROLLER GRILL Light CD800 - less rust, less humidity - even in tropical climates - less rust, less humidity - - Digital temperature display - Castors for easy positioning and equipped with defrost water drain - Corrosion resistant construction NEMOX with its own temperature control Internal storage compartment hygiene and visual effect safety, - Curved display canopy for for better protection: less condensation, - Easy clean condenser design
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 224 Inner glassshelves.Rearslidingdoor. ensuring themaintenanceofhumidity andtasteofproducts.LEDbacklight. Precise temperaturecontrolwithanelectronic thermostat.Humiditycontrol, ROLLER GRILL and practicalwithfrontrearopening. products andthegraphiccanbechangedtomatchyourmenu.Efficient pastries croissantspiesandpasties. The upperlightbox willpromoteyour shelves andprovideathermostaticallycontrolledhumidifieddisplayfor This stylishcompactcabinetwillstillaccommodatea1/1GNtrayonboth ROLLER GRILL firestone arecompletelyremovable. and theirssupports,thestainlesssteellowertray, thewaterdrawerand the loadingofprofessionalshowcaseandforservice. The grids Very easytouseandclean. The rearglassdoorsopenat180°Cfor ROLLER GRILL Add. Info. Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Stainless SteelHeatUpDisplaywithGlassShelves Counter Top Warming DisplayWDL200 Stainless SteelVentilated Warming DisplayWD780DI 230V /50W1800W 60 x40cmtrays/5Levels 78 x4964cm 04-006-00010 230V /3000W13Amps 2 Levels 78.5 x67.572cm 04-006-00033 230V /50W650W Fits 2xGN1/1 Tray Internal Dimension:2x(543312.5)cm 59 x3548cm 04-006-00012 Comes with2grids
and soon. and keepswarminquantitiesquiches,pizzas,fondues,meatballs,pastries This ventilatedheatedshowcase,equippedwith4LEDramps,highlights ROLLER GRILL Inner glassshelves.Rearslidingdoor. ensuring themaintenanceofhumidity andtasteofproducts.LEDbacklight. Precise temperaturecontrolwithanelectronic thermostat.Humiditycontrol, Shelves HD1200-BK ROLLER GRILL included. tray withtopsectioninglassforeasycleaningandmaintenance Tray not products moistanddelicious.Removablestainlesssteelpresentation illuminated displaysign,andwatercontainerforhumiditycontroltokeep Keep productsataconstanttemperatureof20-95°C.Equippedwithtop ROLLER GRILL Add. Info. Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Elec. Spec. Capacity Dimension Product Code Stainless SteelVentilated Warming DisplayWD780SI Stainless SteelHeatUpDisplay2LevelswithGlass Counter Top Warming DisplayWDL100 Comes with2grids 230V /50W1200W 60 x40cmtrays/3Levels 78 x4948cm 04-006-00011 230V /3000W13Amps 2 Levels,3xGN1/1 &3xGN1/1 118.5 x6573.5cm 04-006-00035 230V /50Hz650W Fits GN1/1 Tray Internal Dimension:54x3316.5cm 59 x3537.5cm 04-006-00013
225 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines - -
04-006-00021(XX) 2 Touch GT 45 x 44 x 65cm 2 x 5ℓ 230V / 50Hz / 750W 04-006-00031(XX) U Go Pump 35.7 x 52.12 x 60cm Hooper: 7ℓ Cylinder: 2.3ℓ 170cones/h 230V / 50Hz / 1050W 04-006-00021(XX)
04-006-00017(XX) 26 x 43 x 65cm 5ℓ 230V / 50Hz / 350W 04-006-00020(XX) 1 Touch GT 26 x 43 x 65cm 5ℓ 230V / 50Hz / 350W 04-006-00030(XX) U Go Gravity 35.7 x 52.12 x 60cm Hooper: 7ℓ Cylinder: 2.3ℓ 120cones/h 230V / 50Hz / 1000W 04-006-00020(XX) Container Sold Separately Soft Serve Ice Cream, Yoghurt, Slush Machine Yoghurt, Soft Serve Ice Cream, Soft Serve Ice Cream, Yoghurt, Slush Dispenser GT Lab Yoghurt, Soft Serve Ice Cream, Soft Serve Ice Cream, Yoghurt, Slush Machine Yoghurt, Soft Serve Ice Cream, Product Code Model No. Dimension Capacity Elec. Spec. Product Code Dimension Capacity Elec. Spec. Product Code Model No. Dimension Capacity Elec. Spec. SPM delivers up to 5 products and is easy to use with exclusive inter Touch GT active touch screen. SPM develop LAB is the latest the GT Compact, practical and touch-controlled, machines allowing to produce and deliver ice- ment in the field of small shops. cream in tubs, like in ice-cream • A control light warns the operator when the product inside the machine control light warns the operator when the product inside the machine A necessary to fill it up. U-Go is easy to reaches the minimum level and it’s use, to clean and to assemble. SPM -
04-006-00019(XX) Push 2 GT 45 x 43.5 x 65cm 2 x 5ℓ 230V / 50Hz / 750W 230V / 50Hz / 500W 04-006-00026(XX) Nina 2 28 x 38.8 x 47.8cm 2 x 2ℓ 04-006-00026(XX)
04-006-00019(XX) 04-006-00018(XX) Push 1 GT 26 x 43 x 65cm 5ℓ 230V / 50Hz / 350W 04-006-00009 100 x 72 x 47.5cm Inside dimension: 96 x 53.5 x 28cm Shelf: 96 x 30cm For 3 GN 1/1 230V / 50Hz / 2400W 230V / 50Hz / 270W 04-006-00025(XX) Nina 1 13 x 37.5 x 45.5cm 2ℓ Ventilated Warming Display VHC1000 Warming Ventilated 04-006-00025(XX) 04-006-00018(XX) Soft Serve Ice Cream, Yoghurt, Slush Machine Yoghurt, Soft Serve Ice Cream, Soft Serve Ice Cream, Yoghurt, Slush Machine Yoghurt, Soft Serve Ice Cream, Capacity Elec. Spec. Product Code Model No. Dimension Elec. Spec. Dimension Capacity Product Code Dimension Capacity Elec. Spec. Product Code Model No. SPM frozen yogurt with an For dispensing creamy ice cream soft and delicious exceptional quality. Temperature (+20/+10°C). Pulsed air convection system. LED lights. Tray Tray LED lights. (+20/+10°C). Pulsed air convection system. Temperature not included. this display is made up of 2 removable sections: the heating unit and this display is made up of by a system of rollers. Both warming and the display cabinet assembled 2 front and 1 rear changed with the front display. refrigerating units can be service tray make loading, serving and clean liftable door and a removable at a constant keep ready-made dishes, starters, main courses To ing easy. ROLLER GRILL ROLLER GRILL markets, kiosks, convenience stores, butchers, Designed for takeaways, good display surface. Modular and panoramic, market stalls, offers a very SPM creams is the mini dispenser for NINA Small, lightweight, revolutionary, and other cold dishes.
SIA HUAT 04 Electricals & Food Prep Machines
CATALOGUE // 226 Thermostat controlled.Stirringpaddle toavoidfoamingandoxidisation.HighqualitycompressorÚcceptsfruitpieces. Stainlesssteelbody a highquality, efficientandlong-lastingapplince.Compressordesignedfortropicalcountries. Reliable refrigerationsystem:Wideair-coolingcondensertocontinuouslychill thedrinks.Highpressurehermeticallysealedcompressorgivingguaranteeof SANTOS products canberemovedwithouthavingtouseanytools. shapes withstainlesssteelfinishingandwhiteorblackfinishes.Itiseasytocleanuser-friendly Bench compactmachinefordispensingcoldcreams,sorbetsandothercreamydishes.SP iscompactandfeaturesanelegantdesign,aswellrounded SPM enhancing theproductattractiveness. minimizes theinfluenceofexternaltemperature,increasescoolingpowerandenhancesproductconsistency The uniqueinsulationbathI-TANK ™technology,integratedwiththemanualcontrolsystem. The exclusiveinsulatedbowlspoweredbyi-Tank™ technology SPM Elec. Spec. Capacity Dimension Type Product Code Elec. Spec. Capacity Dimension Model No. Product Code Elec. Spec. Capacity Dimension Model No. Product Code Slush MachineIP1Mechanical Soft ServeIceCream, Yoghurt, SlushMachineSP1 Cold DrinkDispenserTank 34 230V /50W260W 1 x12ℓ 43 x1954.5cm Single 04-006-00014 230V /50Hz350W 5ℓ 26 x4361cm SP1 04-006-00027(XX) 230V /50Hz500W 11ℓ 20 x5887cm IP1 Mechanical 04-006-00022(XX) 04-006-00022(XX) 04-006-00027(XX) 04-006-00014 230V /50Hz980W 2 x11ℓ 40 x5887cm IP2 Mechanical 04-006-00023(XX) 230V /50W260W 2 x12ℓ 43 x3854.5cm Double 04-006-00015 230V /50Hz500W 2 x5ℓ 45 x4461cm SP2 04-006-00028(XX) 04-006-00023(XX) 04-006-00028(XX) 04-006-00015 , andallthecomponentswhichcomeintocontactwith . Itreducescondensationontheouterbowl 230V /50Hz1420W 3 x11ℓ 60 x5887cm IP3 Mechanical 04-006-00024(XX) 230V /50W330W 3 x12ℓ 43 x5754.5cm Triple 04-006-00016 230V /50Hz1000W 3 x5ℓ 63 x4561cm SP3 04-006-00029(XX) 04-006-00016 04-006-00024(XX) 04-006-00029(XX) . 227 SIA HUAT CATALOGUE // 04 Electricals & Food Prep Machines