DOCSLIB.ORG

Epigenetics of Colorectal Cancer

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Epigenetics of Colorectal Cancer DOI: http://dx.doi.org/10.22516/25007440.229 Review articles Epigenetics of Colorectal Cancer Carlos Humberto Afanador A.,1 Carlos Mario Muñetón Peña.1 1 Medical Genetics Unit of the Department of Abstract Pediatrics in the Faculty of Medicine at the University of Antioquia in Medellín, Colombia Colorectal cancer (CRC) has broad geographic distribution and affects millions of people throughout the Correspondence: Dr. Carlos Mario Muñetón world. It occurs sporadically in 80% of cases, but the rest have family histories. Epigenetic alterations such [email protected], [email protected]. as DNA methylation and modification of histones and non-coding RNA are involved in the development of this ......................................... disease. At present, these alterations have valuable potential as biomarkers for early detection of CRC and Received: 15-05-17 could be useful for diagnosis and determination of prognosis for individuals with CRC. The purpose of this Accepted: 22-01-18 review is to describe the main epigenetic mechanisms involved in colorectal cancer and the important roles they have in the development and progression of the disease. Keywords Colorectal cancer, epigenetics, DNA methylation, repair genes, tumor suppressor genes. INTRODUCTION tions in the APC and MLH1 genes predispose to heredi- tary-type CRC. (7-9) Several different genetic alterations Colorectal cancer (CRC) is considered to be a public are involved in onset and development of this disease. (10) health problem with a wide geographic distribution, accor- These alterations affect the expression of multiple genes, ding to the GLOBOCAN 2012 registry. (1) Currently, promoting the transformation of the normal mucosa of the CRC is the third most common cancer in men and women colon into a benign polyp which progresses to early ade- in the world. Its incidence is high in developed countries noma, then becomes intermediate, and finally progresses to but low in developing countries. (1, 2) Nevertheless, recent adenocarcinoma. (10) data from the International Agency for Research on Cancer Several molecular pathways are known to explain the (IARC) show increasing incidence and mortality rates in development of CRC. Initially, the classic model of progres- less developed countries. (3, 4) sion from adenoma to carcinoma was proposed by Fearon Incidence of CRC and CRC mortality rates have increa- and Vogelstein. (11) It is called the traditional or suppres- sed in Colombia in recent last decades. (5, 6) According sor pathway and involves deactivation of the APC and to figures from GLOBOCAN 2012 for Colombia, CRC TP53 tumor suppressor genes plus mutations in the KRAS, ranks fourth in incidence and mortality for both sexes. In DCC and SMAD oncogenes. (11) The second pathway is the most recent year, 4,107 new cases were diagnosed, most called a mutator and is related to mutations in the MLH1 of which were in advanced stages of the disease. (1) and MSH2 genes of the MMR repair system which induce The CRC occurs sporadically in about 80% of cases, but microsatellite instability (MSI) in tumor cells. (12) The the remaining 20% ​​have family histories. Germline muta- third pathway is epigenetic and consists of repression of 30 © 2018 Asociaciones Colombianas de Gastroenterología, Endoscopia digestiva, Coloproctología y Hepatología gene expression by methylation of the promoter region of HISTONE MODIFICATION the tumor suppressor or repair genes. (13) The term epigenetics was invented in 1942 by Conrad Hal On transcriptional control mechanism involves modifi- Waddington. It now describes the mechanisms that modify cations in histone proteins that are associated with DNA. the structure of chromatics and affect levels of gene expres- (15, 16) Post-translational covalent modifications in spe- sion without changes in the sequence of deoxyribonucleic cific regions of histones are known to be an epigenetic acid (DNA). These mechanisms include methylation, ace- mechanism that regulates and modifies the structure of tylation and hydroxylation of DNA, modification of histone- chromatin and are thought to be associated with the origin like proteins, remodeling of the chromatin structure and and progression of cancer. (16) changes in non-coding ribonucleic acids (RNA). Epigenetic Current knowledge of histone modifications in the develo- modifications can be induced by external and internal factors pment of cancer in humans is very limited. Histones are orga- that may have effects similar to those of pathogenic muta- nized in a cylindrical structure, and modifications commonly tions, since they can inactivate expression of various genes in occur in H2A, H2B, H3 and H4 which are part of a histone a specific tissue. This has been shown in the carcinogenesis octamer. (15, 16) The nucleosome is a unit composed of of various organs and is of great importance in the develo- approximately 150 to 200 base pairs of DNA that are arranged pment of cancer since these modifications affect expression around the nucleosomal histones. The N-terminal portion of of tumor suppressor genes of the DNA repair system. (14) each histone that emerges from this compact structure is the The purpose of this review is to describe the most impor- target at which post-translational modifications occur. The tant epigenetic modifications related to CRC and their main types of modifications are phosphorylation, glycosyla- possible use in clinical applications as biomarkers for early tion, ADP-ribosylation, ubiquitination, sumoylation and, most detection of CRC. commonly, acetylation and methylation (Figure 1). (15, 16) SGRGKQGGKARAKAKSRSSRAGLQFPVGRVVHRLLRKGNY H2A PEPAKSAPAPKKGSKKAVTKAQKKDSKKRKRSKSRKEDSYSV H2B ARTKQTARKSTGGKAPRKQLLATKAARKSAPATGGVKKPSH H3 SFRFKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLAR H4 Phosphorylation Acetylation H3 H2A Lysine methylation with gene expression Methylation (arginine) Lysine methylation without gene expression H2B H4 Ubiquitination Figure 1. Main post-translational modifications in N-terminal histones residues. The four histone proteins (H2A, H2B, H3 and H4) have a cylindrical structure called the histone nucleus. Main covalent modifications are phosphorylation, acetylation, methylation and ubiquitination. The image shows the sequence of amino acids that make up the N-terminal residue of each histone and the place where each type of modification occurs. Epigenetics of Colorectal Cancer 31 Acetylation and methylation are the most studied epigene- NH tic modifications in cancer. Amino acid residues, certain types 2 N of modifications and the histone domain have been observed N CH to be associated with the development and progression of 3 N cancer. (16-18) In general, of all the epigenetic mechanisms, SAM SAH histone modifications are of great importance and are the object of many studies about the epigenetics of cancer. DNMT O The acetylation/deacetylation and methylation/deme- O thylation states of lysine and arginine residues among the N N histones are among the most studied and best understood modifications. In general, it is known that hypoacetylation Cytosine 5-methylcytosine represses gene expression; while hyperacetylation of histo- nes activates the transcription of genes. Acetylation in speci- Figure 2. Methylation of cytosine in carbon 5 by means of DNMT. This fic histone motifs destabilizes chromatin fiber which allows enzyme catalyzes the union of a methyl group CH3 in the carbon 5 of increased mobility of the nucleosomes in the chromosomes. the cytosine, using the S-adenosyl methionine (SAH) of the CH3 group In this state, transcription factors bind to DNA. (19) as a donor molecule. SAH: S-adenosyl L-homocysteine. Currently, it is known that the deacetylation of histone H3K9 is related to repression of E-cadherin transcription Among the modifications that occur in the genome, in the cells of colorectal tumors. Other studies report that methylation has important functions such as regulating the loss of E-cadherin expression by methylation and the processes of replication, transcription, DNA repair and gene subsequent loss of cell adhesion appear to be critical steps expression. In addition, this DNA modification is necessary in the ability of tumor cells to invade adjacent tissues and for permanent deactivation of certain regions with genes metastasize. Various studies have shown that expression of that are not expressed after embryonic development and this protein is null or very low in poorly differentiated car- for deactivation of the X chromosome. It is also essential for cinomas, including CRC. (20, 21) coordination of transcriptional processes during embryonic development and cell differentiation. (10) DNA METHYLATION HYPERMETHYLATION OF DNA IN COLORECTAL Regulation of gene expression is the product of interac- CANCER tion between transcription initiation factors and promoter sequences located before the start codon (ATG). In nor- DNA methylation has been studied extensively in various mal cells, 60% of the genes coding in humans, the promo- types of cancer. (19, 26, 27). Similarly, the association bet- ter region is rich in sequences of cytosine-guanine (C-G, ween hypermethylation of CpG islands located near the gene called CpG islands). (22) promoter region and deactivation of gene transcription is One mechanism for complete inhibition of gene expres- well known. This includes deactivation of tumor suppressor sion is methylation of the promoter regions which pre- gene transcription, and these genes regulate the cell cycle and vents of transcription factors from
Load more

Recommended publications
  • Cytogenetics, Chromosomal Genetics
    Cytogenetics Chromosomal Genetics Sophie Dahoun Service de Génétique Médicale, HUG Geneva, Switzerland [email protected] Training Course in Sexual and Reproductive Health Research Geneva 2011 Cytogenetics is the branch of genetics that correlates the structure, number, and behaviour of chromosomes with heredity and diseases Conventional cytogenetics Molecular cytogenetics Molecular Biology I. Karyotype Definition Chromosomal Banding Resolution limits Nomenclature The metaphasic chromosome telomeres p arm q arm G-banded Human Karyotype Tjio & Levan 1956 Karyotype: The characterization of the chromosomal complement of an individual's cell, including number, form, and size of the chromosomes. A photomicrograph of chromosomes arranged according to a standard classification. A chromosome banding pattern is comprised of alternating light and dark stripes, or bands, that appear along its length after being stained with a dye. A unique banding pattern is used to identify each chromosome Chromosome banding techniques and staining Giemsa has become the most commonly used stain in cytogenetic analysis. Most G-banding techniques require pretreating the chromosomes with a proteolytic enzyme such as trypsin. G- banding preferentially stains the regions of DNA that are rich in adenine and thymine. R-banding involves pretreating cells with a hot salt solution that denatures DNA that is rich in adenine and thymine. The chromosomes are then stained with Giemsa. C-banding stains areas of heterochromatin, which are tightly packed and contain
    [Show full text]
  • GENETICS and GENOMICS Ed
    GENETICS AND GENOMICS Ed. Csaba Szalai, PhD GENETICS AND GENOMICS Editor: Csaba Szalai, PhD, university professor Authors: Chapter 1: Valéria László Chapter 2, 3, 4, 6, 7: Sára Tóth Chapter 5: Erna Pap Chapter 8, 9, 10, 11, 12, 13, 14: Csaba Szalai Chapter 15: András Falus and Ferenc Oberfrank Keywords: Mitosis, meiosis, mutations, cytogenetics, epigenetics, Mendelian inheritance, genetics of sex, developmental genetics, stem cell biology, oncogenetics, immunogenetics, human genomics, genomics of complex diseases, genomic methods, population genetics, evolution genetics, pharmacogenomics, nutrigenetics, gene environmental interaction, systems biology, bioethics. Summary The book contains the substance of the lectures and partly of the practices of the subject of ‘Genetics and Genomics’ held in Semmelweis University for medical, pharmacological and dental students. The book does not contain basic genetics and molecular biology, but rather topics from human genetics mainly from medical point of views. Some of the 15 chapters deal with medical genetics, but the chapters also introduce to the basic knowledge of cell division, cytogenetics, epigenetics, developmental genetics, stem cell biology, oncogenetics, immunogenetics, population genetics, evolution genetics, nutrigenetics, and to a relative new subject, the human genomics and its applications for the study of the genomic background of complex diseases, pharmacogenomics and for the investigation of the genome environmental interactions. As genomics belongs to sytems biology, a chapter introduces to basic terms of systems biology, and concentrating on diseases, some examples of the application and utilization of this scientific field are also be shown. The modern human genetics can also be associated with several ethical, social and legal issues. The last chapter of this book deals with these issues.
    [Show full text]
  • Epigenetics in Clinical Practice: the Examples of Azacitidine and Decitabine in Myelodysplasia and Acute Myeloid Leukemia
    Leukemia (2013) 27, 1803–1812 & 2013 Macmillan Publishers Limited All rights reserved 0887-6924/13 www.nature.com/leu SPOTLIGHT REVIEW Epigenetics in clinical practice: the examples of azacitidine and decitabine in myelodysplasia and acute myeloid leukemia EH Estey Randomized trials have clearly demonstrated that the hypomethylating agents azacitidine and decitabine are more effective than ‘best supportive care’(BSC) in reducing transfusion frequency in ‘low-risk’ myelodysplasia (MDS) and in prolonging survival compared with BSC or low-dose ara-C in ‘high-risk’ MDS or acute myeloid leukemia (AML) with 21–30% blasts. They also appear equivalent to conventional induction chemotherapy in AML with 420% blasts and as conditioning regimens before allogeneic transplant (hematopoietic cell transplant, HCT) in MDS. Although azacitidine or decitabine are thus the standard to which newer therapies should be compared, here we discuss whether the improvement they afford in overall survival is sufficient to warrant a designation as a standard in treating individual patients. We also discuss pre- and post-treatment covariates, including assays of methylation to predict response, different schedules of administration, combinations with other active agents and use in settings other than active disease, in particular post HCT. We note that rational development of this class of drugs awaits delineation of how much of their undoubted effect in fact results from hypomethylation and reactivation of gene expression. Leukemia (2013) 27, 1803–1812; doi:10.1038/leu.2013.173
    [Show full text]
  • Cytogenetic Mapping and Contribution to the Knowledge of Animal Genomes
    In: Advances in Genetics Research. Volume 4 ( in press ) ISBN 978-1-61728-764-0 Editor: Kevin V. Urbano, pp. © 2010 Nova Science Publishers, Inc. Chapter 1 Cytogenetic Mapping and Contribution to the Knowledge of Animal Genomes Cesar Martins, Diogo Cavalcanti Cabral-de-Mello, Guilherme Targino Valente, Juliana Mazzuchelli and Sarah Gomes de Oliveira UNESP – Univ Estadual Paulista, Departamento de Morfologia, Instituto de Biociências, Botucatu, SP, Brazil. Abstract Decades before the recent advances in molecular biology and the knowledge of the complete nucleotide sequence of several genomes, cytogenetic analysis provided the first information concerning the genome organization. Since the beginning of cytogenetics, great effort has been applied for understanding the chromosome evolution in a wide range of taxonomic groups. The exploration of molecular biology techniques in the cytogenetic area represents a powerful tool for advancement in the construction of physical chromosome maps of the genomes. The most important contribution of cytogenetics is related to the physical anchorage of genetic linkage maps in the chromosomes through the hybridization of DNA markers onto chromosomes. Several technologies, such as polymerase chain reaction (PCR), enzymatic restriction, flow sorting, chromosome microdissection and BAC library construction, associated with distinct labeling methods and fluorescent detection systems have allowed for the generation of a range of useful DNA probes applied in chromosome physical mapping. Concerning the probes used for molecular cytogenetics, the repetitive DNA is amongst the most explored nucleotide sequences. The recent development of bacterial artificial chromosomes (BACs) as vectors for carrying large genome fragments has allowed for the utilization of BACs as probes for the purpose of chromosome mapping.
    [Show full text]
  • Molecular Biology and Applied Genetics
    MOLECULAR BIOLOGY AND APPLIED GENETICS FOR Medical Laboratory Technology Students Upgraded Lecture Note Series Mohammed Awole Adem Jimma University MOLECULAR BIOLOGY AND APPLIED GENETICS For Medical Laboratory Technician Students Lecture Note Series Mohammed Awole Adem Upgraded - 2006 In collaboration with The Carter Center (EPHTI) and The Federal Democratic Republic of Ethiopia Ministry of Education and Ministry of Health Jimma University PREFACE The problem faced today in the learning and teaching of Applied Genetics and Molecular Biology for laboratory technologists in universities, colleges andhealth institutions primarily from the unavailability of textbooks that focus on the needs of Ethiopian students. This lecture note has been prepared with the primary aim of alleviating the problems encountered in the teaching of Medical Applied Genetics and Molecular Biology course and in minimizing discrepancies prevailing among the different teaching and training health institutions. It can also be used in teaching any introductory course on medical Applied Genetics and Molecular Biology and as a reference material. This lecture note is specifically designed for medical laboratory technologists, and includes only those areas of molecular cell biology and Applied Genetics relevant to degree-level understanding of modern laboratory technology. Since genetics is prerequisite course to molecular biology, the lecture note starts with Genetics i followed by Molecular Biology. It provides students with molecular background to enable them to understand and critically analyze recent advances in laboratory sciences. Finally, it contains a glossary, which summarizes important terminologies used in the text. Each chapter begins by specific learning objectives and at the end of each chapter review questions are also included.
    [Show full text]
  • Cytogenetics, Chromosomal Genetics
    Cytogenetics Chromosomal Genetics Sophie Dahoun Service de Génétique Médicale, HUG Geneva, Switzerland [email protected] Training Course in Sexual and Reproductive Health Research Geneva 2010 Cytogenetics is the branch of genetics that correlates the structure, number, and behaviour of chromosomes with heredity and diseases Conventional cytogenetics Molecular cytogenetics Molecular Biology I. Karyotype Definition Chromosomal Banding Resolution limits Nomenclature The metaphasic chromosome telomeres p arm q arm G-banded Human Karyotype Tjio & Levan 1956 Karyotype: The characterization of the chromosomal complement of an individual's cell, including number, form, and size of the chromosomes. A photomicrograph of chromosomes arranged according to a standard classification. A chromosome banding pattern is comprised of alternating light and dark stripes, or bands, that appear along its length after being stained with a dye. A unique banding pattern is used to identify each chromosome Chromosome banding techniques and staining Giemsa has become the most commonly used stain in cytogenetic analysis. Most G-banding techniques require pretreating the chromosomes with a proteolytic enzyme such as trypsin. G- banding preferentially stains the regions of DNA that are rich in adenine and thymine. R-banding involves pretreating cells with a hot salt solution that denatures DNA that is rich in adenine and thymine. The chromosomes are then stained with Giemsa. C-banding stains areas of heterochromatin, which are tightly packed and contain
    [Show full text]
  • Interplay Between P53 and Epigenetic Pathways in Cancer
    University of Pennsylvania ScholarlyCommons Publicly Accessible Penn Dissertations 2016 Interplay Between P53 and Epigenetic Pathways in Cancer Jiajun Zhu University of Pennsylvania, [email protected] Follow this and additional works at: https://repository.upenn.edu/edissertations Part of the Biology Commons, Cell Biology Commons, and the Molecular Biology Commons Recommended Citation Zhu, Jiajun, "Interplay Between P53 and Epigenetic Pathways in Cancer" (2016). Publicly Accessible Penn Dissertations. 2130. https://repository.upenn.edu/edissertations/2130 This paper is posted at ScholarlyCommons. https://repository.upenn.edu/edissertations/2130 For more information, please contact [email protected]. Interplay Between P53 and Epigenetic Pathways in Cancer Abstract The human TP53 gene encodes the most potent tumor suppressor protein p53. More than half of all human cancers contain mutations in the TP53 gene, while the majority of the remaining cases involve other mechanisms to inactivate wild-type p53 function. In the first part of my dissertation research, I have explored the mechanism of suppressed wild-type p53 activity in teratocarcinoma. In the teratocarcinoma cell line NTera2, we show that wild-type p53 is mono-methylated at Lysine 370 and Lysine 382. These post-translational modifications contribute ot the compromised tumor suppressive activity of p53 despite a high level of wild-type protein in NTera2 cells. This study provides evidence for an epigenetic mechanism that cancer cells can exploit to inactivate p53 wild-type function. The paradigm provides insight into understanding the modes of p53 regulation, and can likely be applied to other cancer types with wild-type p53 proteins. On the other hand, cancers with TP53 mutations are mostly found to contain missense substitutions of the TP53 gene, resulting in expression of full length, but mutant forms of p53 that confer tumor-promoting “gain-of-function” (GOF) to cancer.
    [Show full text]
  • Genomic and Epigenomic EBF1 Alterations Modulate TERT Expression in Gastric Cancer
    Genomic and epigenomic EBF1 alterations modulate TERT expression in gastric cancer Manjie Xing, … , Bin Tean Teh, Patrick Tan J Clin Invest. 2020;130(6):3005-3020. https://doi.org/10.1172/JCI126726. Research Article Gastroenterology Oncology Graphical abstract Find the latest version: https://jci.me/126726/pdf The Journal of Clinical Investigation RESEARCH ARTICLE Genomic and epigenomic EBF1 alterations modulate TERT expression in gastric cancer Manjie Xing,1,2,3 Wen Fong Ooi,2 Jing Tan,4,5 Aditi Qamra,2,3 Po-Hsien Lee,6 Zhimei Li,5 Chang Xu,1,6 Nisha Padmanabhan,1 Jing Quan Lim,7 Yu Amanda Guo,8 Xiaosai Yao,9 Mandoli Amit,1 Ley Moy Ng,6 Taotao Sheng,1,10 Jing Wang,1 Kie Kyon Huang,1 Chukwuemeka George Anene-Nzelu,11,12 Shamaine Wei Ting Ho,1,6 Mohana Ray,13 Lijia Ma,13 Gregorio Fazzi,14 Kevin Junliang Lim,1 Giovani Claresta Wijaya,5 Shenli Zhang,1 Tannistha Nandi,2 Tingdong Yan,1 Mei Mei Chang,8 Kakoli Das,1 Zul Fazreen Adam Isa,2 Jeanie Wu,1 Polly Suk Yean Poon,2 Yue Ning Lam,2 Joyce Suling Lin,2 Su Ting Tay,1 Ming Hui Lee,1 Angie Lay Keng Tan,1 Xuewen Ong,1 Kevin White,13,15 Steven George Rozen,1,16 Michael Beer,17,18 Roger Sik Yin Foo,11,12 Heike Irmgard Grabsch,14,19 Anders Jacobsen Skanderup,8 Shang Li,1,20 Bin Tean Teh,1,5,6,9,16,20 and Patrick Tan1,2,6,16,21,22,23 1Cancer and Stem Cell Biology Program, Duke-NUS Medical School, Singapore.
    [Show full text]
  • Cytogenetics Can It Make Sense?
    Reporting cytogenetics Can it make sense? Daniel Weisdorf MD University of Minnesota Reporting cytogenetics • What is it? • Terminology • Clinical value • What details are important Diagnostic Tools for Leukemia • Microscope What do the cells (blasts) look like? How do they stain? • Flow Cytometry fluorescent antibody measure of molecules and density on cells • Cytogenetics Chromosome number, structure and changes • Molecular testing (PCR) DNA or RNA changes that indicate the tumor cells Diagnosis- Immunocytochemistry MPO and PAS (red) in normal MPO in M2 (orange) BM M7 Factor VIII related protein identifies blasts of megakaryocyte lineage. Immunocytochemistry M5 M5 Strongly positive for the Chloroacetate esterase stains nonspecific esterase Inhibited by neutrophils blue,nonspecific Fluoride. esterase stains monocytes red- brown Reporting cytogenetics • How are they tested? • What is FISH? • What’s the difference? • What do they mean? Reporting cytogenetics • How are they tested? Structural and numerical changes in chromosomes—while cells are dividing • What is FISH? Fluorescent in situ hybridization Specific markers on defined chromosome sites • What’s the difference? Dividing (metaphase) vs non-dividing (interphase) • What do they mean? Molecular probes to find chromsome changes Specimen requirements • Cytogenetics – Sodium heparin (green top) – Core biopsy acceptable (in saline, RPMI or other media) – FFPE tissue acceptable for FISH UNLESS it has been decalcified • G-banding – Requires dividing cells to be able to examine chromosomes
    [Show full text]
  • Epigenetics Changes in Breast Cancer
    ering & B ne io gi m n e e d io i c B a f l Behera P, J Bioengineer & Biomedical Sci 2017, S Journal of o l c a i e n n r 7:2 c u e o J DOI: 10.4172/2155-9538.1000223 ISSN: 2155-9538 Bioengineering & Biomedical Science Review Article Open Access Epigenetics Changes in Breast Cancer: Current Aspects in India Behera P* Department of Biotechnology, Amity University, Lucknow, India *Corresponding author: Behera P, Department of Biotechnology, Amity University, Lucknow, India, Tel: 9703466651; E-mail: [email protected] Received date: March 25, 2017; Accepted date: April 4, 2017; Published date: April 15, 2017 Copyright: © 2017 Behera P. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution and reproduction in any medium, provided the original author and source are credited. Abstract Epigenetics is turning out to be one of the promising studies in cancer research. This review focuses mainly on how genetic and epigenetic factors like DNA methylation, histone modifications and various other genes can assess the promoter region of cancer related genes and provides a tool for cancer diagnosis and research. The objective of the review is to provide an overview of the literature with some recent developments providing insights into the important question of co-evolution of epigenetic changes in breast cancer progression and tumorigenesis. This review also comply study of different genetic changes existing in breast cancer. Further in this review focus on functioning of DNA methylation, including both normal, disruptions or abnormal role in human disease, and changes in DNA methylation during human breast cancer is also noted.
    [Show full text]
  • The Role of Cytogenetics and Molecular Biology in the Diagnosis
    REVIEW ARTICLE J Bras Patol Med Lab. 2018 Apr; 54(2): 83-91. The role of cytogenetics and molecular biology in the diagnosis, treatment and monitoring of patients with chronic myeloid leukemia 10.5935/1676-2444.20180015 O papel da citogenética e da biologia molecular no diagnóstico, no tratamento e no monitoramento de pacientes com leucemia mieloide crônica Luiza Emy Dorfman1; Maiara A. Floriani1; Tyana Mara R. D. R. Oliveira1; Bibiana Cunegatto1; Rafael Fabiano M. Rosa1, 2; Paulo Ricardo G. Zen1, 2 1. Universidade Federal de Ciências da Saúde de Porto Alegre (UFCSPA), Rio Grande do Sul, Brazil. 2. Complexo Hospitalar Santa Casa de Porto Alegre (CHSCPA), Rio Grande do Sul, Brazil. ABSTRACT Chronic myeloid leukemia (CML) is the most common myeloproliferative disorder among chronic neoplasms. The history of this disease joins with the development of cytogenetic analysis techniques in human. CML was the first cancer to be associated with a recurrent chromosomal alteration, a reciprocal translocation between the long arms of chromosomes 9 and 22 – Philadelphia chromosome. This work is an updated review on CML, which highlights the importance of cytogenetics analysis in the continuous monitoring and therapeutic orientation of this disease. The search for scientific articles was carried out in the PubMed electronic database, using the descriptors “leukemia”, “chronic myeloid leukemia”, “treatment”, “diagnosis”, “karyotype” and “cytogenetics”. Specialized books and websites were also included. Detailed cytogenetic and molecular monitoring can assist in choosing the most effective drug for each patient, optimizing the treatment. Cytogenetics plays a key role in the detection of chromosomal abnormalities associated with malignancies, as well as the characterization of new alterations that allow more research and increase knowledge about the genetic aspects of these diseases.
    [Show full text]
  • Epigenetic Inactivation of the P53-Induced Long Noncoding RNA
    Epigenetic inactivation of the p53-induced long PNAS PLUS noncoding RNA TP53 target 1 in human cancer Angel Diaz-Lagaresa, Ana B. Crujeirasa,b,c, Paula Lopez-Serraa, Marta Solera, Fernando Setiena, Ashish Goyald,e, Juan Sandovala, Yutaka Hashimotoa, Anna Martinez-Cardúsa, Antonio Gomeza, Holger Heyna, Catia Moutinhoa, Jesús Espadaf,g, August Vidalh, Maria Paúlesh, Maica Galáni, Núria Salaj, Yoshimitsu Akiyamak, María Martínez-Iniestal, Lourdes Farrél,m, Alberto Villanueval, Matthias Grossd,e, Sven Diederichsd,e,n,o,p, Sonia Guila,1, and Manel Estellera,q,r,1 aCancer Epigenetics and Biology Program (PEBC), Bellvitge Biomedical Research Institute (IDIBELL), L’Hospitalet de Llobregat, 08908 Barcelona, Catalonia, Spain; bCentro de Investigación Biomédica en Red (CIBER) Fisiopatología de la Obesidad y Nutrición (CIBERobn), Instituto Salud Carlos III, 28029 Madrid, Spain; cEndocrine Division, Complejo Hospitalario Universitario de Santiago, 15706 Santiago de Compostela, Spain; dDivision of RNA Biology and Cancer (B150), German Cancer Research Center (DKFZ), 69120 Heidelberg, Germany; eInstitute of Pathology, University Hospital Heidelberg, 69120 Heidelberg, Germany; fExperimental Dermatology and Skin Biology Group, Ramón y Cajal Institute for Biomedical Research (IRYCIS), Ramón y Cajal University Hospital, 28034 Madrid, Spain; gBionanotechnology Laboratory, Bernardo O’Higgins University, Santiago 8370854, Chile; hPathology Department, Hospital Universitari de Bellvitge, IDIBELL, L’Hospitalet de Llobregat, 08907 Barcelona, Catalonia, Spain;
    [Show full text]