DOCSLIB.ORG

Female Vs Male 13.5 List of Genes.Xlsx

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Female Vs Male 13.5 List of Genes.Xlsx Dimorphically expressed genes in the female versus male comparison at E13.5 Gene Symbol Gene Title Probe Set ID Entrez Gene Gender Enriched Cluster Number* Cluster Order* Tmem109 transmembrane protein 109 1416032_at 68539 M 1 1 Rhbdl2 rhomboid, veinlet-like 2 (Drosophila) 1442819_at 230726 M 1 2 Fam3c family with sequence similarity 3, member C 1448904_at 27999 M 1 3 Stk17b serine/threonine kinase 17b (apoptosis-inducing) 1423452_at 98267 M 1 4 Slc39a8 solute carrier family 39 (metal ion transporter), member 8 1416832_at 67547 M 1 5 Mapre1 microtubule-associated protein, RP/EB family, member 1 1428819_at 13589 M 1 6 Myh9 myosin, heavy polypeptide 9, non-muscle 1420171_s_at 17886 M 1 7 Sash1 SAM and SH3 domain containing 1 1448005_at 70097 M 1 8 Col17a1 collagen, type XVII, alpha 1 1418799_a_at 12821 M 1 9 Reep3 receptor accessory protein 3 1424781_at 28193 M 1 10 Nipbl Nipped-B homolog (Drosophila) 1453576_at 71175 M 1 11 Dym dymeclin 1437141_x_at 69190 M 1 12 Arf3 ADP-ribosylation factor 3 1437331_a_at 11842 M 1 13 Ep400 E1A binding protein p400 1447349_s_at 75560 M 1 14 Cxxc5 CXXC finger 5 1448960_at 67393 M 1 15 Ptpn12 protein tyrosine phosphatase, non-receptor type 12 1450478_a_at 19248 M 1 16 Lgi2 leucine-rich repeat LGI family, member 2 1457040_at 246316 M 1 17 Pan3 PAN3 polyA specific ribonuclease subunit homolog (S. cerevisiae) 1428768_at 72587 M 1 18 Ypel5 yippee-like 5 (Drosophila) 1433593_at 383295 M 1 19 Wbscr27 Williams Beuren syndrome chromosome region 27 (human) 1418359_at 79565 M 1 20 Rgs3 regulator of G-protein signaling 3 1425296_a_at 50780 M 1 21 Rtkn rhotekin 1425601_a_at 20166 M 1 22 Chd1 chromodomain helicase DNA binding protein 1 1457473_at 12648 M 1 23 Swap70 SWA-70 protein 1434225_at 20947 M 1 24 AU040320 expressed sequence AU040320 1452150_at 100317 M 1 25 Iqsec1 IQ motif and Sec7 domain 1 1427145_at 232227 M 1 26 Tyrobp TYRO protein tyrosine kinase binding protein 1450792_at 22177 M 1 27 Vps11 vacuolar protein sorting 11 (yeast) 1428110_x_at 71732 M 1 28 Kctd14 potassium channel tetramerisation domain containing 14 1455452_x_at 233529 M 1 29 Tnfaip1 tumor necrosis factor, alpha-induced protein 1 (endothelial) 1417866_at 21927 M 1 30 Nudt18 nudix (nucleoside diphosphate linked moiety X)-type motif 18 1435902_at 213484 M 1 31 Znf512b zinc finger protein 512B 1436184_at 269401 M 1 32 Btd biotinidase 1417987_at 26363 M 1 33 Fam82a2 family with sequence similarity 82, member A2 1428196_a_at 67809 M 1 34 Pygb brain glycogen phosphorylase 1433504_at 110078 M 1 35 Slc44a2 solute carrier family 44, member 2 1438559_x_at 68682 M 1 36 Cyb5r3 cytochrome b5 reductase 3 1422186_s_at 109754 M 1 37 Mib2 mindbomb homolog 2 (Drosophila) 1424862_s_at 76580 M 1 38 2310044G17Rik RIKEN cDNA 2310044G17 gene 1424915_s_at 217732 M 1 39 Ranbp2 RAN binding protein 2 1422621_at 19386 M 1 40 Pigh phosphatidylinositol glycan anchor biosynthesis, class H 1455860_at 110417 M 1 41 Stradb STE20-related kinase adaptor beta 1433544_at 227154 M 1 42 Gnb2 guanine nucleotide binding protein (G protein), beta 2 1450623_at 14693 M 1 43 Dnajc5 DnaJ (Hsp40) homolog, subfamily C, member 5 1436179_a_at 13002 M 1 44 Amotl1 angiomotin-like 1 1428785_at 75723 M 1 45 Naf1 nuclear assembly factor 1 homolog (S. cerevisiae) 1452192_at 234344 M 1 46 4933403F05Rik RIKEN cDNA 4933403F05 gene 1434979_at 108654 M 1 47 Plscr3 phospholipid scramblase 3 1449020_at 70310 M 1 48 Nfkbia nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha 1449731_s_at 18035 M 1 49 Eif3a eukaryotic translation initiation factor 3, subunit A 1416660_at 13669 M 2 50 Gmeb1 glucocorticoid modulatory element binding protein 1 1456232_at 56809 M 2 51 Mfsd9 major facilitator superfamily domain containing 9 1460619_at 211798 M 2 52 Ctnnd1 catenin (cadherin associated protein), delta 1 1422450_at 12388 M 2 53 Fap fibroblast activation protein 1417552_at 14089 M 2 54 Cpeb2 cytoplasmic polyadenylation element binding protein 2 1434272_at 231207 M 2 55 Dmxl2 Dmx-like 2 1428749_at 235380 M 2 56 Pak3 p21 protein (Cdc42/Rac)-activated kinase 3 1435486_at 18481 M 2 57 Flt1 FMS-like tyrosine kinase 1 1451756_at 14254 M 2 58 Slco5a1 solute carrier organic anion transporter family, member 5A1 1440874_at 240726 M 2 59 Acvr1 activin A receptor, type 1 1416786_at 11477 M 2 60 Map3k7ip3 mitogen-activated protein kinase kinase kinase 7 interacting protein 3 1428762_at 66724 M 2 61 Ubr3 ubiquitin protein ligase E3 component n-recognin 3 1429107_at 68795 M 2 62 Kif13a kinesin family member 13A 1451890_at 16553 M 2 63 Gria3 glutamate receptor, ionotropic, AMPA3 (alpha 3) 1420563_at 53623 M 2 64 Baiap2l1 BAI1-associated protein 2-like 1 1424951_at 66898 M 2 65 BC059842 cDNA sequence BC059842 1440819_s_at 230676 M 2 66 Gm129 predicted gene 129 1435188_at 229599 M 2 67 Fbxo6 F-box protein 6 1417501_at 50762 M 2 68 Msi2 Musashi homolog 2 (Drosophila) 1435521_at 76626 M 2 69 Bche butyrylcholinesterase 1436098_at 12038 M 2 70 --- --- 1430245_at --- M 2 71 Ltbp4 latent transforming growth factor beta binding protein 4 1436665_a_at 108075 M 2 72 Egr2 early growth response 2 1427683_at 13654 M 2 73 Nipal1 NIPA-like domain containing 1 1456321_at 70701 M 2 74 Magi3 membrane associated guanylate kinase, WW and PDZ domain containing 3 1435461_at 99470 M 2 75 Egfr epidermal growth factor receptor 1435888_at 13649 M 2 76 Inadl InaD-like (Drosophila) 1418983_at 12695 M 2 77 Foxc1 forkhead box C1 1419486_at 17300 M 2 78 Enpp5 ectonucleotide pyrophosphatase/phosphodiesterase 5 1425702_a_at 83965 M 2 79 Cds1 CDP-diacylglycerol synthase 1 1456114_at 74596 M 2 80 Serinc5 serine incorporator 5 1433571_at 218442 M 2 81 --- --- 1445758_at --- M 2 82 Vps37a vacuolar protein sorting 37A (yeast) 1419177_at 52348 M 2 83 N4bp1 NEDD4 binding protein 1 1455606_at 80750 M 2 84 Samd8 sterile alpha motif domain containing 8 1434402_at 67630 M 2 85 Eif2c1 eukaryotic translation initiation factor 2C, 1 1434331_at 236511 M 2 86 Slc6a6 solute carrier family 6 (neurotransmitter transporter, taurine), member 6 1437149_at 21366 M 2 87 Myo1c myosin IC 1419648_at 17913 M 2 88 Slit3 Slit homolog 3 (Drosophila) 1427086_at 20564 M 2 89 BC023744 cDNA sequence BC023744 1436591_at 231668 M 2 90 Coro1a coronin, actin binding protein 1A 1416246_a_at 12721 F 3 91 Ddx28 DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 1428702_at 71986 F 3 92 Pla2g12a phospholipase A2, group XIIA 1452026_a_at 66350 F 3 93 Ttc26 tetratricopeptide repeat domain 26 1435401_at 264134 F 3 94 Mrps25 mitochondrial ribosomal protein S25 1418716_at 64658 F 3 95 Ncbp2 nuclear cap binding protein subunit 2 1423045_at 68092 F 3 96 Prpf3 PRP3 pre-mRNA processing factor 3 homolog (yeast) 1424314_at 70767 F 3 97 Tusc4 tumor suppressor candidate 4 1417046_at 56032 F 3 98 Eif1b eukaryotic translation initiation factor 1B 1428272_at 68969 F 3 99 Gm13880 /// Trappc6bpredicted gene 13880 /// trafficking protein particle complex 6B 1428177_at 433458 /// 78232 F 3 100 Bag2 BCL2-associated athanogene 2 1423948_at 213539 F 3 101 Orc2l origin recognition complex, subunit 2-like (S. cerevisiae) 1418226_at 18393 F 3 102 Taf9 TAF9 RNA polymerase II, TATA box binding protein (TBP)-associated factor 1422778_at 108143 F 3 103 Msra methionine sulfoxide reductase A 1448856_a_at 110265 F 3 104 Hmbs hydroxymethylbilane synthase 1426475_at 15288 F 3 105 Dnajc4 DnaJ (Hsp40) homolog, subfamily C, member 4 1417934_at 57431 F 3 106 Arpc4 actin related protein 2/3 complex, subunit 4 1423588_at 68089 F 3 107 Arf1 ADP-ribosylation factor 1 1426390_a_at 11840 F 3 108 Arglu1 arginine and glutamate rich 1 1433597_at 234023 F 3 109 Racgap1 Rac GTPase-activating protein 1 1451358_a_at 26934 F 3 110 Spg21 spastic paraplegia 21 homolog (human) 1451036_at 27965 F 3 111 Ppp1cc protein phosphatase 1, catalytic subunit, gamma isoform 1452046_a_at 19047 F 3 112 Coil coilin 1416692_at 12812 F 3 113 Trim37 tripartite motif-containing 37 1436394_at 68729 F 3 114 Noc4l nucleolar complex associated 4 homolog (S. cerevisiae) 1423826_at 100608 F 3 115 Gle1 GLE1 RNA export mediator (yeast) 1426344_at 74412 F 3 116 Senp2 SUMO/sentrin specific peptidase 2 1451717_s_at 75826 F 3 117 2610306M01Rik RIKEN cDNA 2610306M01 gene 1452988_at 67170 F 3 118 4930453N24Rik RIKEN cDNA 4930453N24 gene 1449718_s_at 67609 F 3 119 Stx18 syntaxin 18 1453819_x_at 71116 F 3 120 Tspan13 tetraspanin 13 1460239_at 66109 F 3 121 Slc25a20 solute carrier family 25 (mitochondrial carnitine/acylcarnitine translocase), member 20 1423109_s_at 57279 F 3 122 Homer3 homer homolog 3 (Drosophila) 1424859_at 26558 F 3 123 Gm5871 /// Smndc1predicted gene 5871 /// survival motor neuron domain containing 1 1443396_at 545792 /// 76479 F 3 124 Smpd2 sphingomyelin phosphodiesterase 2, neutral 1416999_at 20598 F 3 125 5530601H04Rik RIKEN cDNA 5530601H04 gene 1452750_at 71445 F 3 126 Gla galactosidase, alpha 1418248_at 11605 F 3 127 Lrrc57 leucine rich repeat containing 57 1428312_at 66606 F 3 128 Isl2 insulin related protein 2 (islet 2) 1418676_at 104360 F 3 129 Dusp11 dual specificity phosphatase 11 (RNA/RNP complex 1-interacting) 1452594_at 72102 F 3 130 B3gnt5 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 5 1420993_at 108105 F 3 131 Eif2s3x eukaryotic translation initiation factor 2, subunit 3, structural gene X-linked 1423744_x_at 26905 F 3 132 Eif2s3x eukaryotic translation initiation factor 2, subunit 3, structural gene X-linked 1451090_a_at 26905 F 3 133 2610029G23Rik RIKEN cDNA 2610029G23 gene 1417921_at 67683 F 3 134 Mrps9 mitochondrial ribosomal protein S9 1435843_x_at 69527 F 3 135 Eif2s3x /// LOC100048746eukaryotic translation
Load more

Recommended publications
  • CORVET, CHEVI and HOPS – Multisubunit Tethers of the Endo
    © 2019. Published by The Company of Biologists Ltd | Journal of Cell Science (2019) 132, jcs189134. doi:10.1242/jcs.189134 REVIEW SUBJECT COLLECTION: CELL BIOLOGY AND DISEASE CORVET, CHEVI and HOPS – multisubunit tethers of the endo-lysosomal system in health and disease Jan van der Beek‡, Caspar Jonker*,‡, Reini van der Welle, Nalan Liv and Judith Klumperman§ ABSTRACT contact between two opposing membranes and pull them close Multisubunit tethering complexes (MTCs) are multitasking hubs that together to allow interactions between SNARE proteins (Murray form a link between membrane fusion, organelle motility and signaling. et al., 2016). SNARE assembly then provides additional fusion CORVET, CHEVI and HOPS are MTCs of the endo-lysosomal system. specificity and drives the actual fusion process (Ohya et al., 2009; They regulate the major membrane flows required for endocytosis, Stroupe et al., 2009). In this Review, we focus on the role of tethering lysosome biogenesis, autophagy and phagocytosis. In addition, proteins in endo-lysosomal fusion events. individual subunits control complex-independent transport of specific Tethering proteins can be divided into two main groups: long cargoes and exert functions beyond tethering, such as attachment to coiled-coil proteins (Gillingham and Munro, 2003) and microtubules and SNARE activation. Mutations in CHEVI subunits multisubunit tethering complexes (MTCs). MTCs form a lead to arthrogryposis, renal dysfunction and cholestasis (ARC) heterogenic group of protein complexes that consist of up to ten ∼ syndrome, while defects in CORVET and, particularly, HOPS are subunits resulting in a general length of 50 nm (Brocker et al., associated with neurodegeneration, pigmentation disorders, liver 2012; Chou et al., 2016; Hsu et al., 1998; Lürick et al., 2018; Ren malfunction and various forms of cancer.
    [Show full text]
  • (PAD) and Post-Translational Protein Deimination—Novel Insights Into Alveolata Metabolism, Epigenetic Regulation and Host–Pathogen Interactions
    biology Article Peptidylarginine Deiminase (PAD) and Post-Translational Protein Deimination—Novel Insights into Alveolata Metabolism, Epigenetic Regulation and Host–Pathogen Interactions Árni Kristmundsson 1,*, Ásthildur Erlingsdóttir 1 and Sigrun Lange 2,* 1 Institute for Experimental Pathology at Keldur, University of Iceland, Keldnavegur 3, 112 Reykjavik, Iceland; [email protected] 2 Tissue Architecture and Regeneration Research Group, School of Life Sciences, University of Westminster, London W1W 6UW, UK * Correspondence: [email protected] (Á.K.); [email protected] (S.L.) Simple Summary: Alveolates are a major group of free living and parasitic organisms; some of which are serious pathogens of animals and humans. Apicomplexans and chromerids are two phyla belonging to the alveolates. Apicomplexans are obligate intracellular parasites; that cannot complete their life cycle without exploiting a suitable host. Chromerids are mostly photoautotrophs as they can obtain energy from sunlight; and are considered ancestors of the apicomplexans. The pathogenicity and life cycle strategies differ significantly between parasitic alveolates; with some causing major losses in host populations while others seem harmless to the host. As the life cycles of Citation: Kristmundsson, Á.; Erlingsdóttir, Á.; Lange, S. some are still poorly understood, a better understanding of the factors which can affect the parasitic Peptidylarginine Deiminase (PAD) alveolates’ life cycles and survival is of great importance and may aid in new biomarker discovery. and Post-Translational Protein This study assessed new mechanisms relating to changes in protein structure and function (so-called Deimination—Novel Insights into “deimination” or “citrullination”) in two key parasites—an apicomplexan and a chromerid—to Alveolata Metabolism, Epigenetic assess the pathways affected by this protein modification.
    [Show full text]
  • (Bag3) and Its P209L Mutant
    Characterization and interaction studies of Bcl-2-associated athanogene 3 (Bag3) and its P209L mutant Jeffrey Li Department of Biochemistry McGill University, Montreal August 2018 A thesis submitted to McGill University in partial fulfillment of the requirements of the degree of Master of Science © Jeffrey Li 2018 1 Abstract: A genetic form of myofibrillar myopathy (MFM) has been linked to a P209L mutation in Bag3, with patients exhibiting childhood-onset progressive skeletal muscle weakness and associated cardiomyopathy. Microscopy studies on MFM patients show myofibril disintegration beginning at the Z-disk and formation of protein aggregates. Bag3 is a member of the BAG family of Hsp70 nucleotide exchange factors, and is associated with a number of pathways, such as selective autophagy, aggresome formation and Hippo pathway regulation. Previous work in zebrafish suggests Bag3-P209L is aggregation-prone and can sequester wildtype Bag3 into aggregates, leading to a loss of Bag3 function. How a loss in Bag3 function leads to the disease is unknown. We identified changes in Bag3 phosphorylation at residues linked to regulation of the heat shock response. BioID comparison of wildtype Bag3 and Bag3-P209L interactors in the soluble and insoluble fraction show potential changes in pathways such as autophagy, Hippo and Wnt pathway regulation, signal transduction, and actin cytoskeleton maintenance. Interestingly, a Bag3 function in Wnt signaling has never been reported. With these findings, we propose several hypotheses describing how the observed gain and loss of interaction caused by the P209L mutation may affect Bag3-associated pathways, and how these aberrancies could contribute to the MFM phenotype. 2 Résumé: Une forme génétique de la myopathie myofibrillaire (MMF) a été liée à une mutation P209L dans la protéine Bag3.
    [Show full text]
  • Identifying Loci Under Positive Selection in Complex Population Histories
    bioRxiv preprint doi: https://doi.org/10.1101/453092; this version posted October 25, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Identifying loci under positive selection in complex population histories Alba Refoyo-Martínez1, Rute R. da Fonseca2, Katrín Halldórsdóttir3, Einar Árnason3;4, Thomas Mailund5, Fernando Racimo1;∗ 1 Centre for GeoGenetics, Natural History Museum of Denmark, University of Copenhagen, Denmark. 2 Centre for Macroecology, Evolution and Climate, Natural History Museum of Denmark, University of Copenhagen, Denmark. 3 Institute of Life and Environmental Sciences, University of Iceland, Reykjavík, Iceland. 4 Department of Organismic and Evolutionary Biology, Harvard University, Cambridge, USA. 5 Bioinformatics Research Centre, Aarhus University, Denmark. * Corresponding author: [email protected] October 25, 2018 Abstract Detailed modeling of a species’ history is of prime importance for understanding how natural selection operates over time. Most methods designed to detect positive selection along sequenced genomes, however, use simplified representations of past histories as null models of genetic drift. Here, we present the first method that can detect signatures of strong local adaptation across the genome using arbitrarily complex admixture graphs, which are typically used to describe the history of past divergence and admixture events among any number of populations. The method—called Graph-aware Retrieval of Selective Sweeps (GRoSS)—has good power to detect loci in the genome with strong evidence for past selective sweeps and can also identify which branch of the graph was most affected by the sweep.
    [Show full text]
  • HOPS-Dependent Endosomal Fusion Required for Efficient Cytosolic Delivery of Therapeutic Peptides and Small Proteins
    HOPS-dependent endosomal fusion required for efficient cytosolic delivery of therapeutic peptides and small proteins Angela Steinauera, Jonathan R. LaRochelleb, Susan L. Knoxa, Rebecca F. Wissnera, Samuel Berryc, and Alanna Schepartza,b,1 aDepartment of Chemistry, Yale University, New Haven, CT 06520-8107; bDepartment of Molecular, Cellular and Developmental Biology, Yale University, New Haven, CT 06520-8103; and cDepartment of Molecular Biophysics and Biochemistry, Yale University, New Haven, CT 06520-8114 Edited by James A. Wells, University of California, San Francisco, CA, and approved November 26, 2018 (received for review July 17, 2018) Protein therapeutics represent a significant and growing compo- Recently, we discovered that, when added to cells, certain small, nent of the modern pharmacopeia, but their potential to treat folded miniature proteins (9, 10) derived from avian pancreatic human disease is limited because most proteins fail to traffic polypeptide (aPP) or an isolated zinc-finger (ZF) domain, are across biological membranes. Recently, we discovered a class of taken up into the endocytic pathway and subsequently released cell-permeant miniature proteins (CPMPs) containing a precisely into the cytosol with unprecedented efficiencies (11, 12). The most defined, penta-arginine (penta-Arg) motif that traffics readily to effective molecules are defined by a discrete array of five arginine the cytosol and nucleus of mammalian cells with efficiencies that residues on a folded α-helix (13); we refer to these molecules as rival those of hydrocarbon-stapled peptides active in animals and cell-permeant miniature proteins (CPMPs). Treatment of HeLa man. Like many cell-penetrating peptides (CPPs), CPMPs enter the cells in culture with the CPMP ZF5.3 leads to a ZF5.3 concen- endocytic pathway; the difference is that CPMPs containing a penta- tration in the cytosol that is roughly 67% of the extracellular in- Arg motif are released efficiently from endosomes, while other CPPs cubation concentration; this value is at least 10-fold higher than are not.
    [Show full text]
  • Membrane Trafficking in the Yeast Saccharomyces Cerevisiae Model
    Int. J. Mol. Sci. 2015, 16, 1509-1525; doi:10.3390/ijms16011509 OPEN ACCESS International Journal of Molecular Sciences ISSN 1422-0067 www.mdpi.com/journal/ijms Review Membrane Trafficking in the Yeast Saccharomyces cerevisiae Model Serge Feyder, Johan-Owen De Craene, Séverine Bär, Dimitri L. Bertazzi and Sylvie Friant * Department of Molecular and Cellular Genetics, UMR7156, Université de Strasbourg and CNRS, 21 rue Descartes, Strasbourg 67084, France; E-Mails: [email protected] (S.F.); [email protected] (J.-O.D.C.); [email protected] (S.B.); [email protected] (D.L.B.) * Author to whom correspondence should be addressed; E-Mail: [email protected]; Tel.: +33-368-851-360. Academic Editor: Jeremy C. Simpson Received: 14 October 2014 / Accepted: 19 December 2014 / Published: 9 January 2015 Abstract: The yeast Saccharomyces cerevisiae is one of the best characterized eukaryotic models. The secretory pathway was the first trafficking pathway clearly understood mainly thanks to the work done in the laboratory of Randy Schekman in the 1980s. They have isolated yeast sec mutants unable to secrete an extracellular enzyme and these SEC genes were identified as encoding key effectors of the secretory machinery. For this work, the 2013 Nobel Prize in Physiology and Medicine has been awarded to Randy Schekman; the prize is shared with James Rothman and Thomas Südhof. Here, we present the different trafficking pathways of yeast S. cerevisiae. At the Golgi apparatus newly synthesized proteins are sorted between those transported to the plasma membrane (PM), or the external medium, via the exocytosis or secretory pathway (SEC), and those targeted to the vacuole either through endosomes (vacuolar protein sorting or VPS pathway) or directly (alkaline phosphatase or ALP pathway).
    [Show full text]
  • The Male Germ Cell Gene Regulator CTCFL Is Functionally Different from CTCF and Binds CTCF-Like Consensus Sites in a Nucleosome Composition-Dependent Manner
    UCLA UCLA Previously Published Works Title The male germ cell gene regulator CTCFL is functionally different from CTCF and binds CTCF-like consensus sites in a nucleosome composition-dependent manner Permalink https://escholarship.org/uc/item/455607cf Journal Epigenetics & Chromatin, 5(1) ISSN 1756-8935 Authors Sleutels, Frank Soochit, Widia Bartkuhn, Marek et al. Publication Date 2012-06-18 DOI http://dx.doi.org/10.1186/1756-8935-5-8 Peer reviewed eScholarship.org Powered by the California Digital Library University of California Sleutels et al. Epigenetics & Chromatin 2012, 5:8 http://www.epigeneticsandchromatin.com/content/5/1/8 RESEARCH Open Access The male germ cell gene regulator CTCFL is functionally different from CTCF and binds CTCF-like consensus sites in a nucleosome composition-dependent manner Frank Sleutels1*, Widia Soochit1, Marek Bartkuhn2, Helen Heath1, Sven Dienstbach2, Philipp Bergmaier2, Vedran Franke3, Manuel Rosa-Garrido4,5, Suzanne van de Nobelen1, Lisa Caesar1, Michael van der Reijden1, Jan Christian Bryne3, Wilfred van IJcken6, J Anton Grootegoed7, M Dolores Delgado4, Boris Lenhard3, Rainer Renkawitz2, Frank Grosveld1,8,9 and Niels Galjart1,8,9* Abstract Background: CTCF is a highly conserved and essential zinc finger protein expressed in virtually all cell types. In conjunction with cohesin, it organizes chromatin into loops, thereby regulating gene expression and epigenetic events. The function of CTCFL or BORIS, the testis-specific paralog of CTCF, is less clear. Results: Using immunohistochemistry on testis sections and fluorescence-based microscopy on intact live seminiferous tubules, we show that CTCFL is only transiently present during spermatogenesis, prior to the onset of meiosis, when the protein co-localizes in nuclei with ubiquitously expressed CTCF.
    [Show full text]
  • Transcriptome Analysis of Nautilus and Pygmy Squid Developing Eye Provides Insights in Lens and Eye Evolution
    Transcriptome Analysis of Nautilus and Pygmy Squid Developing Eye Provides Insights in Lens and Eye Evolution Konstantinos Sousounis1, Atsushi Ogura2*, Panagiotis A. Tsonis1* 1 Department of Biology and Center for Tissue Regeneration and Engineering, University of Dayton, Dayton, Ohio, United States of America, 2 Ochadai Academic Production, Ochanomizu University, Tokyo, Japan Abstract Coleoid cephalopods like squids have a camera-type eye similar to vertebrates. On the other hand, Nautilus (Nautiloids) has a pinhole eye that lacks lens and cornea. Since pygmy squid and Nautilus are closely related species they are excellent model organisms to study eye evolution. Having being able to collect Nautilus embryos, we employed next-generation RNA sequencing using Nautilus and pygmy squid developing eyes. Their transcriptomes were compared and analyzed. Enrichment analysis of Gene Ontology revealed that contigs related to nucleic acid binding were largely up-regulated in squid, while the ones related to metabolic processes and extracellular matrix-related genes were up-regulated in Nautilus. These differences are most likely correlated with the complexity of tissue organization in these species. Moreover, when the analysis focused on the eye-related contigs several interesting patterns emerged. First, contigs from both species related to eye tissue differentiation and morphogenesis as well as to cilia showed best hits with their Human counterparts, while contigs related to rabdomeric photoreceptors showed the best hit with their Drosophila counterparts. This bolsters the idea that eye morphogenesis genes have been generally conserved in evolution, and compliments other studies showing that genes involved in photoreceptor differentiation clearly follow the diversification of invertebrate (rabdomeric) and vertebrate (ciliated) photoreceptors.
    [Show full text]
  • Integrative Functional Analyses of the Neurodegenerative Disease-Associated TECPR2 Gene Reveal Its Diverse Roles
    Integrative functional analyses of the neurodegenerative disease-associated TECPR2 gene reveal its diverse roles Ido Shalev Ben-Gurion University of the Negev Judith Somekh University of Haifa Alal Eran ( [email protected] ) Ben-Gurion University of the Negev https://orcid.org/0000-0001-6784-7597 Research article Keywords: Integrative functional analysis, neurodegenerative disorders, autophagy, ribosome, TECPR2 Posted Date: January 30th, 2020 DOI: https://doi.org/10.21203/rs.2.22274/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 1/23 Abstract Background Loss of tectonin β-propeller repeat-containing 2 (TECPR2) function has been implicated in an array of neurodegenerative disorders, yet its physiological function remains largely unknown. Understanding TECPR2 function is essential for developing much needed precision therapeutics for TECPR2-related diseases. Methods We leveraged the considerable amounts of functional data to obtain a comprehensive perspective of the role of TECPR2 in health and disease. We integrated expression patterns, population variation, phylogenetic proling, protein-protein interactions, and regulatory network data for a minimally biased multimodal functional analysis. Genes and proteins linked to TECPR2 via multiple lines of evidence were subject to functional enrichment analyses to identify molecular mechanisms involving TECPR2. Results TECPR2 was found to be part of a tight neurodevelopmental gene expression program that includes KIF1A, ATXN1, TOM1L2, and FA2H, all implicated in neurological diseases. Functional enrichment analyses of TECPR2-related genes converged on a role in late autophagy and ribosomal processes. Large-scale population variation data demonstrated that this role is nonredundant. Conclusions TECPR2 might serve as an indicator for the energy balance between protein synthesis and autophagy, and a marker for diseases associated with their imbalance, such as Alzheimer’s disease, Huntington’s disease, and various cancers.
    [Show full text]
  • Pnas.201320629SI.Pdf
    Supporting Information Pirooz et al. 10.1073/pnas.1320629111 SI Materials and Methods Plasmid Constructs. The Flag-, HA-, or GST-tagged WT UVRAG Cell Culture. NIH 3T3, HeLa, HCT116, African green monkey and the UVRAGC2, UVRAGCCD (CCD, coiled-coil domain), Δ kidney epithelial Vero cells, BHK-21, immortalized mouse em- UVRAG270-CT (270-CT, 270-C-terminal), UVRAG C2, and Δ bryonic fibroblasts, and HEK 293T cells were cultured in DMEM UVRAG CCD mutants and the HA-tagged vacuolar protein supplemented with 10% (vol/vol) FBS, 2 mM L-glutamine, and 1% sorting 16 (Vps16) and Vps18 plasmids used in this study have penicillin/streptomycin (Gibco–BRL). Transient transfection was been described in our previous work (2). All constructs were performed with Fugene 6 (Roche), Lipofectanine 2000 (In- confirmed by sequencing, using an ABI PRISM 377 automatic vitrogen), or calcium phosphate (Clontech). NIH 3T3, HeLa, and DNA sequencer (Applied Biosystems). HCT116 stable cell lines were established using a standard pro- tocol of selection with 2 μg/mL puromycin (Sigma–Aldrich), as Antibodies, Fluorescent Dyes, and Reagents. The following anti- described previously (1, 2). UV-radiation resistance-associated bodies were used in this study: polyclonal rabbit anti-UVRAG + + + − gene (UVRAG) / (E14TG2a.4) and UVRAG / (AC0571) (U7058; Sigma–Aldrich) at 1:1,000, monoclonal mouse anti- feeder-free mouse ES cells were obtained from the Mutant UVRAG (SAB4200005; Sigma–Aldrich) at 1:200, polyclonal Mouse Regional Resource Center (MMRRC) and maintained goat anti–VSV-glycoprotein G (VSV-G; sc-138076; Santa Cruz at a comparable passage in Glasgow Minimum Essential Biotechnology) at 1:500, anti-VSVM (8G5F11; KeraFAST), Medium (Sigma) with 15% (vol/vol) FBS (Invitrogen), following polyclonal rabbit Atg5 (2630; Cell Signaling) at 1:1,000, monoclonal the MMRRC’s cell culture protocol (www/mmrrc.org/strains/E14/ rabbit Atg7 (NBP1-95872; Novus Biologicals) at 1:1,000, polyclonal ctr_protocol.pdf).
    [Show full text]
  • Product Datasheet: ARP61122 P050
    Aviva Systems Biology STX7 antibody - N-terminal region (ARP61122_P050) Product Number ARP61122_P050 Product Page http://www.avivasysbio.com/stx7-antibody-n-terminal-region-arp61122-p050.html Product Name STX7 antibody - N-terminal region (ARP61122_P050) Size 100 ul Gene Symbol STX7 Alias Symbols - Protein Size (# AA) 261 amino acids Molecular Weight 30kDa Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. NCBI Gene Id 8417 Host Rabbit Clonality Polyclonal Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml Official Gene Full Syntaxin 7 Name Description This is a rabbit polyclonal antibody against STX7. It was validated on Western Blot by Aviva Systems Biology. At Aviva Systems Biology we manufacture rabbit polyclonal antibodies on a large scale (200-1000 products/month) of high throughput manner. Our antibodies are peptide based and protein family oriented. We usually provide antibodies covering each member of a whole protein family of your interest. We also use our best efforts to provide you antibodies recognize various epitopes of a target protein. For availability of antibody needed for your experiment, please inquire ([email protected]). Peptide Sequence Synthetic peptide located within the following region: PSEQRQRKIQKDRLVAEFTTSLTNFQKVQRQAAEREKEFVARVRASSRVS Description of STX7 may be involved in protein trafficking from the plasma membrane to the early Target endosome (EE) as well as in homotypic fusion of endocytic organelles. STX7 mediates the endocytic trafficking from early endosomes to late endosomes and lysosomes. Protein Interactions STX4; ATP4A; UBL4A; UBC; SYNPO2; CHCHD4; MRPL53; SARNP; SUGP1; CDV3; SBDS; TIMM10B; RAB31; PPIF; SCO2; SNX3; SOD2; SCP2; RPS19; RBMS1; NDUFA7; SERPINH1; ELAVL1; MAPK6; NSF; VPS16; VPS11; SNAP29; VPS18; STX6; STX8; NAPA; VTI1B; VAMP8; ENTPD2; VAMP7; GTF2I; Reconstitution and For short term use, store at 2-8C up to 1 week.
    [Show full text]
  • Tads Structure and Characteristics of Associated Genes in Probands With
    TADs structure and characteristics of associated genes in probands with phenotype not explained by the directly disrupted gene(s) Figure: Visual representation of TADs. The colours next to the genes, represent DOMINO score and pLI score, respectively. On the upper part of each figure the colours represent the number of interactions between loci in the genome Table: Topologically Associating Domain (TADs) structure in the proximity of BCT breakpoints Domain – 0: same as breakpoint, +1: adjacent to breakpoint towards the telomere, -1 : adjacent to breakpoint towards the centromere. Distance from breakpoint- distance vs. 5’ or 3’ end of the coding sequence of the gene (whatever shorter). OMIM#, disease, inheritance -Information about inheritance from OMIM (https://omim.org/); AD - Autosomal dominant inheritance, AR- Autosomal recessive inheritance. pLI - from http://exac.broadinstitute.org/ DOMINO – The score taken from DOMINO database (Quinodoz M, Royer-Bertrand B, Cisarova K, Di Gioia SA, Superti-Furga A, Rivolta C. DOMINO: Using Machine Learning to Predict Genes Associated with Dominant Disorders. Am J Hum Genet 2017;101(4):623-29. doi: 10.1016/j.ajhg.2017.09.001) Mouse phenotype - from http://www.informatics.jax.org Proband 1 page 1 of 1 46,XY,t(5;8)(q21.3:q11.21), chr5 46,XY,t(5;8)(q21.3:q11.21), chr8 Distance from breakpoint Comments (HGMD, mouse Breakpoint Gene OMIM#, disease, inheritance pLI DOMINO (bp)/domain phenotype) 46,XY,t(5;8)(q21.3:q11.21), FBXL17 (MIM: 609083), F-box +446,390 / +1 low confidence, early onset NA 0,98 0,68
    [Show full text]