DOCSLIB.ORG

PYCARD (Human) Recombinant Protein (P01)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
PYCARD (Human) Recombinant Protein (P01) PYCARD (Human) Recombinant (PYD) and a C-terminal caspase-recruitment domain Protein (P01) (CARD). The PYD and CARD domains are members of the six-helix bundle death domain-fold superfamily that Catalog Number: H00029108-P01 mediates assembly of large signaling complexes in the inflammatory and apoptotic signaling pathways via the Regulation Status: For research use only (RUO) activation of caspase. In normal cells, this protein is localized to the cytoplasm; however, in cells undergoing Product Description: Human PYCARD full-length ORF apoptosis, it forms ball-like aggregates near the nuclear ( AAH13569.2, 1 a.a. - 149 a.a.) recombinant protein periphery. Two transcript variants encoding different with GST-tag at N-terminal. isoforms have been found for this gene. [provided by RefSeq] Sequence: MDALDLTDKLVSFYLETYGAELTANVLRDMGLQEMAG References: QLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRA 1. NLRP3 activation and mitosis are mutually exclusive ALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSK events coordinated by NEK7, a new inflammasome MRKLFNFTPAWNWTCKDLLLQALRESQSYLVEDLERS component. Shi H, Wang Y, Li X, Zhan X, Tang M, Fina M, Su L, Pratt D, Bu CH, Hildebrand S, Lyon S, Scott L, Host: Wheat Germ (in vitro) Quan J, Sun Q, Russell J, Arnett S, Jurek P, Chen D, Kravchenko VV, Mathison JC, Moresco EM, Monson NL, Theoretical MW (kDa): 42.13 Ulevitch RJ, Beutler B. Nat Immunol. 2015 Dec 7. [Epub ahead of print] Applications: AP, Array, ELISA, WB-Re (See our web site product page for detailed applications information) Protocols: See our web site at http://www.abnova.com/support/protocols.asp or product page for detailed protocols Preparation Method: in vitro wheat germ expression system Purification: Glutathione Sepharose 4 Fast Flow Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. Storage Instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing. Entrez GeneID: 29108 Gene Symbol: PYCARD Gene Alias: ASC, CARD5, MGC10332, TMS, TMS-1, TMS1 Gene Summary: This gene encodes an adaptor protein that is composed of two protein-protein interaction domains: a N-terminal PYRIN-PAAD-DAPIN domain Page 1/1 Powered by TCPDF (www.tcpdf.org).
Load more

Recommended publications
  • Post-Translational Regulation of Inflammasomes
    OPEN Cellular & Molecular Immunology (2017) 14, 65–79 & 2017 CSI and USTC All rights reserved 2042-0226/17 www.nature.com/cmi REVIEW Post-translational regulation of inflammasomes Jie Yang1,2, Zhonghua Liu1 and Tsan Sam Xiao1 Inflammasomes play essential roles in immune protection against microbial infections. However, excessive inflammation is implicated in various human diseases, including autoinflammatory syndromes, diabetes, multiple sclerosis, cardiovascular disorders and neurodegenerative diseases. Therefore, precise regulation of inflammasome activities is critical for adequate immune protection while limiting collateral tissue damage. In this review, we focus on the emerging roles of post-translational modifications (PTMs) that regulate activation of the NLRP3, NLRP1, NLRC4, AIM2 and IFI16 inflammasomes. We anticipate that these types of PTMs will be identified in other types of and less well-characterized inflammasomes. Because these highly diverse and versatile PTMs shape distinct inflammatory responses in response to infections and tissue damage, targeting the enzymes involved in these PTMs will undoubtedly offer opportunities for precise modulation of inflammasome activities under various pathophysiological conditions. Cellular & Molecular Immunology (2017) 14, 65–79; doi:10.1038/cmi.2016.29; published online 27 June 2016 Keywords: inflammasome; phosphorylation; post-translational modifications; ubiquitination INTRODUCTION upstream sensor molecules through its PYD domain and The innate immune system relies on pattern recognition downstream
    [Show full text]
  • Genetic Variant in 3' Untranslated Region of the Mouse Pycard Gene
    bioRxiv preprint doi: https://doi.org/10.1101/2021.03.26.437184; this version posted March 26, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 1 2 3 Title: 4 Genetic Variant in 3’ Untranslated Region of the Mouse Pycard Gene Regulates Inflammasome 5 Activity 6 Running Title: 7 3’UTR SNP in Pycard regulates inflammasome activity 8 Authors: 9 Brian Ritchey1*, Qimin Hai1*, Juying Han1, John Barnard2, Jonathan D. Smith1,3 10 1Department of Cardiovascular & Metabolic Sciences, Lerner Research Institute, Cleveland Clinic, 11 Cleveland, OH 44195 12 2Department of Quantitative Health Sciences, Lerner Research Institute, Cleveland Clinic, Cleveland, OH 13 44195 14 3Department of Molecular Medicine, Cleveland Clinic Lerner College of Medicine of Case Western 15 Reserve University, Cleveland, OH 44195 16 *, These authors contributed equally to this study. 17 Address correspondence to Jonathan D. Smith: email [email protected]; ORCID ID 0000-0002-0415-386X; 18 mailing address: Cleveland Clinic, Box NC-10, 9500 Euclid Avenue, Cleveland, OH 44195, USA. 19 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.03.26.437184; this version posted March 26, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. 20 Abstract 21 Quantitative trait locus mapping for interleukin-1 release after inflammasome priming and activation 22 was performed on bone marrow-derived macrophages (BMDM) from an AKRxDBA/2 strain intercross.
    [Show full text]
  • ATP-Binding and Hydrolysis in Inflammasome Activation
    molecules Review ATP-Binding and Hydrolysis in Inflammasome Activation Christina F. Sandall, Bjoern K. Ziehr and Justin A. MacDonald * Department of Biochemistry & Molecular Biology, Cumming School of Medicine, University of Calgary, 3280 Hospital Drive NW, Calgary, AB T2N 4Z6, Canada; [email protected] (C.F.S.); [email protected] (B.K.Z.) * Correspondence: [email protected]; Tel.: +1-403-210-8433 Academic Editor: Massimo Bertinaria Received: 15 September 2020; Accepted: 3 October 2020; Published: 7 October 2020 Abstract: The prototypical model for NOD-like receptor (NLR) inflammasome assembly includes nucleotide-dependent activation of the NLR downstream of pathogen- or danger-associated molecular pattern (PAMP or DAMP) recognition, followed by nucleation of hetero-oligomeric platforms that lie upstream of inflammatory responses associated with innate immunity. As members of the STAND ATPases, the NLRs are generally thought to share a similar model of ATP-dependent activation and effect. However, recent observations have challenged this paradigm to reveal novel and complex biochemical processes to discern NLRs from other STAND proteins. In this review, we highlight past findings that identify the regulatory importance of conserved ATP-binding and hydrolysis motifs within the nucleotide-binding NACHT domain of NLRs and explore recent breakthroughs that generate connections between NLR protein structure and function. Indeed, newly deposited NLR structures for NLRC4 and NLRP3 have provided unique perspectives on the ATP-dependency of inflammasome activation. Novel molecular dynamic simulations of NLRP3 examined the active site of ADP- and ATP-bound models. The findings support distinctions in nucleotide-binding domain topology with occupancy of ATP or ADP that are in turn disseminated on to the global protein structure.
    [Show full text]
  • A Role for the Nlr Family Members Nlrc4 and Nlrp3 in Astrocytic Inflammasome Activation and Astrogliosis
    A ROLE FOR THE NLR FAMILY MEMBERS NLRC4 AND NLRP3 IN ASTROCYTIC INFLAMMASOME ACTIVATION AND ASTROGLIOSIS Leslie C. Freeman A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the requirements for the degree of Doctor of Philosophy in the Curriculum of Genetics and Molecular Biology. Chapel Hill 2016 Approved by: Jenny P. Y. Ting Glenn K. Matsushima Beverly H. Koller Silva S. Markovic-Plese Pauline. Kay Lund ©2016 Leslie C. Freeman ALL RIGHTS RESERVED ii ABSTRACT Leslie C. Freeman: A Role for the NLR Family Members NLRC4 and NLRP3 in Astrocytic Inflammasome Activation and Astrogliosis (Under the direction of Jenny P.Y. Ting) The inflammasome is implicated in many inflammatory diseases but has been primarily studied in the macrophage-myeloid lineage. Here we demonstrate a physiologic role for nucleotide-binding domain, leucine-rich repeat, CARD domain containing 4 (NLRC4) in brain astrocytes. NLRC4 has been primarily studied in the context of gram-negative bacteria, where it is required for the maturation of pro-caspase-1 to active caspase-1. We show the heightened expression of NLRC4 protein in astrocytes in a cuprizone model of neuroinflammation and demyelination as well as human multiple sclerotic brains. Similar to macrophages, NLRC4 in astrocytes is required for inflammasome activation by its known agonist, flagellin. However, NLRC4 in astrocytes also mediate inflammasome activation in response to lysophosphatidylcholine (LPC), an inflammatory molecule associated with neurologic disorders. In addition to NLRC4, astrocytic NLRP3 is required for inflammasome activation by LPC. Two biochemical assays show the interaction of NLRC4 with NLRP3, suggesting the possibility of a NLRC4-NLRP3 co-inflammasome.
    [Show full text]
  • Inflammasome Adaptor ASC Suppresses Apoptosis of Gastric Cancer Cells by an IL-18 Mediated Inflammation-Independent Mechanism
    Author Manuscript Published OnlineFirst on December 27, 2017; DOI: 10.1158/0008-5472.CAN-17-1887 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited. Inflammasome adaptor ASC suppresses apoptosis of gastric cancer cells by an IL-18 mediated inflammation-independent mechanism Virginie Deswaerte1,2,*, Paul Nguyen3,4,*, Alison West1,2, Alison F. Browning1,2, Liang Yu1,2, Saleela M. Ruwanpura1,2, Jesse Balic1,2, Thaleia Livis1,2, Charlotte Girard5, Adele Preaudet3,4, Hiroko Oshima6, Ka Yee Fung3,4, Hazel Tye1,2, Meri Najdovska1,2, Matthias Ernst7, Masanobu Oshima6, Cem Gabay5, Tracy Putoczki3,4, and Brendan J. Jenkins1,2 1Centre for Innate Immunity and Infectious Diseases, Hudson Institute of Medical Research, Clayton, Victoria, Australia; 2Department of Molecular Translational Science, School of Clinical Sciences, Monash University, Clayton, Victoria, Australia; 3Inflammation Division, Walter and Eliza Hall Institute of Medical Research, Parkville, Victoria, Australia; 4Department of Medical Biology, University of Melbourne, Parkville, Victoria, Australia; 5Division of Rheumatology, University Hospital of Geneva, and Department of Pathology and Immunology, University of Geneva School of Medicine, Geneva, Switzerland; 6Division of Genetics, Cancer Research Institute, Kanazawa University, Kanazawa, Japan; 7Olivia Newton-John Cancer Research Institute, La Trobe University School of Cancer Medicine, Heidelberg, Victoria, Australia. *These authors contributed equally. Running title: ASC inflammasomes promote gastric cancer via IL-18 Keywords: apoptosis, ASC, gastric cancer, IL-18, inflammasomes. 1 Downloaded from cancerres.aacrjournals.org on September 25, 2021. © 2017 American Association for Cancer Research. Author Manuscript Published OnlineFirst on December 27, 2017; DOI: 10.1158/0008-5472.CAN-17-1887 Author manuscripts have been peer reviewed and accepted for publication but have not yet been edited.
    [Show full text]
  • Cutting Edge: Critical Role for PYCARD/ASC in the Development of Experimental Autoimmune Encephalomyelitis This Information Is Current As of September 26, 2021
    Cutting Edge: Critical Role for PYCARD/ASC in the Development of Experimental Autoimmune Encephalomyelitis This information is current as of September 26, 2021. Patrick J. Shaw, John R. Lukens, Samir Burns, Hongbo Chi, Maureen A. McGargill and Thirumala-Devi Kanneganti J Immunol 2010; 184:4610-4614; Prepublished online 5 April 2010; doi: 10.4049/jimmunol.1000217 Downloaded from http://www.jimmunol.org/content/184/9/4610 Supplementary http://www.jimmunol.org/content/suppl/2010/04/06/jimmunol.100021 http://www.jimmunol.org/ Material 7.DC1 References This article cites 20 articles, 3 of which you can access for free at: http://www.jimmunol.org/content/184/9/4610.full#ref-list-1 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 26, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2010 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Cutting Edge: Critical Role for PYCARD/ASC in the Development of Experimental Autoimmune Encephalomyelitis Patrick J. Shaw, John R.
    [Show full text]
  • The NLRP3 and NLRP1 Inflammasomes Are Activated In
    Saresella et al. Molecular Neurodegeneration (2016) 11:23 DOI 10.1186/s13024-016-0088-1 RESEARCHARTICLE Open Access The NLRP3 and NLRP1 inflammasomes are activated in Alzheimer’s disease Marina Saresella1*†, Francesca La Rosa1†, Federica Piancone1, Martina Zoppis1, Ivana Marventano1, Elena Calabrese1, Veronica Rainone2, Raffaello Nemni1,3, Roberta Mancuso1 and Mario Clerici1,3 Abstract Background: Interleukin-1 beta (IL-1β) and its key regulator, the inflammasome, are suspected to play a role in the neuroinflammation observed in Alzheimer’s disease (AD); no conclusive data are nevertheless available in AD patients. Results: mRNA for inflammasome components (NLRP1, NLRP3, PYCARD, caspase 1, 5 and 8) and downstream effectors (IL-1β, IL-18) was up-regulated in severe and MILD AD. Monocytes co-expressing NLRP3 with caspase 1 or caspase 8 were significantly increased in severe AD alone, whereas those co-expressing NLRP1 and NLRP3 with PYCARD were augmented in both severe and MILD AD. Activation of the NLRP1 and NLRP3 inflammasomes in AD was confirmed by confocal microscopy proteins co-localization and by the significantly higher amounts of the pro-inflammatory cytokines IL-1β and IL-18 being produced by monocytes. In MCI, the expression of NLRP3, but not the one of PYCARD or caspase 1 was increased, indicating that functional inflammasomes are not assembled in these individuals: this was confirmed by lack of co-localization and of proinflammatory cytokines production. Conclusions: The activation of at least two different inflammasome complexes
    [Show full text]
  • Influence of Galectin-3 on the Innate Immune Response During
    Journal of Fungi Article Influence of Galectin-3 on the Innate Immune Response during Experimental Cryptococcosis Caroline Patini Rezende 1, Patricia Kellen Martins Oliveira Brito 2 , Thiago Aparecido Da Silva 2 , Andre Moreira Pessoni 1 , Leandra Naira Zambelli Ramalho 3 and Fausto Almeida 1,* 1 Department of Biochemistry and Immunology, Ribeirao Preto Medical School, University of Sao Paulo, Ribeirao Preto 14049-900, SP, Brazil; [email protected] (C.P.R.); [email protected] (A.M.P.) 2 Department of Cellular and Molecular Biology, Ribeirao Preto Medical School, University of Sao Paulo, Ribeirao Preto 14049-900, SP, Brazil; [email protected] (P.K.M.O.B.); [email protected] (T.A.D.S.) 3 Department of Pathology, Ribeirao Preto Medical School, University of Sao Paulo, Ribeirao Preto 14049-900, SP, Brazil; [email protected] * Correspondence: [email protected] Abstract: Cryptococcus neoformans, the causative agent of cryptococcosis, is the primary fungal pathogen that affects the immunocompromised individuals. Galectin-3 (Gal-3) is an animal lectin involved in both innate and adaptive immune responses. The present study aimed to evaluate the influence of Gal-3 on the C. neoformans infection. We performed histopathological and gene profile analysis of the innate antifungal immunity markers in the lungs, spleen, and brain of the wild-type (WT) and Gal-3 knockout (KO) mice during cryptococcosis. These findings suggest that Gal-3 absence does not cause significant histopathological alterations in the analyzed tissues. The expression profile of the genes related to innate antifungal immunity showed that the presence of cryptococcosis in Citation: Rezende, C.P.; Brito, the WT and Gal-3 KO animals, compared to their respective controls, promoted the upregulation P.K.M.O.; Da Silva, T.A.; Pessoni, of the pattern recognition receptor (PRR) responsive to mannose/chitin (mrc1) and a gene involved A.M.; Ramalho, L.N.Z.; Almeida, F.
    [Show full text]
  • Prognostic Value of NLRP3 Inflammasome and TLR4
    ORIGINAL RESEARCH published: 02 September 2021 doi: 10.3389/fonc.2021.705331 Prognostic Value of NLRP3 Inflammasome and TLR4 Expression in Breast Cancer Patients † † Concetta Saponaro 1* , Emanuela Scarpi 2 , Margherita Sonnessa 1, Antonella Cioffi 1, Francesca Buccino 3, Francesco Giotta 4, Maria Irene Pastena 3, ‡ ‡ Francesco Alfredo Zito 3 and Anita Mangia 1* 1 Functional Biomorphology Laboratory, IRCCS Istituto Tumori “Giovanni Paolo II”, Bari, Italy, 2 Unit of Biostatistics and Clinical Trials, IRCCS Istituto Scientifico Romagnolo per lo Studio dei Tumori (IRST) “Dino Amadori”, Meldola (FC), Italy, 3 Pathology Department, IRCCS Istituto Tumori “Giovanni Paolo II”, Bari, Italy, 4 Medical Oncology Unit, IRCCS-Istituto Tumori “Giovanni Paolo II”, Bari, Italy Edited by: Nicola Silvestris, University of Bari Aldo Moro, Italy Inflammasome complexes play a pivotal role in different cancer types. NOD-like receptor Reviewed by: protein 3 (NLRP3) inflammasome is one of the most well-studied inflammasomes. Stan Lipkowitz, Activation of the NLRP3 inflammasome induces abnormal secretion of soluble National Cancer Institute, fl United States cytokines, generating advantageous in ammatory surroundings that support tumor Elena Gershtein, growth. The expression levels of the NLRP3, PYCARD and TLR4 were determined by Russian Cancer Research Center NN immunohistochemistry in a cohort of primary invasive breast carcinomas (BCs). We Blokhin, Russia *Correspondence: observed different NLRP3 and PYCARD expressions in non-tumor vs tumor areas Anita Mangia (p<0.0001). All the proteins were associated to more aggressive clinicopathological [email protected] characteristics (tumor size, grade, tumor proliferative activity etc.). Univariate analyses Concetta Saponaro [email protected] were carried out and related Kaplan-Meier curves plotted for NLRP3, PYCARD and TLR4 †These authors contributed have expression.
    [Show full text]
  • A Long Noncoding RNA Distributed in Both Nucleus and Cytoplasm Operates in the PYCARD-Regulated Apoptosis by Coordinating the Epigenetic and Translational Regulation
    RESEARCH ARTICLE A long noncoding RNA distributed in both nucleus and cytoplasm operates in the PYCARD-regulated apoptosis by coordinating the epigenetic and translational regulation 1☯ 1 1 1 2 1 Hui Miao , Linlin Wang , Haomiao ZhanID , Jiangshan Dai , Yanbo ChangID , Fan Wu , 1 3 3 1☯ 1,4 Tao Liu , Zhongyu Liu , Chunfang Gao *, Ling LiID *, Xu Song * a1111111111 1 Center for Functional Genomics and Bioinformatics, Key Laboratory of Bio-Resource and Eco-Environment of Ministry of Education, College of Life Sciences, Sichuan University, Chengdu, Sichuan, China, 2 College a1111111111 of Basic Science and Forensic Medicine, Sichuan University, Chengdu, Sichuan, China, 3 989 Hospital, a1111111111 Luoyang, Henan, China, 4 State Key Laboratory of Biotherapy, West China Hospital, Sichuan University, a1111111111 Chengdu, Sichuan, China a1111111111 ☯ These authors contributed equally to this work. * [email protected] (CG); [email protected] (LL); [email protected] (XS) OPEN ACCESS Abstract Citation: Miao H, Wang L, Zhan H, Dai J, Chang Y, Wu F, et al. (2019) A long noncoding RNA Long noncoding RNAs (lncRNAs) participate in various biological processes such as apo- distributed in both nucleus and cytoplasm operates ptosis. The function of lncRNAs is closely correlated with their localization within the cell. in the PYCARD-regulated apoptosis by While regulatory potential of many lncRNAs has been revealed at specific subcellular loca- coordinating the epigenetic and translational tion, the biological significance of discrete distribution of an lncRNA in different cellular com- regulation. PLoS Genet 15(5): e1008144. https:// doi.org/10.1371/journal.pgen.1008144 partments remains largely unexplored. Here, we identified an lncRNA antisense to the pro- apoptotic gene PYCARD, named PYCARD-AS1, which exhibits a dual nuclear and cyto- Editor: Kevin V Morris, UNITED STATES plasmic distribution and is required for the PYCARD silencing in breast cancer cells.
    [Show full text]
  • Autophagy Regulates Inflammatory Programmed Cell Death Via Turnover of RHIM-Domain Proteins
    RESEARCH ARTICLE Autophagy regulates inflammatory programmed cell death via turnover of RHIM-domain proteins Junghyun Lim1, Hyunjoo Park2, Jason Heisler2, Timurs Maculins1, Merone Roose-Girma3, Min Xu2, Brent Mckenzie2, Menno van Lookeren Campagne4, Kim Newton5, Aditya Murthy1* 1Department of Cancer Immunology, Genentech, South San Francisco, United States; 2Department of Translational Immunology, Genentech, South San Francisco, United States; 3Department of Molecular Biology, Genentech, South San Francisco, United States; 4Department of Immunology, Genentech, South San Francisco, United States; 5Department of Physiological Chemistry, Genentech, South San Francisco, United States Abstract RIPK1, RIPK3, ZBP1 and TRIF, the four mammalian proteins harboring RIP homotypic interaction motif (RHIM) domains, are key components of inflammatory signaling and programmed cell death. RHIM-domain protein activation is mediated by their oligomerization; however, mechanisms that promote a return to homeostasis remain unknown. Here we show that autophagy is critical for the turnover of all RHIM-domain proteins. Macrophages lacking the autophagy gene Atg16l1accumulated highly insoluble forms of RIPK1, RIPK3, TRIF and ZBP1. Defective autophagy enhanced necroptosis by Tumor necrosis factor (TNF) and Toll-like receptor (TLR) ligands. TNF- mediated necroptosis was mediated by RIPK1 kinase activity, whereas TLR3- or TLR4-mediated death was dependent on TRIF and RIPK3. Unexpectedly, combined deletion of Atg16l1 and Zbp1 accelerated LPS-mediated necroptosis
    [Show full text]
  • Upregulation of the NLRC4 Inflammasome Contributes to Poor
    www.nature.com/scientificreports OPEN Upregulation of the NLRC4 infammasome contributes to poor prognosis in glioma patients Received: 13 November 2018 Jaejoon Lim1, Min Jun Kim1, YoungJoon Park2, Ju Won Ahn2, So Jung Hwang1, Accepted: 8 May 2019 Jong-Seok Moon3, Kyung Gi Cho1 & KyuBum Kwack2 Published: xx xx xxxx Infammation in tumor microenvironments is implicated in the pathogenesis of tumor development. In particular, infammasomes, which modulate innate immune functions, are linked to tumor growth and anticancer responses. However, the role of the NLRC4 infammasome in gliomas remains unclear. Here, we investigated whether the upregulation of the NLRC4 infammasome is associated with the clinical prognosis of gliomas. We analyzed the protein expression and localization of NLRC4 in glioma tissues from 11 patients by immunohistochemistry. We examined the interaction between the expression of NLRC4 and clinical prognosis via a Kaplan-Meier survival analysis. The level of NLRC4 protein was increased in brain tissues, specifcally, in astrocytes, from glioma patients. NLRC4 expression was associated with a poor prognosis in glioma patients, and the upregulation of NLRC4 in astrocytomas was associated with poor survival. Furthermore, hierarchical clustering of data from the Cancer Genome Atlas dataset showed that NLRC4 was highly expressed in gliomas relative to that in a normal healthy group. Our results suggest that the upregulation of the NLRC4 infammasome contributes to a poor prognosis for gliomas and presents a potential therapeutic target and diagnostic marker. Glioma represents the most prevalent primary tumor of the central nervous system, with high morbidity and mortality rates. Te standard therapy for gliomas comprises tumor resection and subsequent radiotherapy and chemotherapy with temozolomide in the adjuvant setting1,2.
    [Show full text]