DOCUMENT RESUME

ED 476 674 IR 058 731

AUTHOR Heard, Adriana Flores; Ingham, Donna; McDermott, Joe; Meyer, Sally; Parrish, Leila; Schill, Victor; Trevino, Rose TITLE Mission Possible: Spy a Book! 2003 Texas Reading Club Manual. INSTITUTION Texas State Library, Austin. Library Development Div. PUB DATE 2003-00-00 NOTE 311p.; For the 2002 Reading Club Manual, see ED 475 284. AVAILABLE FROM Texas State.Library & Archives Commission, P.O. Box 12927 Austin, TX 78711. Tel: 512-463-5465; e-mail: [email protected]; Web site:

http://www.tsl.state.tx.us/ld/projects/trc/index.html/ . PUB TYPE Guides Non-Classroom (055) Reference Materials Bibliographies (131) EDRS PRICE EDRS Price MF01/PC13 Plus Postage. DESCRIPTORS *Adolescent Literature; Adolescents; Children; *Childrens Libraries; *Childrens Literature; Elementary Secondary Education; *Library Services; *Public Libraries; *Reading Programs IDENTIFIERS Clip Art

ABSTRACT The purpose of this manual for the 2003 Texas Reading Club, "Mission Possible: Spy a Book!" is to assist library staff who serve youth by suggesting ideas for programs that will attract children to the library. The following chapters are included:(1) Marketing, Cooperation and PR; (2) Serving Children with Disabilities;(3) Theme Songs;(4) Celebrations; (5) Stories, Puppet Plays, and Reader's Theater Scripts;(6) Bilingual Programs; (7) Toddler Programs;(8) Preschool Programs;(9) Elementary School Programs; and (10) Young Adult Programs. The programs feature a combination of the following components: books to share, show, and booktalk; bulletin boards, displays, and decorations; fingerplays, rhymes, poems, and songs; riddles, and jokes; crafts, games, and activities; guest speakers; musical recordings, videos, Web sites, and CD-ROMs; and reader's theater scripts, puppet shows, stories, or citations to books in which they may be located. Bibliographic information for titles in all chapters and in all formats is compiled at the end of the manual in the bibliography. The bibliography is divided into sections for books, magazines, videos, audio recordings, and CD-ROMs. Clip art by G. Brian Karas is included and may be used for crafts, programs, or to decorate the library.(MES)

Reproductions supplied by EDRS are the best that can be made from the original document nizotoli Poo/lie: 2003 Texas ReacC1219 ClolD nantrat Sp9 A book! AdrianaSally Meyer Flores * HeardLeila Parrish * Donna * Victor Ingham Schill * Joe * Rose McDermott Trevino Written by: DISSEMINATEPERMISSION TO THIS REPRODUCE MATERIAL HASAND Craft Patterns and Illustrations by: Steven P Trevino EDUCATIONALOffice RESOURCES of Educational INFORMATION ResearchU.S. andDEPARTMENT Improvement OF EDUCATION CENTER (ERIC) E. Seidenberg BEEN GRANTED BY Clip Art by: G. Brian Karas 0 Minor changes have been Thismadeoriginatingreceived document toimprove from it. hasreproduction the been person reproduced,as quality.or organization TO THE EDUCATIONAL RESOURCESINFORMATION CENTER (ERIC) Edited by: Christine E. McNew documentPointsofficial of view doOERI not or position opinionsnecessarily or stated policy. represent in this of thePublished Texas State by: Library The Library and Archives Development Commission Division Austin, Texas 2003 TEXAS STATE LIBRARY AND ARCHIVES COMMISSION CATALOGING IN PUBLICATION DATA patternsClubMission manual possible, and illustrations/ written spy aBook!by Adrianaby Steven :2003 Flores TexasP. Trevino Heard... Reading ; clip [et artal.] by ; craft G. ArchivesLibraryBrian Karas Commission, Development ; edited 2003.by Division, ChristineIncludesp. ; cm. Texas E. bibliographicalMc State New. Library references. and (Texas reading club ; 2003) Austin, Tex. : I.1. Heard, AdrianaTexas Flores. State"Sponsored Library andcooperativelyChildrenBooks Archives Commission" by and your reading. library and 2. Children'sthe libraries. II. Trevino, Steven P. III. Karas, G. Brian. p. ??? Z1037ReadingCommission.IV. McNew, Club Christine. Librarymanual. Development V. VII. Texas Series. State Division. Library VI.and 2001 Archives Texas 028.534 T312 2003 512-463-5460toComments the Director or or complaintsand 512-463-5436 Librarian, regarding P.O. fax Box the 12927, programs Austin,Texas and services 78711-2927 of the Texas State Library and Archives Commission can be addressed n1001011 PoZZODie: Preface Reatitv.5 Glib nap-tat 1 Bilingual Programs spy a Bo 60 AboutAbout the the Illustrator, Authors G. Brian Karas 42 ToddlerPreschool Programs Programs 148120 Marketing,Introduction Cooperation, and PR 10 7 YoungElementary Adult Programs School Programs 213184 ThemeServing Songs Children with Disabilities 1614 AcceptableBibliography Use of Clipart 274233 andStories,Celebrations Reader's Puppet Theater Plays, Scripts 5019 Clip Art 275 11, tootov. Pozoilie: 2Teface spy a 130 theme,program "Mission of the Texas Possible: State Spy Library a Book!" and Archives invites children Commission. to explore This manual is created for the 2003 Texas Reading Club, a The of-summerA Celebrations celebrations. chapter with suggestions for kick-off and end- partnershipshistory,individual cultures, throughchapters adventures, the in theirportal spies,areas of books ofsecret interest and codes, their and mysteries,local expertise.In libraries. the and 2003These manual, Texas children's librarians have written exciting ideas for planning and hosting an enjoyableIf and you successful explore this manualbasedA thoroughly, suggestion on the theme,youin the will for "Operation find a separate many Top Young Secret!" Adult reading club Authors."aboutsuggestionsmost talented the authors for and wonderful inenthusiastic the section age-appropriate librarians of this manual contributed programs. entitled, Pleasea vast "About arrayread the of 2003readingcontributed Texas this Reading theirmanual, ideas Club. to toShawn this manual, Clements Belinda for the Boon beautiful Ifor would proof- formatting, like to express my gratitude to all of the authors who andtrc/index.html.at the Sally Texas Meyers State Recordings Librarywill be includedweb of thesite theme atin www.tsl.state.tx.usild/projects/addition songs toby the Joe Theinformation McDermott 2003 Texas in Reading Club manual will be available online thecontributingbilingualto Myra craft Arredondo patternschapter outstanding writtenand and illustrations, Paolo andby Rose original Ferate-Soto Trevino, to ideas,G. Brian forto to allproofreadingSteven Karas of the forP. authors Trevino his the delight- for for Clubthe print manual manual. including: There are many exciting elementsA chapter in thefeaturing 2003 Texas puppet Reading plays, stories, and reader's thisful clip program art, and year especially after year. to the many children's librariansChristine who hostE. McNew theatervariousA Bilingual scripts. ages. Programs chapter with programs for children of TexasSeptember,Youth State Services Library 2002 Consultant and Archives Commission MOZtol 20001iie: 5)09 aaras 13o k. comediesG. Brian to Karas hip hop has renditions illustrated of a Cinderellawide range and of books SleepingFrom for children.Beauty, bedtime lullabies to westerns, classroom dramas and kl,orpt the Illustrator, sculpture.maycouldn't have figure beenI recovered ita outmessage and and was thatheld too my the deflated futuretitle of was toClass explain in illustrationArtist it allthroughout G.to andher. BriarnotIt andauthoringHisBook theoverillustrated illustrator,Boston for seventy Children byGlobe/Horn booksHomeMr. in Karas, 2001haveOn BookThe waswonand Bayou. received Honoramany Smithsonian The awardsin the 1997 Class Oppenheim and Magazine'sfor Artist, honors,his first also Toy includ-Notablebook written Portfo- as children'sAnothertomy art school school passion books years, and byofquiteyet minethat I neverearly time was on considered Ireading still decided remembered and whichart though as adirection career.vividly I was But beyondtheto go Idifferent did in. go aSteenlio CapitolChildren's 2002 received Best Choices Books Book a Blue Noteworthy inGold Ribbon2001 Award. and from Book Saving Car the for Wash BulletinSweetness Children by Sandraof in bythe 1996, Diane Center and received Susan Stanley for awas createare,met.worlds and The as children's I vivid imagesthought an from booksimpressionthat Ithose wouldtook books mefor like tosomeone weretoand do the etchednothing else. wonderful Illustratingin more my mind,characters than children's trythey to Istill wasBulletin a School of the Library Center Journalfor Children's Best Book Books of Blue1996. Ribbon"MyHere's in 1996,sister what andtaught Brian me has my to say:first drawing lessons. I was 5. We drew waschildren'sthosebooks fortunate wonderful also stories. gave to havemeplaces I went a manygreat with to Paierexcuse fineall those teachers School to wonderfulspend ofwho Artmy were in adultcharacters Connecticut children's life back in book andin all Mythinkmovedpilgrims. first they on setback I from werecaught pilgrims sowas onfunny). inquickly Kindergarten to Ifunny became and portraits drawing a when confident of becameafter my artisthavingsister a passion. at(who aa weekyoung didn't I to age. livedalwaysingillustrators. infor Kansas children.a challenge, They City, Although gave New I can me York, think aat good times andof backgroundno itPhoenix. canoccupation be frustrating, He in hasthemore workedBrianfield rewarding." slow, of grew publish-in and up in a small town in Connecticut. After college, he longforinchproduce her cut-outattempt to the know best tipi.to constructthat workMy the teacher we little a could, three tipiwas dimensionalwas allnot I impressedreallyhad to the show life-size outcome but was there tipi. a of meagerwas Ia justweek- no 3-way ofLloydop many anin Newold Wright interesting lodge York house on City, Camelback studios in a thesculptor's desert,including Mountain loftand a ona sewing small inSeattle's Phoenix. cottage factory-turned waterfront, Brian on the now grounds aartists Frank lives co- Lucy.children,in the Hudson Bennett Valley and of Zachary, New York their with large his dog, wife, Otto, Sue, andtheir small two cat, SavingSleepless Sweetness Beauty by by Frances Diane Stanley. Minters. Putnam, Viking, 1996.1996. Bebe's Bad Dream by G. Brian Karas. Greenwillow,G.Selected 2000. Brian KarasChildren's Books Written and/or Illustrated by The WindySeals on Day the by Bus G. by Brian Lenny Karas. Hort. Simon Henry & Holt, Schuster, 2000. 1998. CarCinder-Elly Wash by Sandra by Frances Steen. Minters. Putnam, Viking, 2002. 1994. HomeHigh-Rise on the Private Bayou Eyes: by G.The Brian Case Karas. of the PuzzlingSimon & Possum Schuster. by 1996. Cynthia Rylant. Greenwillow, 2001. LikeI Know Butter an Old on PancakesLady by Jonathanby Jonathan London. London. Scholastic, Puffin, 1998. 1995. Muncha!On the TrailMuncha! With Muncha! Miss Pace by by Denise Sharon Fleming. Phillips Denslow.Simon and Simon & Schuster, 2002. RaisingPrincess Sweetness Fishtail by by Frances Diane Minters.Stanley. Putnam,Viking 2002. 1999. Schuster, 1995. 2000t1)1.0:klpout spy the Atitiyyro a Bid chapter,Act Tialla. graduated Flores Heard with an MLIS from the UniversityAdriana of Texas Flores at Heard, author of the Young Adult Programs Joecanof neDev2ott Native settlers. Americans and Hispanic, European, and African-Ameri- thesevenHeardAustin Assistant years haswith worked ina Manager specialization a variety for the at of theSan positions inWestfall Antonio children and Public Public and locations. youth Library Library services.Currently and for createsthe Ms. shepast is allyhassible," writtendistributed is a nationallyand CD,released I acclaimedAm five Baby, children's recordingwon a Parent'srecordings. artist Choice basedJoe His McDermott, infirstRecom- Texas. nation- He composer of the theme song, "Mission Pos- co thereadingServicesintegralprograms Teen program,part departmentFriends. and in resources creating aShe monthly which is the anfor SanALA/YALSA includes teensbook Antonio andclub, annual adults. a Public teen Serving Young Ms. advisory Library's Heardthe Adult Underserved hoard, playedfirst summer Youth and an throughteacherteemedmended Parent's forliveHonor. seven performances ChoiceHis years 2001 Awardand release, is his unparalleled Silverinteraction Great Honor. Big inwith World Joethe children children'swas won a Montessori the and entertain- es- parents DonnaTrainer Ingham and offers workshops for librarians who workDonna with teens. Ingham is the author of the story, "Mollie Bailey Was a caughtMatterswithment theJoeindustry.show attentionto composein the He fall ofwas authors10 of featured songs2001. Stan basedHis on and uniqueDiscovery on Jan their Berenstainsongwriting Berenstain Channel's who talents BearsHome worked books. willschools,travelsSpy". gather She throughout libraries, is to a listen.retired festivals,Texas Her university tellingprograms conferences, storiesprofessor include and and turned offeringpersonal wherever storyteller workshops narratives else whopeople inabout 2002.HepearedwizardAuthor is currentlyJoe lastatStan communicatingresides spring Berenstain working inat Toronto'sAustin statedon with awith new Milkthatchildren his album "Joe Internationalwife, McDermottthrough to Louise, be released music." Children's and is an hisin Joe absolute thethree Festival.ap- fall of tales,growing and up other in the classics, Panhandle, and multicultural "Texanized" talesmyths, drawn legends, from fairy the lore 4 children. Possible:Sa lly Me9e'rs Spy a Book!" has been the Children's ServicesSally Coordinator Meyers, author of the piggyback theme song, "Mission AssociationactiveinBranch History in Library the and (TLAO),American an of MLIS the andHarris Library from the CountyHoustonthe Association University Public Storytellers (ALA), Library.of Texas Guild. the He at Texas Austin.holds He isLibrary a a HeBA is fromyears.forsongMs. the 1994-1998 Previously Meyers Tomsince Green 1995. served andshe County She haswason is the written teacher-director aLibrary memberTexas the SystemReading ofsummer Children's ofin Club LaSanreading Escuelita AdvisoryAngelo Round club for Table'sPreschool. Committeetheme eleven WorkshopsKUHT-TVCommunityChannel 8.(Channel providedPartner with 8),by andthe EducationHoustonis a trainer Public and for Outreachthe Television "Ready Department ToStation, Learn" at LeilaBluebonnet Rav-eD Committee. "Parrish Leila Raven Parrish, author of the Toddler Programs, Preschool SanRose Antonio rrTevirio Public Library to begin consulting in theRose area Trevino of youth retired as Children's Services Coordinator for the weeklyDirectorfromPrograms the Bible forUniversity and a storytime. Mother'sElementary of Wisconsin-Madison. Day With Programs Out over /Preschool 20 chapters, years whereCurrentlyexperience received she shepresents asher isa MLSProgram a forSheServicesservices. Children, is an forInactive thethe the fallmemberHouston TLA of 2002,Children's ofPublic the Rose ALA Library Roundbecame Association andTable, the continues Coordinator and of LibraryREFORMA, consulting. of Services Youth the tion.chairFloridachildren's Aof member andthe librarian PublicIowa, of Ms.Relations Houstonin Texas Parrish Area (HoustonCommittee is aAssociation 1997 Public TALLof Texas forand Texan Education LibraryHarris and County), Associa-former of Young ServicesPuraLatinosNational Belpre and AssociationCommittee Awardthe Spanish-Speaking. Selection forto PromoteREFORMA, Committee Library Presently both andand ALA InformationCo-chairshe appointments, is the of Chair Servicesthe Youth of and the to alongconferencesserveChildren aswith a and consultant story on Greater "Storytelling time, and Houstonprograms presenter With Puppetry and Puppets" for services libraries Guild, and for andshe"Booksyoung continuesearly children. for childhood Babies," to She past,servestermBluebonnet she on as served theChair Siddie Award onof thethe Jo Committee TLA NewberyJohnson 2 X Committee2Award andReading she Committee, just List for completed TLA/CRT.Committee. the Texas a Inthree-year Ms. the chaptersReadingwas the author ofClub the manual of2001 the TexasToddler and a Reading contributor Programs Club Chapterto manual. the toddler of the and 2002 preschool Texas TrevinoStevenpresented developed p. Born Txeitiiio to the Read first workshops bilingual Bornthroughout to Read the program country.Steven and P. Trevinohas is a 1999 graduate of the University of Texas theVictor Assistant L9DD Branch 50a Librarian/Children's LibrarianVictor at the Schill,Fairbanks co-author of the Young Adult Programs chapter, is 5 for the Engineering.atTexas Austin Reading where He Club, he illustrated earned 1996 afor Bachelor Ready the Texas Set of StateScience Read!: Library. inProgram Chemical He is Guide furniturebycurrently Salas &andworking Company architectural as a in project San millwork. Antonio, manager a forcustom ARTchitectural manufacturer Interiors of fine

6 ntootoD P000nie: 5F9aBook!

INTR.01X5GTIoN

1'..; r ,,.. op62dPap 4C) at7 op C op dp00 40 Up dp co Qb(10 QO qb Gbat) c-c) Goa ntortori Pozotlie: Spy a book * Musical Recordings, Videos, Web Sites, and CD-ROMs suggestingpurposedren of Texas of thisideas to manual forbecome programs is libraryto assist that users library will and attract staff lifelong childrenwho readers.serveThe to goalyouththe The library. of by the Texas Reading Club is to encourage thearkt chil- ?tyTpoze The* Reader's fun begins Theater with Scripts, an originalto booksPuppet Texas in shows, which Reading Stories,they Clubmay or betheme citations located libraryaOur friendly, hope collection, is fun, that welcoming when programs, children place, and of services.they all ages will discoveravail themselves that the libraryof the is ing"Missionsong Club by composer websitePossible". at and www.tsl.state.tx.usild/projects/trc/index.html.A soundchildren's file formusician, this song Joe is McDermott on theA piggybackTexas entitled Read- theme song written especially for the 2003 Texas nationUzin6 of the tilts following naDtrai. components: The programs in each chapter of this manual feature a combi- Clock".PossibleReading ClubSpy aby Book!" Sally Meyersand is sung follows. to the It ismelody entitled, of This "Mission"Grandfather's year's manual features a chapter of puppet plays, stories, * BooksBulletin to Boards, Share, Show, Displays, and andBooktalk Decorations andfor"Mission two tworeader's kick-off end-of-summer Accomplished!" theater celebrations, scripts. celebrations, The These "Mystery programs are "Spy ideal Parade!" begins a to Celebration!" promote and with "Spy a the suggestions Games!" Texasand * Crafts,Fingerplays,Riddles, Games, and Rhymes,Jokes and Activities Poems, and Songs havechildrenReading suggestions ofClub all agesduring for programs in schoolthe library. specificallyvisits and to designed enhance Theforprograms youth Toddler, infor Preschool, and Elementary programs chapters * Guest Speakers 7 fingerplays,those age groups.crafts, activities, They include and othermany programming wonderful books, ideas. songs, featuresaventuras...en many wonderful la biblioteca!" suggestions The Bilingual for books, Programs games,The crafts, chapter 2003 songs, Spanish slogan is, "iAccion, espionaje, manualClip may Art be used for crafts, programs, or to decorateThe your clip library.art by G. Brian Karas included at the back of this rhymes,theand YoungSpanish stories, Adult translations and Programs puppet for shows chapter, each for are childrenwhich included. uniquely and families. Alladdresses of theEnglish chapters the have similar formats, with the exception of needs,attachholesMake around mobilesthebut clipdo thenot art.with edgealter Enlarge the withit clip in or anyaart holereduce usingother punch theway.sturdy artand Cut dependingpaper use out yarn plates.the patternsor on string Punchyour and to asseparateandinterests many to encourage ofwonderfulreading that age club them programminggroup. on to the read, To theme attract the ideas. Young"Operation more youngAdult Top chapteradults Secret!"Bibliographic to outlines the as library well a information for titles in all chapters and in all manualcolor them. entitled, For more"Acceptable guidelines, Use please of Clip read Art". the sectionClip inart this may also be used for creating: formatscontainaudiobibliography isrecordings, manycompiled is additional divided andat the CD-ROMs. into endtitles sectionsof relating the Yourmanual for to books,library's the in program the magazines, collectionbibliography. themes videos,may that The * TabletopBulletinProgram board "favors"decorations decorations Amazon.com.purchasedyoutitles may in wish thefrom bilingualAto distributors listsubstitute of U.S.chapter. for indistributors the Many Unitedbooks of and suggested theseStates publishers titles or throughin may theForeign of alsochapters.bilingual bepublishers are cited in the bibliography for some of the * RefrigeratorTake home coloring magnets sheets(Copy, color andbackof magneticlaminate. of the clip tapeBuy art.) froma roll craft a supply store and glue to the orderedchapter.and Spanish through books interlibrary is included loan, at thefrom end the of Library the Bilingual ScienceMany Programs Collec- of the books and professional resources cited may be * Ceiling, window, or door decorations. siteyourtionRamos(TSLAC), at(LSC) collection. www.tsl.state.tx.us. at of 1-800-252-9386or the fromYou Texas othermay State check ForTexas orLibrary more [email protected] libraries information, andholdings Archivesif you on do pleasethe Commissionnot TSLAC have contact them web Anne in ClubreachTexasLag to programsReading as outreachmany Cluband children deposit and to as use collections.possible the library in underservedTake resources the Texas Encourage throughgroups, Reading out-such as manyas children as possible to participate in the 8 throughinstance,those who their children are providers. financially in childcare In limited order centers toor reachwithout might them, transportation. not bring have library access For re- andchildcaresourceschildren other and centers,locations will programs have family in access yourto them.health area to books.Sponsor ofcenters, service. Plan readingfree programs food clubs distribution such inEstablish schools, as puppet sites, a depository collection at each outreach site so the reportcates,sites.shows, Order andtheir crafts, allow participationextra storytelling the Texas organizations Reading to performances, you. The Club to administerincrease logs, and bookmarks, story in theyour hours program statistics andat these certifi-and will newspaperspublicizeadministratorsdemonstrate your usingthe andsuccessful value thelocal samplesof government your outreach outreachon the programs officials. following program in Make yourpages.to your every community library effort to

9 Mission 200onple: 3F9 a Bo k, programspresenting unless programs. they Childrenand their won'tparents attend are aware even theof them. mostMarketing Developwonderful your a programs is as important as planning and naltettrig, cooperatto. arict ?R Tips on Writing Publicity Releases * LimitDouble-space them to oneall releases page providesmedia kit information for reading aboutclub programs the events and and related includes: activities* APress thatschedule releases of events not assume the reader knows anything about the library.* AttachWriteInclude short, a library Texas concise hours,Reading paragraphs phoneinformation: Club number, flyer that towho, include yourand what, location. news all where, essential release Do when, why, and how * LettersAPublic feature serviceto storynewspapers, announcementsabout the schools, reading city club officials about the events orderingAnneTexas RamosReading information. at Club, 1-800-252-9386 available from or [email protected] TSLAC. PleaseFor contactmore information for about publicity, please read Marketing the

10 53.1210 ?ublic Seri/ice krillonceDeritFor further information, please contact: breakYour mission,a code, catchshould a youspy, chooseand enjoy to accept adventures it, is to with solve the a 2003mystery, Texas SaDFLe ?Teo Release Name/Title:PhoneOrganization: Number: Readingcheck outClub books at the and participate in our programs for children and (Library) Library. Come Fax: Texasyoung Reading theadults library Clubthis summer.and begins join on in"Mission the fun! For more information, please call Possible: Spy a Book!" the 2003 (Date) . Come to Audience:E-Mail:Start Date: Children and Families End Date: (Phone) CheckthisCelebrate summer! out Texas books, at travel the from the Amazon to Australia, or learn about Library cooPERATIoNpossible.childrenschool visits. to read Schools during and the teachers summer. WITH are Cooperate natural scHooLis allies with Anthemin encouraging important in any way way to publicize the reading club is through 2003coyotesschool Texas and through Readingrattlesnakes! Young Club Adult.Attend begins "Mission programs on Possible: for children Spy froma Book!", pre- the (Date) School.February or VittMarch and ask permission to promote yourCall library's or write your school district's administrative office in Pick andup ajoin calendar in the offun! events at (Library) and come ofearlylibrarianssummer school. May. reading in Schools March programs. orare April happy Then and to schedule havecall librarians the visits visit for in latethe lastApril weeks or principals, teachers, or school For more information, please call (Phone) 11 historical figure and carry a backpack full of riddles, jokes,Make and your visits entertaining. Dress up like an animal or stories related to the theme. You'll find animal costumes in costume Bringallthebooks ages. TexasOut such theEntertain Reading asAnimal Snazeroo themClub in You Zoo:withand by yourGreatstories, Jan library's Bullis. Faces songs, andTell programs puppet Easythe students Costumesplays, for children or about music, to of TheDear Teachers and Administrators, Sail* Letter to Schools Askdatetation.according the on school Promote which to yourlibrarian your your talents. reading library's to display Use club programs ideas beginsit in from a prominentandwritten this leave manual on a spot.it posterTake as in a your reminder.bookmarks, with presen- the posters, and program flyers with you. If themesion,in cooperation is is pleased "Mission with to Possible:announce the Texas Spy the State 2003a Book!" Library Texas and Reading Archives Club. Commis- The (Library) of-the-yearchild.programpossible, Some datesprint report schools orand stampcards. library will enough even hours include bookmarksso that reading one withmay club yourbe flyers given summer with to each end- Clubreadingisstimulate on lettingis askills self-pacedcuriosity, children during and reading readtheir attract forsummer program fun children and vacations. helpingin to which the library.themThe children Texas retainThe The keep purpose Reading valuableemphasis track of of the Texas Reading Club is to promote reading, childrenregisterthe books at of theythe all Libraryages read toor highlightbeginning the time theythis on year's spend theme, reading. including TheyMany may activities a special are also planned at the library this summer for (Date) woulddistrictvisitteen bereadingthe inhappy public May club. to libraryto visit tellMay the this we childrenelementary summer?have your about A andhelp staff the middle in membersummer encouraging schools fromreading in ourstudents your club library to to andhearing about from the you. other children's programs at the library.Sincerely, I look forward 12 (Your Title)Name) 5aDFI.e Letter to Parents aril atra.Tctiazz $a12Fle Letter to 1)TeochooL/Da9aare Colter ToDear encourage Parent your or Guardian, child to read this summer, the TheDear Preschool/Daycare Center Staff, is pleased to activitiesis "Missionsponsoring that Possible: themake 2003 reading Spy Texas a Book!" fun. Reading These The Club.programslibrary The will begintheme offer manyfor this club (Library) booksreceive2003announce Texas that awards "Mission are Reading read by joining toPossible: Club.them. the PreschoolChildren SpyRead a Book!"to whoMechildren Clubread This canand is the participatejoinlistening theme the Texas toof and the (Your Library's Name) Contact the library at (Date) and end (Date) readReading or the Club amount and receive of time recognition spent reading. for the number of the books (Your Library's Name) also provides special Byfora doing schedule so, you of the will planned help your activities. child retain hard-earnedEncourage reading your child to participate in the Texas Reading Club! (Phone Number) programsfor information just for daycare on our centers.special daycarePlease callprograms, the library and forat a complete (Phone) to register for the Texas Reading Club, tripexplorecassettes,skills to acquired the the andlibrary, world videos during fromand available yourthe the school Amazonlibrary for year. checkcard to Australia Theis out. free! library Your with hasfamily an books, inexpensive can audio- materialsobtainingschedule offora librarydaycare checkout, card events andfor atyouractivities, the school library. games, or daycare, and arts audiovisualIn and addition, crafts pleasethat contact the library for information about Sincerely,See you at the library! hopeTexasbuild toreading Reading see you skills Clubat the and an library theentertaining enjoyment soon! and of educationalreading.We experience look forward and to making your school's participation in the (Your Title)Name) Sincerely,(Your Name) 13 (Your Title) nizzioD Poortue: 3F9 a book. SelTtlig Chtitt Tell libraryable accommodations buildings, programs, must be and made materials. for persons When with puttingThe disabilities Americans together in with Disabilities Act (ADA) states that reason- permanentunablechargevith andto read visualavailable standardLsa1I.ji or physical to anyoneprint limitations.material who es qualifies as a result because of temporaryA theyproperly are or certified application must be submitted for each childrencanallmindprograms children. be that introduced to whateverand enjoy With activities the ato workslittle programactivities. for planning, for the childrensites 2001 andsimple, Texas with materials inexpensivedisabilitiesReading to enable Club, will adaptations keepmorework in for theprospective federal eligibility patron verifying criteria, thatnamely: the applicant meets* one ABlindness visual or more disability of of sufficient severity to prevent the supportinterestedmationLibrary andandgroups, persons ReferralArchives the about AmericansCenter Commission adaptive (DIRC) with equipment, (TSLAC), thatDisabilities provides hasgames Act, ainformation DisabilityThe andand Talking toys,other Infor-to anyBook Program (TBP), a division of the Texas State * A readingphysical disability disability that that is prevents prescriptionphysicallyholdingreading the of a basedindividual book glassesstandard andor turning of printfrom sufficient without the pages, the oruse of an aid other than [email protected],resources.topics. or Questions at The 512-463-5458, DIRC will canbe answered be or reached by email by toll staff at free or inreferred Texas toat other1- 800 -252- must be certified by a medical doctor or doctor of osteopathy.Applications Appli- submitted for individualsnormalseverity withmanner. to prevent reading the disabilities reading of standard print material in a The Ta The Talking Book Program (TBP) is a joint state and federal book ProvaD orhealth certifiedcationslibrary care, director.submitted by education, a number for or individualsof rehabilitation, professionals with orinother variousby adisabilities professional fields related can librarian be to toTexansprogram visual, of that physical, all providesages whoor readingunabridged are unable disabilities. booksto read in Thestandard alternate service print formats is freematerial forof due 14 print. Special playback equipment is loaned free of chargeTBP provides for use books on cassette tape, in braille, and in large withfree books of charge in cassette. through All the materials regular U.S.are circulated Postal service. to TBPBecause patrons TBP patrons are located throughout the state and sponsoredyoungerinteractiontinue to patrons provideby is limitedpublic to theparticipate libraries to books the telephone inin in alternativetheir the Texascommunities. and the mediaReading mail, needed. TBP TBPPleaseClub will encouragesactivities refer con- any individual qualified to use this service to TBP formakekeep an application, in the your most library. of or the call HelpTexas and young requestReading readers applications Club with experience! disabilities andCall brochures or in write Texas to TBP with your questions or requests for applica- tions: TexasTalking State Book Library Program and Archives Commission AustinPO1-800-252-9605 Box TX 12927 78711-2927 (toll-free in Texas) [email protected] Site: www.tsl.state.tx.us/tbp (fax)(Austin area) (e-mail) 15 nizotori, 2.001ue: 5F9 ClulD Them bong a Bo 2003 Texas React nizzio/1 200410: READ!Sing to the Tune of "My Grandfather's Clock" by Sally Meyers Missionthere's possible, a lot open we a don't book! know We learn as we grow, Spy a book! Look! Pick it up! Check it out!There's At the a library! lot to be learned about Earth as it turns Mission possible, open a book! Spy a book! Look! Pick itTry up! a MissionCheck it that'sout! Atpossible! the library! READ! READ! READ! 16 2003 Texas React cm, Tiler 2e 5orig: pozonie: 5F9 a book! By Sally Meyers (Sing to the Tune of Grandfather's Clock)

D7 11111111111 IP.

We learnas we growthere'sa lot we don't know Mis - sion

G D7 r Pos - si - ble o - pen a book! In - for-ma - tion and codes se - cret

D7 A7 D7

I IN IN

a - gents- bid -den roads, For ad-ven-ture you'll ne-ver for-get, Spy a

D7 C G D7 G

book! Look! Pick it up! Check itout! At theLib-rar - y! Try a

J 41, tv II IP II II 'IF I "If

mis-sion that's pos-si-ble! Read! Read! Read! Try a . inis-sion that's poS-si-ble!

D7

-41 Read! Read! Read! Spy a Book! Look!

G D7 G

Pick it up! Check it out! At thelib-rar -

22 entortori 2000/10: 51)9 2003 TOW Reaca 11g GW13 Ther 2e Song 1"j,i.0010/1 Posse Le by Joe McDermott a Bo SchoolHeOne was day wassecretlyon a supera out mission he searchingspy had snuckof nothing the for overutmost something to to do secrecyme new ButHe hidgotinspectedby mythosea library feet booksevery he card left cornerunder anda note a his andstack cloak, every of books disappeared shelf taller than in a himselfpuff of smoke "IIHe said know saw "Mr. thea not Spy, book so this secretin myis your place, hand lucky and day."said,it's not "Aha, so far a clue!'away" YouIt said... don't need a magnifyingtelescope, all glass you orneed a super are eyes secret disguise YouAndThen"You'll don't II said...led see needhim it's toa not telescope,the a Library mystery, all youcome need on andare eyesfollow me." YourYou're mission on a mission is possible to find adventure and I know where to look Spy a book You'reYouYour don't on mission aneed mission a is magnifying possible to find adventure glass or aand super I know secret where disguise to look Spy a book index.Note: Listenhtml. to this song at www.tsl.state.tx.us/ld/projects/trc/ 18 CID OD C7D OD qo Op Qo OD 0o OP qb 44Q CD 6 QD dp v.-- 0) CD ploocr gNollMgalap 6cts :aicti000d, itto10011t ntortov. "Pozotue: Ce[elpTatt.01101D9 Rose TTelitijo 5F9 a Bo lackoff GeLe'bTattoD: n9oteTh Pa TacCe! RefTeOLDerit$ them.Package Let cookies the children or other guess snacks what in is small inside. brown Place bags dry andice in a seal Briaeti.21 Bowed Jot 11 the note1.9 'PaTacLe! thatbucket the to children make the don't room have look access smoky to itand as mysterious.it sticks to skin.) (Be sure mini-books.bulletinclipCreate art mini-books charactersboard Make so that fromconstructionwith they titlesthe appear manual of paperchildren's to and be sunglasses readingplace mysteries. them titles and on Enlargemagnify-of the the Na Detags chapter.)Spyglasses & magnifying glass. (Patterns are at the end of the minibooksboard.ing glasses Patterns areto use at for the as sunglasses, aend border of this or magnifying chapter.as a path through glasses, your and bulletin Books to DtopLa9 azict BooktalkThe CaseCanary of Caperthe GaspingDumb by Ron Bells Garbage Roy. by Crosby by Michele N. Bonsall. Torrey. DeC011310/10 Tape spyglasses, question marks, and Sherlock Holmes style TheClever CopycatCase Quicksolve of the Mystery Stolen Whodunit by Baseball Gertrude Puzzles:Solve Cards Chandler byMini-Mysteries byJim James Sukach. Warner. Preller. for You to hatsitems to the are end included of your at bookshelves. the end of this Patterns chapter. for each of these 19 Don'tLu & BeClancy's My Valentine: Crime Science A Classroom by Louise Mystery Dickson. by Joan M. Lexau. Encyclopedia Brown and the Case of the Slippery Salamander Where is pinkie, where is pinkie? HenryThe High-Riseand Mudge Private and the Eyes: Sneaky the CynthiabyCaseCrackers Donald of Rylant.the by J. Climbing Sobol.Cynthia Rylant.Cat by RunHowHere away, areI am, you runhere this away. I morning?am. Very well, I thank you. MartyInspector Frye, Hopper Private by EyeDoug by Cushman. Janet Tashjian. RunHowHereWhere away, arewe is youare,the run family,thishere away. morning? we where are. isVery the well,family? we thank you. FillgeTp.a.90 Viler° js Thunbkill? PDT29Reprinted TiluD13 with permission from the National Network for Child WhereRunHowHere away, isareI am,thumbkin, you runhere this away. I morning?am.where is thumbkin?Very well, I thank you. TommyCareVerses NNCC. Thumb, For Children.Labensohn, Ames, D. (1986).IA: Iowa Finger State University.Plays And Action WhereRunHowHere away, isareI am,pointer, you runhere this away.where I morning?am. is pointer? Very well, I thank you. TommyHowHereWhere do IThumb am,are you you?here do? I am, RunHowWhereHere away, are isI youam,tall run thisman,here away. morning? Iwhere am. is Verytall man? well, I thank you. Pointer,"Finger(Repeat "Toby theFamily verse Tall", here and "Ruby wesubstitute are.") Ring", "Tommy "Baby Finger". Thumb" End with with 'Peter HowHereWhere areI am,is youring here this man, I morning?am. where is Very ring well,man? I thank you. Gbazit geOporiSe Song Run away, run away. 20 traveled(Tellny Aunt the allchildren Gapeover the a Backshort world tale and about brought your back mysterious many mysterious aunt who itemsobjects. are. Then, After ask they if theysay yes,would tell like them to toknow "Repeat what thesethe mystery words AndFromOh my she near aunt brought Algiers, came with back, her, FromOh,after my me Holland auntand docame too, what back, I do.") spinningwaving(Action:some cutting a thehulaAdd fan shears.ahoop, cuttingand holdstamping motion, the cane, a move foot) and your move hips both like feet you whileare Oh(Action:AAnd wooden my she aunt Stampbrought shoe. came your with back, foot her, on the word 'shoe' and keep stamping) AndFromOh my she New aunt brought York came fair, with back, her, AAnd (Action:Fromwaving she Oldbrought fan. Wave Japan, awith fan her,and continue to stamp a foot) whileyoua rocking(Action: are waving spinning chair. Add a afan rockinga hula and stampinghoop, motion, hold keep a afoot) cane, cutting, and move move your both hips feet like AAndFromOh walking my she Open aunt brought cane. Plain,came with back, her, someAndFromOh my she pingNiagara aunt brought pong came Falls, balls. with back, her, stampingOh(Action: my auntafoot) Hold came a cane back, and move both feet while waving a fan and Ohandmove(Action: mymove your aunt Nod both hips came head feetlike back,back whileyou andare waving forth,spinning akeep fan a hularocking,and stampinghoop, keep hold cutting,a afoot) cane, the(Action:someAndFrom cane, she hulanear Move broughtand hoops.Kamloops move your with bothhips her, likefeet youwhile are waving spinning a fana hula and hoop, stamping hold a SomeAndFrom she Timbuktunuts brought like you! with her, foot) 21 repeattwice,(Form'Who this thenthe 5-tole and children clap keep Thetwice the into Cookiebeatagain a circle. while to form ClapFm chanting a twice,Therhythm the cookie slap pattern.verse. your IfJar? Childrenlegs HaveCan'tWe're go tocoming marcharoundunder to it!across it! a bridge. it! name.)cookieentersomeone the jar. middleskips Repeat a ofbeat the the or chant circle forgets until where the you chant,they have become then inserted they part needeach of the tochild's Let'sOkay.All right. go. WhoWho(name) stole me? stole the Yes cookie the you! cookie fromCouldn't from the cookiebe!the cookieThen jar? who? jar. Can'tWe're(Stand go coming up under and tostartit! a cactus marching patch. in place) We're(Adapted by Rose Trevino. This is like "Going on a Bear Hunt". of on A n9zteT9 Hunt Okay.AllHaveCan't right. jumpto walk over through it! it! We'relibrarian.)legsThe childrenin going a marching on are a seatedmystery rhythm. as hunt! they Children start torepeat slap eachtheir linehands after on thetheir you(PutLet's are your go.being hands pricked out by in the front cactus.) and say "ooh aah ooh aah" as if Let'sWe'llWhatOkay. go.see.will we find? Can'tWe're go coming aroundunder to it! it!a forest. Can'tWe'reGotCan't go comingto go underswim over to throughit! it! a stream. it! Let'sOkay.AllHave right. go.to walk through it! otherthen(Make the side.) back swimming stroke, motions, etc. Shake first yourselves freestyle, drythen when the breast you get stroke, to the 22 (Close your eyes and pretend to feel around carefully) UhWhatSomething oh... could mysterious. it be? Answer: Encyclopedia Brown. (PretendRUN!!It's a strange to run creature! very fast while slapping on your legs as fast as PairVlorecupscottonand the a around. cottonchildren toball it? under ball.The and oneotherOne give of child child eachthe cups,lines pairguesses threeupand thewhich then colorful three shuffles cup cups, plastichas theputsthe cupsthree cotton a youasbridgedon't can.you forget Runrapidly,can doing throughto sayrun as oohand themany aah jumpforest, strokes ooh into go aah. thethroughas Now youstream. want.) marchthe Swim cactus across across patch the asand fast nOteT9Invitearound.ball under summer ?a:racie it. Let readers each childto a mystery take a turn parade. shuffling Encourage the cups them to Gal eo aria Activittez We made it! bigmysterytimetheydress question marcharea. up snackas End bookin marks and awaitstheir characters out on parade them. ofthem. the Alongat for bookPlace the the circulationaisles theiraevent. question route, and Play through deskplacein eerie each where boxes musicthe box story awithand as 11-90teT9mysteryopeningCover and largeitem,Boteo decorate enoughsuch asabout fora sea afive childshell, medium to inside insert size each a hand.boxes. box. Place CutChildren an a put childrenDumpty?"simplestop at must eachquestions answerbox and such it let before as one "What childthey happened proceed.read the question.Theseto Humpty can The be very theirareatouching hands or line them.in upeach a Place groupbox mysteryand of them.try to boxes guess throughout what the items the children's are by fingerprinttheContactFt/Wirt/40 children the the policeabout entire fingerprinting.department group of children.and If invite possible, If an not, officer ask here them tois aspeak tosimple to scatteredorListstress poster 10 1120? clues board.beside about Displaythe differentclues. the Ask booksbook your characterscontaining summer readerson these a bulletin characters to solve board Materialsway to give each child one fingerprintA few tosheets take ofhome. newspaper dia.Thisthe mysteries.Who young is detectivehe? Here is has an example:a mind that works like an encyclope- 23 MarkersScotch tape Directions DistributeMagnifyingPackage of one glass3" Xindex 5" unlined card and index one markercards to each child. Ask Graft Hte 2Tirkto newspaper.theiraskthem them fingerprint.to write to Theyraise their Eachwilltheir name rub childhand on their theshouldand finger index an beadult back card.given will and When a come pieceforth finished, byofon tothe get MaterialsDirections AskOne thehalf children sheet of if carbontyping they want paperpaper to for forknow eacheach what childchild a bite print looks cardfingerprintstickynewsprint. to side show downAnon the it,adult print.andon thewill carefully Let finger, then each take placepeel child a off piecethe examine the tape oftape tape,on their with the place finger- indexthe it drenthencarbonlike. foldThento paper.place the give carbonthe Ask them folded them paper a piece carbonto foldin ofhalf. insidethetyping Then,typing the paper instruct foldedpaper and in typingthea halfpiece chil- and of Setli.goteT9 up a large Carl:4219 tent in the TTIF children'sparticipants,print room with or the storytime you magnifying could room. do glass.one On or Depending all ten prints on for the each number child. of frombetweenpaper.paper their with Next, his/her mouths,the instruct carbon-side teeth remove each and bitechild touchingthe down. carbon to place the When paper, insidethe theyfolded and of remove examinethe paper folded it groupparticipantthe insideoutside sit closely with toof bringthe a togethercamping tent, a pillow place andlantern toa asksign sit themoron that flashlight. inside tosays, listen the "Solve Invite tent.carefully it!"Have each Light for the ences.comparethe typing theirs paper, to theyothers will and see look their for bite similarities print. Let and them differ- bookSolve,storiesclues. includes George Moreto solve. Stories Shannonfolktales These to Solve,include fromhas compiled andaround the Still following theMore a series world Stories titles: of just books toStories waiting Solve. with to toEach be atrezt Presenter ofInvite the secretsa local magicianto the tricks. to perform and show the children some *lanternthesolved. "Firefly children orSelect flashlight. and will a thefew take Apes" toHere turns read are readingon a yourfew storiessuggestionsmystery using camping for the stories. camping trip. Let Visie00 Maurice Sendak's Little Sherlock Bear. (34 minutes) * "A"The Lesson Tallest Well Tale" Learned" 24 Scooby Doo's Greatest Mysteries. (109 minutes) somechildrenUsesWhere cluesof the trackin about theworld's Carmen World world most is Sandiego geography,Carmen famous Sandiego? andlandmarks history, her gang and and as culture treasures. they steal to help lack-Off 5F9 saxes! useasCarmenWhere around a time in and Time themachine her world, is V.I.L.E. Carmen to stealing track henchmenSandiego? them historical down. travel treasures. through The time good as wellguys SpythePhotocopy Ganes:pictures, pictures Xotctlist information offraDotrz famous like spies Spjez name, from country, library books.secret name,Under BoaT4 somechildrenUsesCarmen cluesof Sandiego:thetrack about world's Carmen world Junior most Sandiegogeography, Detectivefamous andlandmarks history,Edition. her gang and and as culture treasures. they stealto help theyEncourageetc. Gather can about youras much each summer orof asthe readerslittle spies. information to find as muchas you information would like. as cto Vel3 Sttes The Boomer Wolf Web Site Dec011310210 sleuthsDecorate like an Sherlockarea with Holmes, the names Encyclopedia of famous book Brown, character Nate the DangerMouse:Joinwww.boomerwolf.com/ the Boomer The Wolf Greatest Detective Secret Agency Agent inand the help World solve a case. names.Great, etc. Place books featuring these characters around their tures.alongJoinwww.dangermouse.org/index2.html DangerMouse, with his trusty the sidekick Greatest Penfold Secret in Agent some in secret the World, adven- Napeta.9$ endSecret of theagent chapter.) badge and sleuth cap. (Patterns are included at the 25 Books to Display aril book-val.kCodes & Ciphers: Hundreds ofMessages Unusual andby Christina Secret Ways Ashton. to Send JunieHarrietNate B. the Jones GreatSpy and by by LouiseSome Marjorie Sneaky Fitzhugh. Weinman PeekyPark. Sharmat.Spying by Barbara Directions GiveSmallAn iron a cups sheet of paper and a paintbrush to each child. Pour ShadowsRedcoatsSpiesThe Rosenberg and inand theTraitors Petticoats Glasshouse Espionage by Stewart by byKatherine Case Megan Ross. by Francis McDonald.Kirkpatrick. Moss. invisible.ofintothe paper. milk the milk into WaitWhen andsmall for dry, beginthe cups. turn message writing Eachthe sheet tochild a drysecret over will completely andmessage dip use the the paintbrushandon hota become sheet iron SpyholeSpySpiesUndercover by in Richard theSecrets Civil Agents byPlatt. War Zilpha by PaulAlbert Keatley Thomas. A. Snyder.Nofi. carbon,carbonmessageto press compounds whichthe was side written. is ofblack. paperin Thethe The oppositemilkheat children fromto break the the will side irondown then where will andbe cause theable produce milk tothe kettrittez paintYouInYistble will brushes. need Ilk Followlemon juice, the same white readprocedures paper, their and "ghost used flat toothpickswriting".above for theor GluechildrenforththeWrite shelf neup a series tointoinIn cluethe pairs of library.#8. 6 toand Have 8 cluesgiveClue fun each that#1 making would willpair leadaup lead set clues! to of to various clues.clue Form #2 Whenbooks theand sotheon ghost writing to write secret messages. mayclueswithchildren wanteach are findeasiest toother. write the Afterwards, andbooks, their which own let themareset talk moreof exchangeabout clues! difficult? clues. their What Older list kindsof children clues of middleDesignate of aone circle. child Each as the participant "private5F9 PTIYate eye".seated He/she inEye the willcircle sit will in the ask MaterialsGhost VTitim Milk nameprivatefirsta question. person of eye. a Russian The toHere make private are spy?" the some eye private Answer: examplesis only eye "Tomato".allowed laugh of questions. becomes to "Whatsay "tomato". "Whatthe is nextthe iscode Thethe ThinWhite paintbrushes paper 26 name for James Bond?" Answer: "Tomato". YouVIP's will the need Thief? a small bag of pennies and a blindfold. One GTaft pant(pennies)withplayer fromhis/her will willthe be back groupthebe placedtodesignated thewill other understeal detective participants.the the pennies. detective's and TheWhenwill chair. bagbe the blindfolded of One blindfold gold partici- is Materials5F 900sez ConstructionToilet paper rolls paper guessestheclues,removed, thief such to wearing the catch as detective"Was the a baseball thethief. canthief If ask cap?" thewearing three thief The yesistennis detective caught or noshoes?" questionsthen then theor gets "Wasdetec- to three get MarkersStringHoleGlue punch tive.tive gets another turn. If not, the thief becomes the next detec- Directions covertoDistribute each the child. rolls two Letwithtoilet the construction paper children rolls 1ati:Vit9 5beetz Invite"Spy the Games children Word to solveSearch", the and"I Spy" the "MissionCrossword Possible Puzzles, Crypto- the theillustration.markerspaper rolls or together,asdecorate shownNext, sidethey themin the byglue with side. gram" at the end of this program. holesrollsPunchtheir and so aspyglasses holethattie string childrenon each overthrough mayside their ofhangthe neck the and start spying! tie thetationContact audience about the policecriminology, will be department interested spies, andin and knowing invite espionage. an how officer Tell their dothem police a presen- that presenters 27 department aids the FBI and the CIA. VicCeoz HarrietSpy Kids. the Spy. (88 (102minutes) minutes) Gowww.cia.gov/cia/ciakids/index.htmlCIA's on Homepage a virtual tour for Kidsof the CIA, crack the codeateo and solve Thiswww.geocities.com/spanoudi/spy/I Spypuzzles site is at based this site. on the "I Spy" children's game.

28 c7tD o,C7' 15F9 GT000Volict ?Inge 15p9 arozzvoni puzge ADOVOT Keg7.6.1.Across APlantYou secret should this mission and not listen share to fulfill to this every (ESPIONAGE)with move others (BUG) (SECRET) Down9.8. WatchesFreezes moments your every in movetime (CAMERA)(SPY) 5.GLASSES)4.3.2. SecretYouCIA canor signal FBI seesend secret behind(CODE) messages service you withwhen (AGENT) this you (TELEPHONE) wear them (SPY- 6.Across 7.1.A YouPlantsecret should this mission and not listento share fulfill to this every with move others 9.8. 2.DownWatchesFreezes Secret moments yoursignal every in move time 5.4.3. YouCIA canor FBI sendsee secretbehind messages service you withwhen this you wear them 29 7/Usztov."Posstue" Cr9ptogTan

ABCDEFG IJ LMN QRS UV XY 24 25 111512

I S I S R I T I S 25 15 20 16 13 25 9 15 11 7 17 9 25 5 6 12 3 25 15

S R ST F R T 15 21 18 18 7 11 22 21 15 12 2426 11 12 3 7 24 21 5

F I T 2624 25 12 Solution: I spy kids reading this summer just for the fun of it.

Cr)

cn cl4 Z P4 C.., Z -4C0 c...)

c) C. 01-4 0 01 clp clp

= F-1 E--1 = 0 . - ..t cf) L4 C.7 -,4 4.4.4 G4.-4 ;.14 --1c, 1--1 Cl) >- PO >-1 Cl) 4 H -, p v-a A ;4.4E. ;4.4 c..) E- I1>" W .1 Cnr:4 (264 MI >< 0 ;4 W

cE t, 7) CtE.71 .' c'4 ,.., .6. Cn E-4 .-4 E. E. E-4 crs ,,, w , ,, < .., ., ,(1) -'al tl r.'0:. ,_,p 4 Cf)Cf)C/)C/)E.."'=4 tr) vp..4 -tC.4cn 0 F- =P4-tt N Z 0 CO co) a. a. cn L7c/4< w.4 w;.T.4 NC. 1--ck E. c tn.a. al = c..) c., L-4 z = c.7 ''C.41 0 W W C.., (::1al W C...,,..4 < E-4 W4 0.4 < N r:4 GL4 E".4 ) r4 C4 L4 El7:'t w C.) 41:4:cial-,0-40E-1 P--+P4 1t;z4 0 0 Z E. W C- Fil 0 W tvra w a., .. z (..) H rz:,' C-.) Q.) Gr.4W4NE-11:4W.4Z0=cPc-4E-4N01 't 0 f4 '" W W cn -t -tC(-7(....)(...)(=)a:1 = W C.

P__, E. i w . ) Z >. tx -,4 c .1 .1 u . a c . . ) c) cnc..,a. co (5 g4 a4 cn -', DC d> (.2 A> 0 -i 1-)--w 24c)=-cz4:wca Ia

36 ralsi of ?Tog lap Ge[elpitatiorn Spy a GelelDiattopl Nametags chapter.)Camera & binoculars. (Patterns are included at the end of the BtitetID BoaTa spy a Gooct Book! Books -0 Display arLi BooktaikThe Amazing Life of Moe Berg: Catcher, Scholar, Spy by Tricia distributeglass,largePut the letters.a caption,magnifying copies At "Spythe of mini-bookglass,end a Good of and this Book!" a patternschapter mini-book. on areto the the patternsDuplicate bulletin children for board andand a spy- letin Crime-SolvingCommanderBaby Einstein: Toad ScienceSee and and theProjects: Spy Intergalactic ShapesAndryszewski. ForensicKenneth by Julie Spy ScienceG. Aigner-Clark.byRainis. Jane Experiments Yolen. by thehadofthem the bulletina use chancevery a marker firstboard. to bookdecorate toCopy writethey andor remember the color cut title out their of thereading. a mini-book,favorite spyglass After book and placethey ormagnify- the haveit on title EspionageCaseCriminal Closed: Investigation and The Treason Real Scoopby by Chris John on Woodford.DetectiveMeltzer.Ziff. Work by Milton includeoring use glass them the patterns staff's to make favoriteand a placeborder. books. them The throughout bulletin board the bulletinmay board, also IForensic SpyThe in Federal theScience: Jungle Bureau Evidence, by Damonof Investigation Clues Burnard.Campbell. and Investigationby Dynise Balcavage. by Andrea Display 5F9Use Stuff the book, Lu and Clancy's Spy Stuff by Adrienne Mason as LuI SpyOwen and LittleTreasure Clancy's Foote, Letters Hunt:Super Spy by A StuffJeanSpy Book byMarzollo.by MarthaofAdrienne Picture Weston. RiddlesMason. by Jean Marzollo. themzinesmagnifyingthe mainbook onwith posterdisplaywith pictures glass, items board book a of spythat spy toor hat, use areselect stuff, binoculars,consideredas partanothercut outof the the similaretc."spy diplay.pictures If stuff" you title. have andlike Surround mountamaga- PoliceTheSolvingSecret DetectiveSpy Agents: Crimes: on Third byLife Pioneers Tracey Base As a by ProfessionalBoraas. of Matt Forensic Christopher. SpyScience by Claudia by Ron B. Fridell. Manley. 31 efTeohDeritoMake mystery cupcakes with an unexpected "mystery ingredi- This is the mystery trail. way we hold our spy glass, as we walk on our drinkstoent" guess such and what as serve a isjellybean, in purple their milk,cupcake. a gumdrop, blue Add lemonade, a foodtootsie coloring and/orroll, etc. tored Askvarious water. kids This is the way we search for clues,trail.clues, assearch we walk for clues, on our search mystery for .ntIOIC Play soundtracks from the Austin Powers movies. This is the way we close the case,solved! causeclose thea mystery case, close we have the case, Sorigs Where,IttheTe, oh oh where XheTe has my Has little 11 dog y Little gone? Dog aorle awayeach(SingFoolet child andto athe let "Peamita tunehandful the ofchildren "Clementine". of shelled toss the peanuts. peanutsAfter singingSet into a basket the this basket. song, a few giveFill feet a OhWithOh where, hiswhere, ears oh oh cutwhere where short can andcan he hishe be? be?tail cut long, Justjar.Foundlarge The now jarwinner aI foundpeanut,with getspeanuts a foundpeanut, to keep and a foundpeanut, thelet themjar a peanutfoundof guesspeanuts.) a just peanuthow now. many just now,are in the Here(Sing weto Herego round We Gothe Roundmystery the trail, Mulberry mysteryso early Bush.) trail,in the mystery morning. trail, Rory/let the 1"S.oteT9 TTail JustCracked now I crackedit open, itcracked open, crackedit open, itcracked open just it open now. just now, This is the way we wear our hats,trail. whilewear ourwe walkhats, wearon our our mystery hats, AteJustIt itwasnow anyway, rotten,it was ate rotten,it wasit anyway, rotten,it was aterottenit was it anyway justrotten now. just just now, now, This is the way we hold our spyour glass, spy hold glass, our spy glass, hold 32 Just now I ate it anyway, ate it anyway just now. JustGot anow stomachache, I got a stomachache, got a stomachache, gotnow, a stomachache got a stomachache just now. just JustThenFound now I woke Ia wokepeanut, up, up,then found I wokeI woke a peanut,up up, just then now.found I woke a peanut up just just now, now, Penicillin,JustCalled now the I doctor,calledpenicillin, the called doctor,penicillin the doctor,called just the now,called doctor the justdoctor now. just now, Just now I found a peanut, found a peanut just now. JustOperation, now anI tookoperation, operation, penicillin, operation an operationpenicillin just justnow,just now.now. Ganez and Activitiez scene.MakeCatch aMake afishing 1"S.oteT9 a fishing booth out poleFizM of out a large of bamboo. box decorated Tie string with to a one water end Bow* JustDied now anyway, I died died anyway, anyway, died died anyway anyway just just now. now, Onecallingdonationsand attachor outtwo of a"toddler adults clothestoys andare boypin books.behind toor thegirl", Onethe other "preschool booth adult end. attachingstands Ask boy local in or the girl",stores front"fish" etc. for to JustWouldn'tWent now to heaven, IHeaventake went me, towent wouldn't heaven,wouldn't to heaven, wenttake take me, towentme, heaven wouldn't wouldn't to heaven just take now.take just me me now, just just now. now, Gather?)earitethe pole. three Kids 2)09 buckets of nyOteryall ages decorated can Toss fish with for prizes.question marks, several JustWent now the Iother went way, the other went way,the other wentnow, way, the other went waythe otherjust now. way just childeachlinebeanie on aatoss littlebabiesstickerthe several ground farther orfor bean beanieplaying, withaway bags, the babiesfrom whether masking masking the into line they thetape. tape, than getbuckets. Line and thethe other.stickers.upbeanie Give the Let buckets,babieseach Make each a WasJustDidn't nowa dream, wantthey wasdidn'tme, adidn't dream,want want me, was didn'tme, a dream didn't want justwant me now, just me now.just now, NewspaperintoMake a bucket a stack or11.9neT9 ofnot. rolled newspaper5CtiFttiTe in advance by rolling full Just now it was a dream, was a dream, just now. 33 usecornersheets these ofas newspapertightlynewspaper as possible. fromrolls oneto buildSecure corner sculptures. them diagonally with What tape. to the will Let other theythe kids be? It will be a mystery! A suggestion is to divide the group into that child is out. The first child to reach the spy becomes the guessingWhentwo teams both what with teams the each areother team finished, has working built. each independently will have three of triesthe other. at Assignnot:Dividenew spy. participants Secret into nosage two teams. Relay Give Racethe first child on each onthemirror.GathernyOtel'y theirchildren's washablePaint faces. Face whiskers, faces.Then, facepainting Asklet paints, exaggerated the them children very to guess thin eyebrows,look brushes,what in the has hearts, mirror. a been palette, etc., painted andon a othermessage.accomplishesdelivered.team aside spoon TheofThe the andtheir childfirst room, a mission. teamping-pongmust walk toreach successfullyThe back ball. the ping-pong to maskingA the secret deliverline, ball tapemessage and isthe markerhandthe message secretmust the on be the andwinThis11.90-teT9 musicala is mystery like aBook CD, cake book. cards 'Walk walk You with but will insteadnumbers need maskingof written winning tape, on a them,cake, a CD andchildren player wins.ing.thespoon ball, The with he/shefirst the team ping-pongmust of pickchildren ballit up to and completethe count next child.to the ten secret Ifbefore a child assignment proceed- drops sections.tapethememystery to from make Tape books Spy a apath Kids numberto givefor Motion the away.to bookeach Picture A section.walkgood Soundtrack. andchoice Also lines for place between musicUse each masking is theofthe the hands.ThestolenStolen children To goods Goodsdo arethis, and on they geta mission. itwalk to a from secret They a designatedchamber must recover without spot a holdingbag using of their a inHavetheberednumbers that book onesection. numbered walk.into of them a When Whenbox. section pull Thethe the a numbermusic childrengetsmusic a startsbookstops, from begin playing,as theya abybox. prize. standingmust The they stop child stroll in moving. astanding num-around Givethenblown dropeach balloon thechild balloon (hag a balloon of instolen a asbucket agoods) prize. or betweenbasket (secret their kneeschamber). and maskingchildThisCa-Mb is to like bethetape thethe 5F9line. "spy".game The ofLine spy "Red willup Light all be other facing Green children away Light". from behind Select the a partici-one Graft picture,GTeateEach participantfor a this Sp project. profile should bring a photograph, like a school stop.towardspants. If Spy a the child says spy. continues "green Spy says light" to "red walk and light" whenthe childrenand spy the says children start "red to light", walkmust then 34 Materials Card stock MarkersWhite paper Vict 5IrrmeT GetelDTattom Directions sizetheDistributeStapler children cover. aDistribute tosheet fold of it incard two half. stock,sheets They sizeof should white 8 °" havepaper,X 5 °"a passport 8and °" Xask 5 °" Bulletin j3etaTii kecoppllecO appearancewillto theireach fit insidecoverparticipant of anythe a small cover.way and booklet.they ask Next, themwant, staple Each totape fold theparticipant their middlethese photo in to willhalf. ongive decoratethe These the inside participantsplished!"Drawnake a 'Tracksrainbow Cut to out write and footprints-- theonnisoion titleor near usingof theiritAcemplizheco write the favorite pattern "Mission book provided. Accom- or book Invite 4.forthencover, tionalTheir page place and sheetsspy3, onewritemake profile offingerprint their uppaper isa namesecretcomplete. for on otherand code page age Theyitems name 2, on make maypagelike and lipinclude upwrite1. prints,Theya secret it addi- onwill etc. codepage booksfromcharacter a at corner the on endthe of footprints.ofthe the bulletin rainbow. Make board, a windingover the pathrainbow, of footprints to a pot of t=A Atka() ReCo Austin Powers: Spy Who ShaggedPicture Me: Music by Various from theArtists. Motion Dtoplao Tapeinvisiblefirstkids a namestracelong ink. bannertheir and (The hands"a made secretrecipe using of message" forbutcher markers invisible paper inside of ink all to theiriscolors the in floor.thehand and "Kick-Off Letwithwrite the their Video HeySpySingable Ludwig: Kids Songs Motion Classical for Picture the Piano Very Soundtrack SolosYoungLouchard. for by byPlayful Raffi. Various Times Artists. by R. Napetago sponsormessages.coveredCelebration: whowith Display Spy contributedhandprints, Games!" the banner toiron program.) the init reading tothe reveal library When program. the orthe names give banner it and to is a secret local Arthur's Mystery Files. (18 minutes) 35 Key & lock. (Patterns included at the end of the chapter.) Ten brave detectives RefTeohnerito Drink".ies".Serve Serve fortune lemonade cookies. with Label blue the food bowl color "Secret and Message label it "Mystery Cook- TheyTheyWalking walk walk into toathe row. the left. right. (fingers(march yourtoto thethe fingers left)right) on your lap) books to Display Detective Bob and the Great Ape Escape by David Harrison. booktaik Tippy,Then tippy forward.backward. tiptoe, (backward)(forward) IDetective Spy, Year DonutMoleDinosaur Round by and Challenger:Robert by the James Wild Quackenbush. Skofield.Goose A Book Chase of Picture by Bruce Riddles Whatley. by Jean TenThereWalking brave they detectivesingo, a row. (march your fingers on your lap) SpyingI Was a on Third MissDracula Grade Midler by Spy Maryby by Eve Labatt.Mary Bunting.Marzollo. Jane Auch. Spir/g on a 13.49 Bunue Bee Won'tI'mI'm(Adapted spying spyingmy mama on by on aRose babyahe baby so Trevino.) bumble proud bumble of bee. me.bee. FirigeTpLa9 Play the theme music to the movie, Mission Impossible. I'mI'mBut spying justlook spying on a baby for a crocodile little while he's spying on me! (AdaptedTiFp9 TiFF9from an EnglishTiptoe rhyme by Rose Trevino.) I'mOh nospying on a fuzzybaby crocodilelittle bear he just swam a mile. ThereTippy, they tippy go, tiptoe, 36 He'sI'mFuzzy spying looking wuzzy, on back ahe fuzzy just doesn't little bear care yes, he really does care. I'mWon't spying my mama on a baby be so bumble proud of bee. me. kettvittez (AdaptedTetiBut look on by a RoseCase Trevino.) he's spying on me! childrenwallSelectShadow using about to "Playanguess a opaquedozen what Xbat items projector they An and are. I? projectin a darkened their images room. ontoAsk the SoAndThere one the were started sergeant ten moving on said, a case "Getand went moving, out the get door. moving." *youchildrenAlsoShadow Butterfly: started! using how Furl an Link to opaque create your projector animalthumbs shadows. together in a darkened andHere wave areroom, a your few show handsto get SoAndThere one the were started sergeant nine moving onsaid, a case "Getand went moving, out the get door. moving." * Rabbit: Bring your thumb togetherears.fingerback and withto formforth your anin pinkie eye.front Your of and the otherring light. two fingers will be bunny ThereAndSo theone were sergeant started eightseven... moving said,on a case"Get and moving, went out get the moving." door. * Crocodile: Put your fingersover togethermake the another. and open cup Open mouth your and palms,movement. close fromone the tips of your fingers to There were four...five...six...three... witheeriecrime.andGive you. you of.the Check Inside arechildrenthe on yourCline a mission. these kit carefullyis instructions: everything You have and you"Youyourmake need crime aresure toDetective you detectionsolve have the Wright thekit ThereWho waswere shouted one two... on out a loud,case "I solved it! I solved it!" Possiblecopiesnextright tostuff ofevery Maze". the before "Missionitem you you get Possibleshould to the have." sceneWord Then, ofSearch" the givecrime. and the theMark children "Mission an 'X' 37 Gripe Detection BlotterArrow paper Kit Check Lin Magnifying glass Mat nizzlorl AceoppLizilect" Vonct Search CottonContactCameraBone lenses MicroscopeMicrophoneMeasuring cup slides WXPUTNCNRRCDWIQRUSRIAXZWPONDSIWAOVBOOKKXFEWEPS CGETCLUESOXFKSFESPROTCEPSNISY FeatherExtensionEarplugsDominoes cord SoapPencilsPaperNinhydrin powder DQLABQTDCEFEREZXG SECRETSLNDCIRDFEWRLSEOIAEMNJZ OYTRJITMPTCGXI GraduatedForceps cylinder SuperglueStick DMICROSCOPEOERSEAAKHXZYNWTGTMPOS ENPSFGXFPRCIYVR E M A C G U N P Z K T S Z T'jatellatO for CTi72eDeteettoD Kit LotionHighlighters TapeTalcum powder JRFKXSDPSLBSSGSLHNPYOXOEVEJNPK CLUESCAMERA FINGERPRINTSFORCEPS AForcepsMicroscopeMagnifying feather or glassandcotton glass SeveralPaperMicroscopeSuperglue sheets slides of blotter (optional) paper EXPERIMENTDETECTORDETECTIVECRIMECODES MICROSCOPESECRETSLABINSPECTORFORENSIC GraduatedNinhydrinSoftTalcum pencils powder powdercylinder (available or measuring in school laboratories or science supply houses) CameraWide plastic (optional) sticky tape with metric units SPY DetectionThis list is byfrom Robert Crime Gardner. Lab 101: Experimenting with Crime cup 38 ntortop. Pogue .na.ze Okay Inspector, find your way through the maze to get to the center of things.

39

45 EST COPY AVAIIIIA13112 GaT2e0 RanDropped out waving a ball on the floor Thisrupeatol.Inspector. is a "Simon ParticipantsSag Says" game must with follow one the child orders playing of the the inspector part of childrentionsAsk a and volunteer are practice seated, or performingstaff welcome member them them or tovolunteer in the sequence. library. to learn WhenDivide the the themo- lastonlyHere one if the areremaining wordsome "Inspector"suggestions: becomes thesays Inspectornew is used Inspector. insays the tie command. your shoe The andcarefultheirchildren introduction, sleuthing attention into teams skills to the everything and willvolunteer introduce he tested that will theandhappens. hop program that into they Afterthe by shouldroom thesaying welcome and pay that very ContactPlatt/Te a localATea motorcycle dealershipCrawlInspector oron someonethesays floor hop you(Ifon aone knowchild foot does this, he/she is out.) discussperformtheDistribute volunteer what the sequence ahappened mixed-up or staff of memberand actionsset putof cards theperformedand cards thento each leavein them. theteam the order Make and room. inask several which them to theirBringlibrarywho ownspicture. sunglasses and a take motorcycle. Invite the and thechildren's a bikerchild Invite tojacket pictures themhold for ato largestandingbringthe children sign their alongside with cycle to thewear to words, it.the for othermakingsets of teams cards up a to setand put of repeat intoaction sequence. the cards game, and or performing let each team them have for funthe InpicturesplentyageMission X1183 them of Accomplished!,on supervision.to orderthe get library on Didthe Ifwebmotorcycle youasThis thesite, use picture with a digitaland parental is be taken. camera,sure permission. thatDo display not there encour- is the onesupHere's two below aidentical chance written forsets onkids of them. index to practice cardsGrabbedHopped withtheir inmotionsasleuthing onsheet one of such foot skills!paper as theMake flapper TwirledSneezedTouched around threesomeone's in times a circle head 40 Craft Materials51.9 Hat Spy hat pattern Atka° Reco Tit.119 Mission:Score byImpossible Danny Elfman. Music from the Original Motion Picture ScissorsMarkersCrayonsPaper Videos Recess:For the LoveSchool's of Benji. Out. (84 (85 minutes) minutes) Directions head.theofPrecut this hat chapter.theto a spy strip hatGive of and paper one hat patternand band tape patternsto oreach staple childprovided to tofit color. each at the child'sAttach end Guest 2TeOeriteT Contact the band director at a local middle or high ortheschool television movielibrary. and Mission inviteAsk program. if the theyImpossible band could perform playor another the or themerehearse spy movie song at to 41 5PY GIMES Secret Agent Bacige arid 51.etith Cap

42

48 nY5TERY 'PARADE 131teti/1 Board

43 49 nY3TERY PARADE 13taet111 Board 0

DecoTatioDO 411

0 44

50 nYSTERY PARADE Butte-0 Board

45 51 nYSTERY PARADE NaT2etago

46 52 n\e'sTERY hccorcPLisHED Footprints

0

47 53 nY3TERY PARADE NaDetags

48 5 4 nYsTERY PARADE. 3p9 Hat

49

5 5 slairaos 0.4-alaYs-a %t1. plooct 6sPila jaaana 6011-gols6ds GNy 0,e1ct1000a toloollz n1001011?tippet ?000I1Die: Play: The n90-terg 3F9 of the Hatnnect Library by Rose a Book. Notes and Tips Thistips! show is appropriate for children of all ages. Here are a few TrevinoProps or* For paint the library backdrop, bookshelves, use a large books, piece a of book white cart, fabric etc. andon it. draw The puppets.the* Two1 bookworm.will puppeteers playPractice the Both partand are puppeteersseeof needed the what girl. forworks Puppeteerwill this best.alternate puppet 2 will show. with play thePuppeteer the other part of *paper.cloth BackpackSleuth will hat fit for foreasily girl girl aspuppet puppet a backdrop that says and "Jackie won't Superwrinkle Spy, or tearPrivate like narratorspyglassesmysteryand* Ask agree a volunteerwilltheme, to around playstand the the orhis/her innarrator libraryfrontpart neck,of of could staffthe the andnarrator. memberstage wear wear toa sleuth reciteaInto long keepingpractice hat,or dark read have withcoat. the theyou The ?uppeto Eye"1. Girl puppet youmusiclines. decide Theon and narrator to offinclude and would raisingmusic. also Thisand be loweringresponsibleis optional. the for volume turning should the 6.5.4.3.2. PigWolfBookwormBoyGiant puppet ao,,,00 ciC) Qr, v0 crt, ar9 00 CO 00 (3P ca, 00 50 The n90-teT9 of the ilatmtecCAn LDDTaT9 original. script 139 Rose SJ. Trevino alarm,Jackie:Narrator: so Most I guess Jackie of the it's starts lightssafe toto are walkcheck out slowly thingsand I heardaround out. someone the library. set Whenthe JackieNarrator:Curtain is closed. convinced Welcome thatto "The strange Mystery things of are the happening Haunted Library". in her biginspection,Nowshe book. gets Jackie Incredibly, to she the can can picture hear see the thata book rhyme:worm a small area, has wormshemanaged sees is crawlingmovement. to open overthe On cover. to closer a corners,didn'tsleepingwaslibrary. sure see Just butinshe anyone. my yesterday, thereheard bed, was Shea andtiny nobodyshewalked here raspy was she hiding.aroundvoicepassing is!" say,When theShethe "Somebody's shelves folktaledid she see looked, andaarea copy looked been whenshe of she in AndJackTo fetch Jillfelland came adownJill pail went tumbling ofand water, up broke the after. hillhis crown OpenpickedGoldilocks curtain it up, and closedto thebackdrop Three it and Bearsof put library it that back stacks.had on fallen the shelf. to the floor. So she Jackie:Bookworm: Who's there?Oh my! Come I thought out. I've I was got alone. you surrounded. Who are you and superbottomJackie: spy Somethingof privatethis. I'll eye comestrange kit. back is going later juston and before I'd betterclosing get with to themy here?Jackie:what are I'm What you the doingonedo you who here? mean, should who be askingam I, and those what questions. am I doing I can't sleuthClose curtainhat and briefly a backpack. and then re-open. Enter Jackie wearing a believeBookworm.Bookworm:talking I'm to talking a worm? AndExcuse to I livea me,worm. here. but (To Thesemy the name areaudience) myis Hermie. books Am andIHermie, really inside the my InwanderJackie: the background, Nobodyover there ever andsomebody checks stay still behind says, until "Thethe the puppet lightsLibrary gostage, is off. now so closed."I'll just talkingJackie:books are I'mabout? all Jackie, my friends. Super Spy,Who Private are you? Eye and what are you thenPlay fadetheme the music music to to the a very Pink low Panther background for about level. 10-15 seconds, 51 Bookworm: Every evening, I take turns visiting my friends. IvisitWhy had my justto seefriends yesterday, him inbefore the I couldn'twoods. he went Baby wait to sleep. forBear the is libraryjust so toadorable close to and Bookworm:bookworm.Jackie:Red. ThatWe were girlHermie, never here the andtakes name I stillmy is warning can'tHermie. believe seriously. Now I'm I must talking And visit I doto a cools?goesJackie:Bookworm: for Baby a walk Bear. Give with Are yourself Mama you talkingand an A.Papa Youabout Bear got the while that Baby one their Bear right. porridge who Hermieworrythe book, about crawls Little her. towards Red Riding the fairy Hood. tale Outsections pops and the startswolf to open Enterman.Giant: Giant FEE, FI, FO, FUM, I smell the blood of an English- Bookworm:sniffdon'tWolf: -look Lookingbut asyou'll tastyDon't for do. as someone?just bacon, stand (goes Ah,there. overand Help whatto sniff me have Jackie)get we him here. sniff, back You sniff, into sionChaseBookworm: Impossible" scene Run!occurs sound Run here. towards track Play for fast the about chaseJack 10-15 and music the seconds fromBeanstalk the "Mis- book! Bookworm:Jackie:the book! But how? Run! WhatRun before should you I do? become his supper! SoundcloseBookworm: it offast! book When slamming the giant in thesteps background. on the pages Giant of thedisappears book, ofChase "Thea book scene Ride slamming occursof the Valkyries"here. is heard Have in byfun the Wagner selectingbackground, is fast.good theWhen chase Wolf themusic. sound Bookworm:Jackie:behind theWhere stage. Someone did he come must from? have left the book open just a bit, remindedme,Bookworm:disappears. but I shouldhim That of haveRedwas close!andguessed his He's supper. that a he'dsly He one. go wouldn't after He doesn't someone think bother I whowas it.and Now that's where all that were Giant we? needed to get out. Well, that should do 52 Jackie:tasty enough I don't or get big it. enough Are you to trying fill him to tellup. me that the book characters in all of these library books can just get up out of Narrator: Jackie was so tired that she closed her eyes and wordtheBookworm: pages for it. and Oh walkThat's look, or justhere run the comesaround way ait the littleis. library?You'll pig. have to take my isDavy:immediately closing Jackie. in fivefell Wake asleep.minutes. up Jackie. It's tune to go home. The library YouPig:Enter Hi,didn't pig Hermie. by any I'm chance off tosee the you-know-who? fair to get apples for tonight. Jackie:Davy:long? What? Not long. What We did were you say?picking Davy, out have our library I been bookssleeping and trappedseeBookworm: you insideknow Uh-oh! thewho, Little butI think thoughtRed I Riding just he made wasHood aafter bigbook. Red.mistake. He isWe now did Jackie:wewhile.then have When you(to to the checkdecided I audience)came out toto our sitget That books.behind you, was you the one were puppet strange asleep. stage dream! But and come read on,for a CDC) Exitanyway.Pig: Suitspig Well, me just see fine.you around. I could do without that pesky old wolf Bookworm:Close curtain. Jackie, Enter Super bookworm Spy, Private Eye was a fun kid. I fastestaJackie: worm wormNow would II've think get ever tired I've seen. reallyseen it fast, all! Aren'tbut you you seem tired? to beYou'd the think Playwonder the if Pink she willPanther come music back toagain see forme aboutagain! 10-15 seconds Jackie:eyestoBookworm: be Umopen.my bedtime.sure! Good Well, Yeah! night. Willnow I guess Ithat see youyouso. Well, mentionagain I somecan't it, I seemtime? guess to it keep is getting my Exit bookworm 53 ntootop. P000me: 3F9 a book! ThereWhat is Reader'sno memorizing, Theater? acting, It is often props, defined costumes, by what or sets. it is not. Reactefo Theater makevide6. Allow pens "stage" time and notes,markersfor the such players for as them "gruff to readto highlightvoice". the script If theirtime silently. linespermits, andPro- let HeretoChildren 1.interpret Arrange are someuse their theirthe tips characters.readers voices, for a smoothin facial a row expressions, performance: or semicircle and facing hand gesturesthe audi- encethethem readers atread least the know part script oftheir thealoud lines time. before well enough the performance. to look at theIt is audi- best if andence.whenstand, sit They when finished.they may finished.may all If take standthey a arestepor theysitting, forward may they allwhile sit.may Ifreading stand the readers while and step reading back readyInstruct8.7. WhenAsk to alllisten. one theplayers player reading to to freeze isintroduce finished, until thethe the titleaudience readers and willauthor is quiet freeze of and the for story. a 3. on2.Readers Ifmusic there may stands. are holdtwo narrators,their scripts, put orone the on scripts each sidemay of be the placed stage. long moment and then they all how together. words5.best4. ReviewA ifchild thethat twomaywordsthe charactersreaders be that assigned are may dodifficult not tonot read understand.have to more pronounceconsecutive than one and lines. role. define It is 54 Reader's 'rhea-telt CTI,D0 Scole: newestBooMatthew'stheWhen case who John's investigation and got basketball found cat,to the Charlie, Charlie.bottom involvesdisappeared. vanished, ofAnd thethings thenentire Again Mookie and there neighborhood. it found was wasand Mookie it.theBoo Their time solved It and startedthat Introductionthe Case o? the Ri11 giv-9 DooTIDell 1;.9 Rose V. TITevrilo Therangclaimingfoundon only a Mondayand no sign whenonethat was waswhenthe they a same there.cutout Mrs.went thing So Martinezletterto far, answer happened ofeveryone the went the alphabet door,to to on them. answer their no - justoneThe block her one wasdoorbell door is there. and gram.ElementaryassignedThis script Library in has variousschool staff four children maywayscharacters also to twoor participate. andteens or morea maynarrator. individual read Thesethe entire readers. may pro- be Mookie:eighthsingle letter.stop Okay is They Mrs. Mrs. areMartinez's Martinez. determined house. Tell to me solve what this happened case. Their after you towhatand the the they library. readers will Today, be for learning each you part. are about. inExplain Atfor For the a different example,withbeginning a short storytelling "Hello, of overview the welcomeprogram, introduce the characters outsidedoorbellheardMrs. the Martinez:and ring. doorbell looked When I ring. wasaround, I got baking to but the some Idoor, didn't cookies no see one anyone. whenwas there. I Whenheard I went theI narrator'sMartinez.Mookienatelyexperience read and parts.Our calledthe Ms. librarycharacters' This Brudi. Reader's story volunteer, I will dialogue.isTheater. called play Ms. the'CrimeMs. She Athena parts Gina will Scene: of playwilland Boo Ireadthe will and partsCase the alter- Mrs. of doesBoo:headed yourAn back "L". first inside, Somebody name I beginfound left with this you anjust the "L"? outside letter "L". my Mrs.door. Martinez, Clinehowthe Ringing many50/10: of Doorbell.' youthe canCase solve At of the thisthe end Andcase." R1/4/19 of now,the story, the Doorbell. script! I'd like to know clueBoo:Mrs. log. Martinez:"L" for Louise. My name Mookie, is Mary. let's Marymake Louise.a note of this in our youngNarrator: detectives Mookie who and helpBoo solveare the crimes code innames their usedneighborhood. by two 55 you.Mookie: Got it. Thank you Mrs. Martinez. We'll get back with the house until after lunch when Mom reminded me that my sendingMookie:"S's"Boo: andSo a far, Itamessage. could"K". we haveWhat's be I anything,can an yourfeel"L", it.guess?an but So "A", Ifar, think a we "B", thatcan an spellsomebody's "E", the a "P", words two librarytheBoo: morning. booksI was outwere Her walking due. new So puppy, Mrs. that's Smith's Libby, where threewantedI spent dogs myto sniffat afternoon. 7 o'clock everything in almostNarrator:Let'sAbe, gobake, everyone speak All bakes, day, to theon yes,Mookie theMiller's. tab, block. and TheBootabs. Leyton's rangIt just doorbells doesn't were atmake and church. spoke sense. The to leavingonMookie:so itsomething took for work. Meeta while. real me Ifastat saw the and some library then early I'llin anjoggerssee hour. you plus there.I'm agoing few peopleto check theiraddedtheyoungnap, neighborhood list. couple;anyap, Now"N", sap, Yvonnetheya map"P", handyman. had andan and more "M",lap. Allen, The wordMorean "0",werepuzzle combinationsletters an out was"S" ofwere townandgetting found twoincluding as bigger.was "I's" and Tony, tothey ofbeenseenNarrator: construction atwheeling the Mookie library something paper suddenlyon Monday.and onsome remembered her Ms. square cart. Brudi, She wooden something alsothe librarian, had things. quite she On had hada bither letter"P",Boo: of Natasha I the don't alphabet? get an it."N" Who And and would Sonianot just ringan any "5". a doorbellletter Pete just received to leave a a lookedpapers.wayoutout. to to Up thelikeWhen the inback a library herstencil Mookie office, room, toof meet walked asheMookie flower, had Boo. by thrown grabbedso the she trash reachedaway that can, astencil small shein and saw andstack pulled what headed of it Hmmmm,andMookie: Allen Another return,this is Igetting"S? wonder " That really if makesthey'll interesting. threereceive "S's". a "Y" When or an Yvonne "A". Mookie:Boo: Why Look all the at this.secrecy? Did something else happen? usualMookie:Boo: Whatstuff Let's anddo makeyou anything mean a list unusual.by of that?what Ihappened thinkhad to it's clean onweird. Monday, my room.... all the Mookie:Boo: What It's is a it?cutout of a flower. Boo:Mookie: You clean Very your funny room. and Yeah,quit interrupting! that is pretty I unusual.didn't get out of 56 Boo: So what? Mookie:me. Hello I think Ms. we Brudi. will Whathave thisare youcase working solved soon. on? Just follow thingspyglasses, missing the were sleuth the hat letters. and the magnifying glass. The only butMookie:Ms. my Brudi: display What I wasitems kind going have of items todisappeared. finish were working they? on my bulletin board, Mookie:theMs. display? Brudi: Are Can you you going guess to tell what us? the theme is just by looking at a displayBoo:Ms. Brudi: Ms. for Brudi, our Oh, Summer just can someyou Reading tell patterns us what Program. I was your working patterns on. looked I'm doing like? twoNarrator:itMs. is. "S's",Brudi: Thingstwo No, more I'm were going "O's", coming to and let together anotherour summer "I", fast. Mookie readersWith another andguess Boo what"B", Mookie:SherlockMs. Brudi: IsHolmes Ithere had someanything silhouette, spy elsestuff and you some can bookthink patterns.of that you're Why? a spyglass, a camera, a lettersfigurereadingwere on outat program. theirthe was doors. way who And to actually discovering they eventuallyrang the doorbellstheme did. What for and the they leftsummer couldn'tthe up.letters.Ms.missing? Brudi: Look Well at the actually, bulletin the board, only thingthe rest missing of my werepatterns the are carryingsawaboutBoo: her Hey Monday walkinga Mookie.small morning. bag.down I've She thejust You was sidewalk remembered knowwearing Ms.in aour T-shirt Brudi,something neighborhood thethat librarian? said,unusual I Ms.Boo: Brudi: Letters? Yeah Like in the alphabet letters? how'd you guess? I cut out letters to spell out couldreadshe`Mission what washave waswalking swornImpossible" on theshe to back. Yvonnewas or holding that'sWhen and what sheAllen's something sawI thought house. me shein itDoher wavedsaid. youhand. I knowcouldn'tand And I Narrator:this year's Mookietheme for and the Boo reading looked program. at each other and then said?whatNarrator: I think? Can I bet you she guess was holdingwhat the a back "Y". of Ms. Brudi's T-shirt bulletinlooked back board. at theThere bulletin was thatboard. Sherlock There wereHolmes clues silhouette, all over thethe 57 noate Story 1Dy Donna Ingban Vas a 5p9 theother's,inviting "boom, orthem some boom, to combination.mimic boom" the scene teller's TheySinging with walk could the "Theand/or bass also Olddrum. chimetalk, Gray or in eachMare" during that might be a good way to APeTfornarice involvedlot of the in humor the Notes story and dependopportunityand Suggeottoris upon forgestures children fopand tofacialTearig become expres- Mollie'sconclude husband. the program It's ansince easy it songwasAnd written for now, children theby Gusstory! to Bailey,learn. canmayspy..."sions. begin be Theand told to introduction,ending inham a pretty it with up astraightforward"...And beginningbit, just that's as with Mollie when manner."Mollie probablyshe got BaileyThen, to would be the was a spy",teller a nom.° Bailey Xas Oh,Mollie really, Bailey for was most a spy. of her life she ran a circus, but for part 5p9 whenfocusedhave.use talkingexaggerated and involved. about hand the Tellers quininegestures can Theto to make reflect indicatestoryteller's a wrinkled-up-noseits Molly'sunpleasant body big language hairdo,odor, face will help the children stay oldof 1844,her and life alreadyand she by was themarried a timespy. tothe Gus Civil Bailey,She War was brokea bornmusician outon ashe who'dplantation was grown21 yearsin Alabama back in the fall of oldhidingand ladyequally of and the minimized back quinine. to a young gestures womanThe to indicate transformation allows the for wrappingvisually of Mollie humor- and from a young woman to an winter.gotup transferred in Molliehis daddy's volunteeredto a circus.regiment to in go Flood'sGus along enlisted asTexas a nurse. in Brigade the And Confederate thethat's next Army there in Alabama and back,bodythatous actingMollie languagestooped onwas theshoulders, suchquite part asan of a actress atheturned-down hobbling teller. herself! Itgait, also mouth, The a reinforcesscratchy storyteller a hunched-up voice the can fact and use whenSoquininea sheshe saidgot bitter toshe'd be medicine, a take spy. it to butthem,She very evenheard useful if that she for somehad treating to of go the through malaria. Arkansas soldiers were in need of justmovement.Ifany asthis otherdeliberately. happens, "aging" Then milk "un-age"indicators the moment! Molly, to bring perhapsExaggerate smiles more or outrightand quickly, hold giggles. each but Unionthatenemy quinine soldierslines. soShe they'dthat was even nevera woman if shefind didonAnd it. a See,get mission.she stopped she was made pretty by herself some smart ofa too. reallythe She figured out a way to hide story by describing Mollie's habitIf timeof mimicking allows, the people teller andcan byinvolve children directly in the 58 brushedbig headhair? and ofWell, hair. brushed she You made know,and herselfbrushed we talk some her about hairreally Texas up big from womenhair. her She fore-with smallAndhead thenup packets on she top tookand of herthen that head hidpowdered thosein what packets quinine they calledin and her wrapped ahair. pompadour. it into thanthrough he did,being even a spy though that she he'd tookIt's grown not to show surprisingup in business a circus. then even Afterthat betterafter the she married Gus and got gotthink the up quinine a good delivered scheme." and And, returned AnotherThesure officerenough, safely. time, in it chargeshe worked. did said,some Mollie "Well, real spying. depend That on ais, woman she walked to riverboat"ACivil Texas War with Show they the traveled forBailey Texas Concert all People". overThey Company.the It came South was ato andone-ring Texas even in tenttoured 1879 circus andby started the Bailey Circus, bygetright makingvaluable into an herself informationenemy up camp to look for and thelike listenedShe Rebels. an turned old in woman.She on her managedconversations mouth down to do to realthat sour like and kind of towneventhat elephantsback grew in to those andhave camels.days, 31 wagons but MollieOf and course, was about still it 200 wasclever animalsfinally dangerous and coura- to travel by wagon from town to scratchy:hobblinghunched heraround. back Whenup and she stooped talked,And"Cookies. her hershe shoulders voicepassed I've gotsounded among over cookies. and thoseold began Doand Union you want soldiers any listeningcookies today?" to nearpreparingandgeous, they the just wagonshad the as circledsheevening and had their determined beenmeal, wagons back Mollie Onewhen it just wassaw time sheas Indianssome they thewas Baileys alwaysshadowsa makingspy. weredid. moving those Whilecamped between two Texas towns, enoughandtionevery whereshe scrap awayneeded they of from their wereso that thatconversations going. shecamp could Then to be reportwhenuntil in Rebel she she'dwhat had territory hobbledthey all thewere again, farinforma- up to she circussheWarshadows. tried and drum. something startedShe Boom! grabbed firing else.Boom! anit in Sheold theBoom! pistolstarted air. Theshe beating hadIndians saved on thekept from big coming. bassthe Civil So thesomethingwhich,straightened time of she course, of was herselfan actress,ashe little upwas. girlanda performer. sheranNow likedjust she asButputting if couldn't thatshe on shewas shows. have was. in her doneFrom She 20s all that if she hadn't been possiblesoldiersno doubt hadone thinking atmore the fort.thetime. drum She waswasYessir,And, aquite cannon sure aMollie woman, enough, like had the that figured itone worked. Mollie the out Thehow Indians to make rode her offmission in terror, Andwouldand she'd thewalkget star.hertry like tosisters And thetalk sheservants tolike help,was them quiteorbut too.visitors Mollie Shea mimic. followed orwas just Behind always about her their daddy theanybody. director backs around she their plantation just as if she Bailey, Confederate spy and Texas circus lady. Sowere she a boy,was kindasking of lotsa tomboy of questions and a bit and of watching a daredevil. everything. 59 ar' CD 60 '20 17 6(7 000 410 ac, ye, C0 arD 0 ao o9 ab ap ao ot=, 60 PI.00C1 le IYQ9NiliqSIZTa90-ga6dS :01c11504 11010011Z /vUortov. Pozonie: 5F9 a book. 1)9 Rose TTeviiio 13togTaDo EnglishSpanishWould you and like in English?to promote Here and are advertise a few translations. your programs in Bti.tSpanish gal PTOnOtt011 aria ActVOTtiOtrig StoriesBilingual and Infant Songs Lapsit Cuentosbebes ybilingues canciones para Pre-school Bilingual Storytime Pre-escolaresHora de cuentos bilingues MondaySundayDays of the Week LunesLosDomingo Bias de la semana atEvery 10:00 Tuesday a.m. ATodos las 10:00 los martes a.m. ThursdayWednesdayTuesdayFriday ViernesJuevesMiercolesMartes Whole225-READBilingualFor more Family information,Storytime for call the paraalPara Hora225-LEER todamas de informationla cuentos familia bilingues llame Saturday Sabado BedtimeStorytime Stories CuentosHora de cuentosde pijamas 60 .nistifm Post lie: jEspfa. Loo tootov Pozo rDoict[eT 2110gt3-DO Firignp[a.90 3p9 a Bo aritDgeol intostori Poortlie: 5p9 hvinalz! Este(Traditional) marranitoDaTTalitto fue de compras. This(Traditional)Thin little Little piggy Pigg9 went to El Como130010gato de los las animales mil to narices Share by Margarita by Margarita Robleda Robleda Moguel. Moguel. Este marranito se qued6 encasa. This little piggy stayed home.market. El d'OsoPulgas,ratoncitopaseo pardo, de el Rosiepequertoperro oso andde pardo Jose/ Rosie'sThe que Luis Little yes Walk byBear, aid?Mouse Margarita by What and Pat by Brown Hutchins. DoPipina Robleda You Bear, Salas-Porras. See? Moguel. Brown by Bill Martin Jr. Este marranito nocomi6 comio came nada.asada. This little piggy had none.roastbeef. NaDeRatoncito Tags y osito / Little mouse and little bear. (Patterns are Gui,Y este gui, marranito gui hasta llor6 que llegoa casa. "Wee,And this wee, little wee" piggy all thecried wayhome. provided at the end of the chapter.) 61 (Tradicional)EL 9330 Trevino.)(EnglishThe Gat translation by Rose (Tradicional)T5/1 TatoriCito Trevino.)(English translation by Rose Little nouSe una,tieneCuatro dos,un patas gato, tres, cuatro. One,HasFour a legstwo, cat. three, four.(Hold up four fingers) yayibaUn este seratoncitopor ha cuentecito un acabado arado isandtoA nowlittleswim this long mouse inlittle a gone. pond story ran R.119De0 (Count four fingers) 'Pest-to, pesito, Fesito Nactaba-D(Tradicional) Trevino.)SwiDDIDg(English translation by Rose Pesito,(Traditional)Al reloj pesito, subio pesito un ratoncito, TheHickory,Hickory, mouse dickory,ranackom, up the dock dock clock, (Traditional) ynadaban,nadabanNadaban, no se mojaban. los nadaban,nadaban, patos SwimmingtheySwimmingthe ducks always and go and stay by,swimming, swimming, dry. LaPesito,Y una el ratandi6 pesito, se b.*pesito. TheHickory, mouseclock struck dickory,ran down one, dock. (Tradicional)Palmas Trevino.)(English translation by Rose Le* Clap Trevino.(Thiscal:aid-to traditional Recorded IDLarieo song on Dewas Colores transla tedby into Jose-LuisLittle English VhitelloVe Orozco.) by Rose yquePalmas, trae viene un palmitas, perrito papa He'sHereLet's broughtcomesclap, clap, daddy me clapa puppy LlevameSacameCaballito de ablanco, miaqui, pueblo, TakeLittleGet me whiteme to out my horse of town, here, que dice gud, gua. That says bow wow. 62 Donde yo Where I was born. TtiTengo, no tienes tengo, nada. tengo YouI have, don't I have, have Ianything. have GaDe OtraUnaEnTengo una me tres manada. da borregaslechelana, AnotherOneInI have a flock.gives givesthree me melambs milk, wool, ,MamimaskingCreate ,13trecto? a tapestarting on theline floor and ata finisheach end line of by the placing room. stripsYou may of .notheT .71A9 ParaY otra la mantequillasemana. ForThe theother whole gives week. me butter crossarepersonbeginningalso all the uselinedwill starting ofstring stand upthe at game. or lineatthe yarn.the startinguntil Selectfinish Give they oneline.line all are of person andParticipants given the face children to permission. participantshe Mami. should nametags ThisThe not who at the JaguarMaterialsGraft pattern .a0k rules1. Mami are as callsfollows. out the name ofthey atake player will a certain be and animal asks number himsteps. orof For hersteps. example to Instead of regular steps, 2 bunny steps, 3 ScissorsTapeStrawsCrayonsTag board or or hole and craft markerspunch sticks or string 2. The Player whose name is calledbeforewithmighthorse saybrown steps, askhe "Mami, orgroups eyes" 4she pig takesi,puedo?" steps,toor take"all a etc.step childrenthe If steps, the wearinggroup such isas blue".large, "all children Mami theInDirections advance, endchildren of this tracedecorate chapter and thecut onto maskout the the usingtag jaguar board. markers face Cut mask andout the crayons.pattern eyes. at Let 4.3. FirstThe player player loses to reach a turn Mami if he at newi,puedo?"or the she Mami. finish doesn't line ask becomes "Mami, the Tapeattachmask a straw so string a childor so craft thatcan stick thehold maskto it, the or can insidepunch be end tiedholes ofto ononea child's either side ofhead.side the and TresDosUn paso pasospasos ThreeTwoOne stepsteps steps 63 SeisCincoCuatro pasos pasos pasos SixFiveFour steps stepssteps NueveOchoSiete pasospasos pasos NineEightSeven stepssteps steps gallopollito roosterlittle chick kikirikipio pio doodle-docock-a-peep peep deMamiDiez conejito." pasos dice "da tres pasos TenbunnyMama steps steps."says "take three ContactGuest a petSpeakers store and invite a representative to bring a few ElefanteTortugaConejitoYou can use the following animals: TurtleElephantRabbit rabbit,small pets a mouse, that young and a childrenguinea pig. can look at and pet, such as a RatoncitoGatoPerro MouseCatDog "Los"Patico-Patico"Audio Pollitos" RecorcciDgo en en Lfrica Infantiles infanta por4: con"Anima HugoVol. Jose-Luis 1Uscano lespor y Hugo movimiento"Orozco, y Javier Liscano. Volumen Galue, por Jose-Luis Orozco. AnimalApingActivity soundshow (to animals 00014 in Spa/45h? Animal Spanish English SpotLeo,Videos eland retotio His Grandparents tard(o and Leo Go the to Late the Carnival.Bloomer. (30(6 minutes) minutes) patoperrogallina(ah knee MAWL) dogchickenduck cuaguacara(wow guacua cara wow) quackarfcluck arf cluckquack borrego lamb behhh behhh bahhh bahhh 64 Daturgeza., 1,tchos 9 Tepti.001. / 20011)Le: jEopia La (Tradicional)LaFillgeT1*-90 boniguita Trevino.)(English translation by Rose Little ant ntootoD Possate: 5F9 Nato-re, 33trgo alicC R.eptiiez! Andaba la hormiguita A little ant waswalkingarm)(Fingers climb up your OlmoUnTheBooks grillo Desert y la en mariposa is tomi My cocinaShare Mother azul by by /Margarita El Alma desierto Flor Robleda es Ada. mi madre Moguel. by Pat Mora. LeJuntando coge un su aguacerito comidita rainstormWhenGathering along her came food a (Cup hands together) SanaSalta,La oruga ranita, ranita, muy sana salty hambrienta by and Margarita Jump, and Frog,The RobledaEric Very Jump Carle. HungryMoguel. by Robert Caterpillar Kalan. by Que cone para su casita So she ran towards homearm)rainstorm)(Use(Run fingers fingers to showdown a your chapter.)NaveFlowerpot Tags and cloud. (Patterns are included at the end of this E.19T2e0Y se meti6 en su covachita. (Placeanthill.And dove fingers straight just underinto her yourbottom) flavoredpretendServeRefTesimerlts raisins they with are andcinnamon eating sunflower pill sticks. bugs seed In andkernels. a pot, ants. heat Tell Serve apple the apple kids juice tojuice on (Tradicional)Agua Trevino.)(EnglishWateT translation by Rose afterlow and it is add warmed a few up. cinnamon sticks. Stir and remove from heat 65 LaAgua que con te mojala que al te Hover balms ItWater wets you you use when it to it batherains La que tocone gusta por beber. los dos AndIt flows you through like to drinkthe rivers it. LasLos nubespajaritos se levantan.cantan, The cloudslittle birds are slowlyare singing, rising. (Tradicional)Gliao Trevino.)(EnglishCricket translation by Rose QueiQueQue si, 51, caigaquecanta que no, unel no, labrador!chapan-on! SayLet'sSings yes, have thesay a farm niceno, worker.downpour, CuandoMeSueEn las gustale alegrarnosnoches voy escuchar por fresquecitas el un camino.su grillo canto WhenOnIa verylikecricket I go tocool hear forbrings nights a hiswalk. us song joy Laotwonot(Spanish hoTni9a0 ain word the adaptation Spanishfor T2 word aTellan version, translationand translation the solittle that by one when Rose does theyTrevino. not march stop This to two tie is by Las50119 hojitas Little Leaves Lascough.)his shoe, hormigas but rather marchan stops una because por una, "tiene hurra, una hurra tos" he has a Las(Tradicional) hojitas, las hojitas LittleTrevino.)(English leaves, translation little leave by Rose debajoYLaLas despues chiquita hormigas de la todas setierra, marchan para se BOOM, marchany chupa una BOOM,por su unadedo BOOM LaYVieneDe se lalos ponenla elarboles la viento la. a bailar se y lascaen, levanta LaAndthemTheFall la windfromthey la la swirl thecomesla. trees, in and a dance lifts Las hormigas marchan dos por dosdos, hurra, hurra (Tradicional)iQue ittrestal Trevino.)(English translation by Rose Rat/q/19! LasdebajoYLa despues chiquita hormigas de la todas tien-a,se marchan para se BOOM, marchanporque tres BOOM,tienepor tres, una BOOM hurra, tos hurra LaiQue vieja llueva, de la que cueva. llueva! TheIt's raining, lady of it'sthe raining!cave. 66 Las hormigas marchan tresties por trestres, hurra, hurra La chiquita se para y anda al reves Las hormigas marchan ocho por ocho, hurra, hurra LasdebajoY despues hormigas de la todas tierra, marchan se BOOM, marchan cuatro BOOM, por cuatro, BOOM hurra, hurra debajoYLaLas despues chiquita hormigas de la todas setierra, marchan para se BOOM, marchany se ocho come BOOM, por un ocho bizcocho BOOM debajoYLaLas despues chiquita hormigas de la todas tierra,se marchan para se BOOM, marchan a ver cuatro un BOOM, zapatopor cuatro BOOM LaLas chiquita hormigas se marchan para a ver nueve si llueve por nuevenueve, hurra, hurra LaLas chiquita hormigas se marchan para par cinco a dar porun brincocincocinco, hurra, hurra LasdebajoY despues hormigas de la todas tierra, marchan se BOOM, marchan diez BOOM, por diez, BOOM hurra, hurra LasdebajoY despues hormigas de la todas tierra, marchan se BOOM, marchan seis BOOM,por seis, BOOM hurra, hurra debajoYLaLas despues chiquita hormigas de la todas setierra, marchan para se BOOM, marchany dice diez fin,BOOM, por no diez mas BOOM debajoYLaLas despues chiquita hormigas de la todas setierra, marchan para se BOOM, marchana rascar seis BOOM,por sus seis pies BOOM The(This ants Antstraditional go Giomarching songnaTebirt5 isone gently by one, adapted hurrah, by hurrah.Rose Trevino.) LaLasLas chiquita hormigas hormigas se marchan para marchan y resbala siete siete por en por sietesiete,aceite siete, hurra, hurra, hurra hurra ToAndThe get antsoutlittlethey of go allone the marching go stopsrain, marching BOOM! to onesuck downby hisBOOM! one, thumb, to the BOOM! ground LasdebajoY despues hormigas de la todas tierra, marchan se BOOM, marchan ocho BOOM, por ocho, BOOM hurra, hurra 67 The ants go marching two by two, hurrah, hurrah. AndThe antslittlethey go allone marching go stops marching to twotie hisdownby shoe,two, to the ground The ants go marching seven by seven, hurrah, hurrah. TheTo get ants out go of marching the rain, BOOM! three by BOOM! three, hurrah, BOOM! hurrah. ToAndThe get antslittlethey out go oneall of marching gothe stops marchingrain, to BOOM! sevenpray down to by heaven,BOOM! seven,to the groundBOOM! ToAndThe get littlethey out all oneof gothe stops marchingrain, to BOOM! rub down his BOOM!knee, to the groundBOOM! AndThe littleantsthey gooneall marchinggo stops marching to moveeight down bya crate, eight, to the hurrah,ground hurrah. AndThe antslittlethey go oneall marching go stops marching to fourshutfour down bytheby four, four,door, to the hurrah, ground hurrah. TheTo get ants out go of marching the rain, BOOM! nine by BOOM! nine, hurrah, BOOM! hurrah. TheTo get ants out go of marching the rain, BOOM! five by BOOM!five, hurrah, BOOM! hurrah. ToAndThe get littleantsthey out gooneall of marchinggothe stops marchingrain, to BOOM! climbnine down by a BOOM! vine,nine, to the hurrah, groundBOOM! hurrah. ToTheAnd get antslittle outthey go one of allmarching the stops go rain, marching to BOOM! fivetake by a down dive, five,BOOM! to hurrah, the BOOM! ground hurrah. The ants go marching ten by ten, hurrah, hurrah. The ants go marching six by six, hurrah, hurrah. ToTheAnd get littleants outthey goone of allmarching the stops go rain, marching to BOOM! sayten by"THE down ten, BOOM! END!" to the BOOM! ground TheToAnd little get they out one all of stops gothe marchingrain, to pick BOOM! updown sticks, BOOM! to the groundBOOM! 68 MaterialsBoolotonCrafts BooknaTk "El coqui" en Ldrica infantil conJose-Luis Jose-Luis Orozco. Orozco, Vol. 3 por Directions chapterPre-cutCrayonsBookworm bookwormand pattern give one using to each the childpattern to atcolor. the end of this I,Video Crocodile.The Day Jimmy's (10 minutes) Boa Ate theEnglish Wash. (8and minutes) Spanish. Available in MaterialsClouds / 120 rill3e0 GlueConstruction sticks paper Directions ballsstickGiveCotton ontoandeach ballsask thechild themconstruction one to sheet make of paper. clouds construction by gluing paper the andcotton a glue antsmagnifyinglibraryCallGuest ata pet work.so thatstore.presenters glasses Sing the and kids"The soinvite theycan Ants the seecan Go owner how take Marching". fast turnsto bringthey closely move. an ant examining Bringfarm toa fewthe "LaAmito cucaracha" Recordings en Infantiles porVol. Hugo 2 por Uscano Hugo yLfscano. Javier Galue, 69 .7210671 2001131.e: tosion possme: $p9 Food jEopfa copictal / inusuallyies.chocolatemothers the They "Mexican sold to areis bring made.separately available Foods"a molinilloPurchase atfrom aisle. grocery andthesome cookiea stores potgalletitas, to section. althoughshow which the They theychildren are may are cook- behow ElLlamanLabooko ratoncito,gallinita, a la to puertaella gallo fresaShare and yroja el The frijoly madura Doorbell by andAlma y elLittleRang granFlor Mouse,by osoAda. Pat hambriento Hutchins. the Red Ripe Strawberry and the Big HattanctoF1.119eTp[a90(Tradicional) un htrevo n1141-119(English translationan Egg by Rose LaUna tortilleda sorpresa and para The Ana Tortilla Cristina FactoryHungry by Margarita by Bear Gary by Paulsen.RobledaDon Wood. Moguel. thumbEste(Raise isnirio theone hallo littlefinger unfat at huevo.one a time who beginning ate the egg.) with your pinkie. The ThisTrevino.) little boy found an egg. Navechapter.)Strawberry Ta50 and molinillo. (Pattern included at the end of the EsteEste lole lope16.gordoecho coci6. la chaparrito sal. se lo This onelittle cookedsaltedpeeled fat one it. it.it. ate it. RefTesimmtoPurchase or borrow a molinillo. (A molinillo is a wooden whisk (ThisEste traditional fingerplaycomi6. is translated into English by Rose This one molinillo.group,lateused and in invite Mexican make Be themsure the cooking.) chocolate toto stircome until Purchaseup ahead theone chocolate ofby milk time.one andto If foams! takeyou Mexican ahave turnDistribute a choco-at small the a Trevino.Estetime.) compr6 It is similar un huevo. to the one above. Raise one finger at a This one bought an egg. parentaldrencup of may Mexican permission! be allergic chocolate toOr, chocolate invite to each one orof of milkthe the children. soHispanic be sure Some storytime to get chil- 70 Este encendiotrajo la sal. el fuego. ThisThis one one brought lit the thefire. salt. YEste este lo picaroguis6. gordo se lo comio. And this fat rascal ate it. This one cooked it. EL(Tradicional) chocolate chocolate(English translation by Rose 13,11912e0 YBatir, el chocolate batir y batir a subir. AndTwirlTrevino.) the and chocolate twirl the frothmolinillo willrise. TortillitasPrtiata$(Tradicional) de manteca LittleTrevino.)(English tortillas Tortillas translation made bywith Rose PlayActivit9 the longer version of "Chocolate" by Jose-Luis Orozco Tortillitaspara mama de que salvado esta contenta. LittleFor mama tortillas who made is very content.withbranshortening song.andfrom let lirica each infantil, child shake Vol. 4.their Distribute instrument percussion with the instruments beat in this (Tradicional)papasPara papa que esta enojado. 'PotatoesFor papa who is angry. Estename!. I'VATaritto Board R119De This Little piggy Papas y papas para mama;papa, Potatoes,Trevino.)(English translationpotatoes for by mama.papa. Rose Esteboard(Adapted marranito from and the translated sefive fue piggy de by patterns Rose Trevino. at the end Make of this a flannel chapter.) This little piggy went las quemaditascalientitas para para papa, mama. The burntnice little little hot toasted ones onesforforpapa. mama. Este nocomi6secompras, qued6comio came ennada, casa,guisada, This little piggy stayedhad none,meat home,with gravy,shopping, 71 QueY este Ileg6 Hero su gui, nana. gui, gui hasta AllAnd the this way little to piggyGrandma. cried"Wee, wee,wee" Hoy es jueves Today is Thursday HoyGonzalez,(SingSongs e0 Wrie0to the Children's tune of "Are Librarian You Sleeping?" for San Antonio Adapted Public by Irene Library, rrocta9 to noricta9 JuevesHoy esmuchas viernes, fresas. TodayThursday, is Friday lots of strawberries (repeat refrain) Hoyand Rose es lunes, Trevino.) Today is Monday, Sabado,byViernes, es sabado, heladoel pescado TodaySaturday,Friday, is Saturday fish ice (repeat cream refrain) (repeat Lunesj,Que los corner?comer? ejotes, Monday,What's to stringeat? beans, byHoy es es Domingo, Domingo, Today is Sunday, refrain) HoybyMmm, es es martes, mmm,martes, mmm TodayMmm, ismmm, Tuesday, mmm Domingo,zQue,Que corner? como comer? todo, Sunday,What's to I eat?eat everything, LunesMartesj,Que ,Quelos corner? losejotes, corner? camotes, Monday,Tuesday,What's to stringsweeteat? potatoesbeans, jAy de mi! Oh, poor me! HoyMmm, es mmm,miercoles, mmm TodayMmm, ismmm, Wednesday, mmm GraftMaterialsApp.° and VorT2 Apple and worm patterns MartesMiercoj,Queby,Que es corner?miercoles, loscorner?les, camotes,cerezas Tuesday,Wednesday,What's to sweeteat? cherries potatoes Directions CraftCrayonsGlue sticks Mmm,Lunes losmmm, ejotes, mmm Mmm,Monday, mmm, string mmm beans, 72 themchildCopy tousingand construction cut the out patterns one paper apple at the andand end cutone ofthem worm this out chapter. pattern again forGlueto giveeach downwormthem strength.behindto the end the Let ofapple. thea craft children stick, color and pop both the patterns, worm upglue and the "ElAudio Atole"Chocolate" engm:Tall-go Lerica en De Infanta Colores conby by Jose-Luis Jose-Luis Orozco,Orozco. Orozco. Volumen 2 Pete'sVideoLa Gallinita a Pizza. Roja (6 minutes)y otros cuentos populares. (37 minutes)

73 ntootop. Po001131e: 5p9 a Bo totOri Poot iLopfa aniDateol?Te0C11001/5C11001.k5e ?Tovarl pineappleServeR, pineapple juice. Pourjuice thepopsicles. juice into To anmake ice them,cube tray.buy aAllow can of the ents BorreguitaBooks y el to coyote/ntootori share and Borreguita ?ozonic: and the Coyote 5F9 by Verna A/111241 paperspoons.juice to liners. partiallyWhen frozen, freeze. pop Insert them toothpicks out and serve or wooden in foil icecupcake cream EightEl gallo Animals que fiveon the a la Town boda byde Susansu toAardema.tto his andMiddleton Uncle's The Rooster Wedding Elya. Who retold Went by Alma Flor Ada. 13ttetin Boani Nose? / LosNinaTomasa tres bonita pequerios the by Cow Ana jabalies / MariaLa vaca /Machado. The TomasaLowell. Three by Little Pietrapiana. Javelinas by Susan ZDe quien tionelephant'sCutes esta outmarks animal trunk, and magnifyingnoses an anteater's from magazines.glasses. nose, Putetc. Cut togetherDecorate out a anbird with activity beak, ques- an NaDeFrog and Tags Rooster. (Patterns may be found at the end of the theplaysheetCarlos following: copies with and clues of the animal suchSkunk asbooks and "this Carlosin animal English y elloves zorrilloand toSpanish eat by ants".Jan such Romero Dis- as chapter. 74 Cuckoo: a Mexican Folktale / MexicanoStevens.Cucu: un cuentoLois Ehlert. folklorico The Twenty-fiveLizard and the Mixtec Sun /Cats Lagartija by Matthew y el sol Gollub. by Alma Flor Ada. Ci.DC0(Tradicional) TatoriCito0 Five(English Little translation Rats by Rose LosFillyeTpay0 arliDalitoo The Little AniTzals DeCinco colita ratoncitos gris, FiveTrevino.)With little gray rats little tails (Wave five fingers) Sheep.)by(This Rose traditional Trevino. rhyme Create was motions trans forlated Mrs. into Chicken English and translation Mrs. Mueven las orejas, Move their ears, upyou)(Grab(Wave and down) your five fingersears and behind move CorrenDetras delos Dona patitos; Pata RunAfter the Mrs. little Duck ducklings;(Putand(Shake down)your your heels shoulders together up Uno,Mueven dos, la tres, nariz. cuatro, cinco! One,And movetwo, three, their four,nose. five!and move(Pinch around) end of your nose Cud,Por alli, cud, por cud. ThisQuack, way andquack, that quack. way, motions)and make running PorqueCorren alviene rincon! el gato, TheyBecause run to here a corner! comes the back)(Put(Countcat, fingers off on behind five fingers) your SiguenDetras delos Dona pollitos; Gallina TheAfter little Mrs. chicks Chicken follow;make(Put hands quacking together motion) and Rh9T2e0A corner ratan... To eat the rat... DardsPio,Por alli,pio, de porpio. Doha alld, Borrega AfterCheep,This way Mrs. cheep, and Sheep that cheep. way, (Tradicional)Pelsiquito Trevino.)(EnglishLittle PaTakeet translation by Rose Beh,PorVan alli, losbeh, borreguitospor beh. ThisBaa,Go way the baa, littleand baa. that lambs; way, 75 Periquito, periquito, Little parakeet, little parakeet, PorTe pareces arriba por a to abajo, Papa FromYou look your just feet like to youryour Pop La pata dijo cuac, cuac, cuac Mother duck said quack, quack, quack Por delante y por dards From your middle to yourtopmiddle, Versos:CuatroCuatro patitos patitos regresaron fueron a nadar...p'atras. FourVerses: little ducks wentcame outbackto play. La507 FlanebactoTa 1gs ''he Laundress TresDos patitos patitos fueron fueron a nadar...a nadar... TwoThree little little ducks ducks went went out outone day... Trevino.Una(This rata traditional It isvieja recorded song on is Diez translated deditos into by Jose-LuisEnglish by Orozco.) Rose WhoA little did old the rat ironing; Un patito fue a nadar... One little duck wentplay... out oneto day... Seseporque quern()push plancharera planchadora;pomada la cola. su falda SheWhile putburned ironing on a her salve her tail. skirt, i,PorElicUez que los pajaros vuelan hacia el Sur? Why do birds fly South forthe winter? leyse a qued6amarr6 la pobre un un rabito.vieja trapito AndEnded thetied up poor a with bandage little a shorter old on oneher tail,tail. i,QuePorque animal tardarlan come mas con si la sefueran caminando. What animalBecause eats it wouldwith its takelong toofor them to walk. Cinco(Traditional)Gino patitosFatitos fueron a nadar Five(Traditional) little Little ducks Pucks went out Todos, ninguno se la quitacomer.cola? para All of them, not one takesofftail? it when they eat. Sobre el lago y mas alla Over the hill and far awayone day 76 makethe coyote flannel and board possum animals.) patterns at the end of the chapter to (Traditional)Um.(Repeat&tom bornigtrita this Vith "story with No no End!end" over and over!) (EnglishA Little translation Alit by Rose Regocueva.Narrador: el Un coyote. dfa Habfa tenia unalas patasvez, un apoyadas tlacuache sobre que la vivia pared en cuando una SeQueEsta rob6 sali6era ununa de granito hormiguitaun hormiguero; ToWhoThereTrevino.) steal left was a the little a littleanthill grain ant Tlacuache:Coyote: ,Qtie Piles hates, nada. Tlacuache? SeDelY volvi6vino rob6 mismo otra un a sugranito hormiguero;honniguita hormiguero. WhoFromAlongAnd then camethe came samereturned to another steal anthill toa little the antanthill. vaTlacuache:Coyote: a hundirse j,Porque Sabes y si tienesseque cae, estoy las nos patas atrancando tapa. apoyadas el camposobre la del pared? cielo que Y volvi6vino otra al hormiguero.hormiguita... AlongAnd camethen returnedanother littleto theant...anthill.grain laTlacuache: Coyote:pared. Haz (Aye, iClaro fuerza. que que horible! Voy si! Vena traer y ponun puntal. las patas apoyadas sobre puedo ayudar? naririel board 5'01'9 / CoyoteNarrador:Coyote: desesperaba. Muy Tlacuache biers, pero se pusono to de tardes. pie y se fue y no regres6. El call(ThisEL511013 coyoteto traditional mind ythe etReader's taletjactrachefolktale of Borreguita about Theater a coyote and the and Coyote anSe opossum bylipt Verna might puntal?Coyote: j,Cuando volvera ese Tlacuache que fue a buscar al TrevinoAardema. from Adapted a traditional and translated folktale frominto English Mexico. by Copy Rose and color 77 lasalt6Narrador: cara, a un vio lado,Despues que escapandono habiade esperar sucedido luego mucho a todonada. tiempo, correr. seCuando dio valor volvio y The(English Coyote translation and the by opossum Rose Trevino.) jumpedNarrator: off toAfter one waiting side ready for ato very escape long the time, landslide. Coyote When bravely he whenOneNarrator: Coyote day he Once walked was there leaning by. was with an Opossumhis feet placed who livedfirmly in on a cave.a wall hadopened tricked his eyes,him! he saw that nothing had happened. Opossum Opossum:Coyote: What Nothing are you much. doing, Opossum? La(This eau traditionalcCei. conejo rhymeDeo is translatedmkt kettvittez into English by Rose The 15t711719'S PlotiSe Opossum:theCoyote: wall? Why Well, are you you see, leaning I am with holding your up legs this firmly wall becauseplanted onif bunnyTrevino.childrenthe bunny enters The recite who thechildren circlethewalks rhyme stand to around choose together.in a on circle. a thenew In outside Choose bunny.the second of Letone the everyoneverse,child circle. to the Thebe Coyote:underneathit falls it Ohwill it.how cover horrible! this land Can completely I help you? and we will be trapped Salk,yEstahave el conejo esaesta turnla marianacasa noas the estadel bunny.) conejoaqui. This is the bunny's house HeBut went the bunny out this isn't morning home Coyote:againstOpossum: this Okay, Of wall. course but I'll hurry! goyou find can! something Come and to put support your it.feet firmly EscogeElY iAy!noconejo ha jAy! a vuelto la ya lAy!nina esta por lAy!o aqui. niiio aqui. And he hasn't returned. TheNowOh! bunny Oh! choose Oh! has Oh!thereturned. little girl or boy Coyote:CoyoteNarrator: became When Opossum is desperate. Opossum quickly going ran away to return and neverwith something returned. to Que to gusta Inas a ti. That you like best. support this wall? 78 CraftMaterialsnolaS childrenthemContactGuest to bringtheabout 2TezeriteTz zoo, some caring a pet small forshop, pets animals or and/or an animalto thewild library shelter animals. and and talk invite to the ScissorsPencilConstructionPatterns of an paper animal in invarious three differentcolors sizes KunaVelp Molas Site & Molitas of San Bias, Panama Directions termtheMolaGlue Indian hasis traditionally come women to represent in theSpanish-speaking name the used reverse for theappliquecountries; blouse panels wornbut the bythat Audiowww.folkart.com/latitude/swenty-3/ R.ecordirlgo arewww.folkart.com/latitude/swenty-3/.entpanel, coloredmadeoften is hand inspiredto cloth.adorn sewn Examplesbythe with nature, blouse. from of are Traditionally, twomolas frequently to sevenmayThe bedesigns, layers animals,each viewed mola,of which differ-atsea- or "Con"Las hormiguitas"real y medio" on on De Infantiles coloresGalue, bypor Jose-Luis Hugo Vol. Liscano1 by Orozco. Hugo y Javier Uscano. preschoolers,patternsthreeturtleslife, plants, different are are especially andincluded cut colors flowers. out common.allandat the threeAnimals sizes end patterns Thisof of sucha the fishmola chapter.inas and willadvancelizards, three be For made birds, fishon up or of AntarcticDesclibrelo,Videos Antics. Vol. (5 3minutes) & 4. (20 minutes designsthetracedifferent largesttop and of or colors cutthe facialfish. outmid-sized ofUse featurestheir construction left-over own fish to fish. theand scraps paper. creatures. Glueglue of thethe colored mid-sizedsmallest paper fish fish to to addto . Older children may 79 11.14611 'Post 1,[e: jr,opia. La LeafNape and butterfly. Tay (Patterns are included at the end of the DatuTaLeza,2" Iptchoo y Teptileol..i,001.011 Posznie: 5F9 Nattne, Servegchapter.) efTeolmerito trail mix and lemonade. To make trail mix, combine one Labooks Cucaracha Martina: A CaribbeanMartina: Folktale Un cuento /La cucarachacolklorico del Caribe by Daniel to Share Bt190, and Reptiles! boxservenuts, of wheat andit in one small chex, package paperone box ofcupcake ofdried raisins, fruitholders. onein a package large bowl. of mixed Stir it and The LittleLizard Ant and / theLa hormigaSun / La chiquitalargartijaAda.Moreton. by y Michaelel sol by Rose Alma Ramirez. Flor FillgeTFIA-90(Traditional) sulpir una Dontaria CliDIDDig(English translation a noulitaiD by Rose PerezWhere y Martina Fireflies and Dance Perez /Aid and donde LuchaMartina bailan Corpi. by Pura las luciernagas Belpre. by Al subir una montana, WhileTrevino.) climbing a mountain,(Climbing motion up your DesignsproutBullettri a gardenA Reader!board on your bulletin / Jai hoard.de ninon Gather photographs of LaUna cogi pulga de melas narices,pia,. IA grabbed flea bit me.it by the nose,(Pinch arm)arm gently) oftheirreptilesyour readers. summerframe, for Patternsframes glue readers. their for for Cuttheirpicture vegetables out pictures. plants,to it, are and Letfruit, provided place the flowers, children it atin the bugs, choose endgarden or of Y se me escap6. But it got away. got(Open(Hold away) twofingerstogether) fingers to show pinched flea dethis nifios" chapter. on Placeyour bulletinthe caption, board. "Sprout a Reader!" or "Jardfn 80 Rosa,Botin, clavelbotero y y bot6n. salio, BeforeHop away you're fast trapped. E.119D00 La(Tradicional) Oar.ta (Traditional)The Little Toads English(ThisHuitot,Songs is onesong. huitsi of Rose two aTalla differentTreviiio's translations mom prefers of thisthis one.traditional The other EeriO9 VeeriOg 5FtieT CantemosElLa sapitoranita soyeres asi yo,gli,tu, glo,glu,gli, glo,gli.glu,glo. glu. WeYouI am sing area little thelike frog,little this, glo,toad, gli, glo,gli, glu, gli.glo.glu, glu. subioHuitsi,huitsitranslation aaratia".) huitsila telarana, begins aratia "La araria pequeriita" in place of "Huitsi, WentThe eensy up the weensy waterspout spider Y Quela ronda la lluvia se va, se gla, fue, gla, gle, gla. gle.gle, ThatAnd the the rain round will willgo away, end, gla,gle, gla.gle, gle. Y Sali6YVinotodo se lalolael Ilev6. sec6,lluviasol AndOutDown camewasheddried came theup the the sunall rain spiderthe rain out (Tradicional)Dolia aTaga Trevino.).79.(English Spider translation by Rose LaSubio,Y tzarla huitsi, subio, huitsi subi6. &arta TheWentAnd Sea the up eensythe spout weensy again. spider VinoHizoDona unelararia viento hilo se y ysefue la puso ahizo pasear, a bailar, trepar, ThenSheMs. came Spiderspun aa windwentthread forthat and a madewalk,herstarted dance, to climb, LaTrevino.Orozco.)(This mar estabatraditional It is recorded serena, song on is Ltrica translated infantil, into Vol. English 3 by by Jose-Luis Rose The sea was serene, Vino la tormenta, la hizo bajar. Then came a storm that made her go home. (RepeatSerenaLaSerena mar estaba estabaeach estaba verse, laserena, lamar. mar. substituting the vowels a, e, i, o, u) TheSerene sea was was serene, the sea. 81 SaranaLaA mar astabaastaba lasarana, mar. E each other, interlock their fingers, and raise their arms to allow SiriniLiISereneLe mirmer istibi istibi estebeestebe ii sirini, mir. leserene, mer. childcave"Tras,chantthe serpent drop who thetras, rhymetheiris tras,to caught pass arms tras!"and through. trades andwalk the catch two throughplaces The children whoever children with the onecave.who is who betweenof are At the are formingthe children the phrasethem. serpent the Thewho LuUSoronoLo0 mor,mur, ostobo ostoboustubu lo sorono, surunu, mor. PorAis formingla aqui vibora, pueden the vibora cave. pasar; de That la childmar, joinsde la themar, end of the serpent.) CanThe serpent,pass through serpent here, of thesea Ric:WeSurunu ustubu lu mur. YLos los de de adelante atras se corren quedaran. mucho, ThoseThe ones in backin front get run left verybehind.fast,through here; withA:conQ: ,Cu6.1El las patas piojo, patas es en queel enla animal cabezacomela cabeza? quecon de comelaslos theirA:feetQ: Lice, on feetWhat a because head?on animal another's they eats eat with its Una ,Quemexicana, fruta vendia? tras, tras, tras! WhatATTaz, Mexican did tras, she girl sell?tras, tram! demas. head. JardinVerbena,MelonCiruela, deo chabacano,sandia verbenamatatena. InVerbena,Plums Cantaloupesa garden or verbena,apricots, of jacks. or watermelons. GaDerecorded(Thisk La rhymevibora on De was cte Colores translated La 12aT by Jose-Luis into English Orozco. by Rose The Trevino traditional and is The $ea Serpent JardinVerbena,Campanita de verbenamatatena. de oro, LittleInVerbena, a garden bell verbena, of of gold, jacks. lineChoosegame and isbecome twovery children much a sea like serpent to be"London the that "cave". triesBridge". toInstruct get The through themchildren toa cave.face form a 82 ConMame todos pasar mis hijos, WithLet me all pass my children, GraftsMenosTras, el de tras,atras tras, tras! Tras,Except tras, the tras,last! tras! shapecleanerthe same it andto with look wrap the like itother around antennae. coffee the filter.top of Next, the clothespin take one pipeand pipecleaner PetMaterials Rocks GlueSmooth rocks Directions MarkersPornGatherConstruction poms smooth paper rocks without sharp edges and give one to C.,0 laceporn-poms.aeach pet maychild.rock also decorated LetOther be the used. materials children with construction usesuch their as fabric imagination paper, remnants markers, to andcreate and showsnakes,InviteGuest anda andlibrary tell pTeSeriteTOlizards session patron for for whopets the tohas children. bring reptiles them Display such to storytime as a iguanas, collection for a of MaterialsDutteltie0 MarkersCoffee filters presentation.books about reptiles that children can check out after the Directions GiveOld-fashionedPipe cleanerseach child wooden two coffee craft filters. clothespins Ask them to decorate the "El"UnaAuctto piojo mosca" y laRecoTarigs enpulga" Lirica en infantil Lirica infantilconVolumen5 por Jose-Luis Jose-Luis con 4 Jose-Luispor Orozco, Jose-LuisOrozco. Orozco, Volumen Orozco. ingflattenedtake in theone coffee clothespin of the filters coffee so with thatfilters the it appears andmarkers. push to itWhen be through gathered. they the finish, Doopen- 83 Descdbrelo,A VideosBug's Life. Vol. (95 1minutes) & 2. (20 minutes) ni05.11 20011)Le: jEzpia copidal.ntortoD / Posotue: 3F9 Food! LaBigBenito'sBooks cena Enough deBizcochitos Chatoto / Bastante 511ate and / BizcochitosChato's grande Kitchen by deOfelia Benito by DumasGary by AnaSoto. Lachtman. Baca. Magda'sIcyQue Watermelon monton Tortillas de / Sandiatamales/ Las tortillas fila and by TooChairez. deMary ManyMagda Sue Tamales byGalindo. Becky by Chavarria-Gary Soto. AngelspoetryBooktaik Ride BooksBikes and Other to ShamFall Poems and /Los Angeles andan DelFrom ombligo the Bellybutton de la luna y of otros the poemasMoonAlarcon.en bicicleta and by OtherVerano y otros Summer Francisco poemas Poems de X. Ototio / by Francisco X. LaughingLove to OutMama: Loud, a Tribute I Fly: Poemsto MothersJuanAlarcon. in FelipeEnglish edited Herrera. byand Pat Spanish Mora. by 84 The Tamarindo Puppy and OtherPomerantz. Poems by Charlotte The Tree Is Older Than You are: A Bilingual Gathering of R.119De0 ArtistsPoems selected and Stories by Naomi from MexicoShihab Nye.With Paintings by Mexican 130a:cd El(Tradicional) 77* Trevino.)corn(English translation by Rose fewMakeReLtAL patterns a book rnese aresalad includedBookol of carrots at/ the and end fruit of holding this chapter mini-books. for this A 5a13oTea eztoo lIbrol QueVaEl iQuemaiz estrenando parece mafz tiernecito flor tan su defeliz! nariz de lis. raiz, WhatItIsThe looksstretching tender a happylike root a out gloriouscorn of its the itnose is! corn,flower bulletin board, but use your imagination! (Tradicional)GotoTeS (EnglishColors translation by Rose NapeofCarrot the chapter.) and Tags watermelon slice. (Patterns are included at the end ParaColores que toy pintesInas doy, colores, mi el jugonina, SoMyColorsTrevino.) you child, andcan I'll morepaint give colors,the you juice colors, wellpineapplecombineServeRef and Mexican Tesimotoserve chunks, chunks chilled. fruit andof seedless punchsomeReposteria strawberriesand watermelon, reposterfa. are small in a sugar aTobanana, blender. make cookies some the Blend punch, that De la naranja y la piria. Of the orange and thepineapple. wasThereyou canthere! is getprobably at a Mexican a panaderfa panaderfa in your or bakery.area that Look you neveraround! knew 20eD(Tradicional)A tapar [a cab Trevino.)Coyer(English the translation Street by Rose 85 QueA tapar no pasela calle, nadie. LetCover no one the pass. street, ComiendoQue pase mi ciruelas.bunuelos abueloabuela EatingAndExcept my herhismy grandma builuelos, plums,grandpa Q:RiddLe ,Que le dijo la cucharaa la sopa? Q: What did the spoon say theto soup? comiendoQueQueComiendo pase pase misandia. mi pepino.tia primohermana AndEating my hera cousinauntsisterpickle, watermelon, A: Me voy, pero vuelvo. A: I'm leaving, but I'll behack. Comiendo manzana. Eating an apple. 3arictiaGliattMaterials Paper plates VateTne[011 Natal).Songs(Traditional) la sitILCe ' (EnglishSweet ()Tame translation by Rose GlueScissorsGreenRed construction and black markers paper or crayons DameLimonNaranja un partido, dulce, abrazo, ASweetTrevino.) Giveslice honey ofme lemon, a hug,orange, Directions child.redPrecut triangle, Ask red trianglesparticipants markers, for glue tothe glue stickswatermelon and a paperslice. Distributeplate to each one MisSiQue fueran juramentos,yo to falsospido. WereIfThat's my false,promises all I ask. theplate.their seeds Tell red and them triangle the to rind. draw on the on pai TocaSeEn olvidaran.poco la marcha tiempo TimeThey'llIn a goes short be forgotten.by time YoAdiosMi yapecho mesenora, voy.llora; I leaveGoodbyeI'll part with tomorrow; dearsorrow. friend. 86 Guest PTesolteTs tortillasagroup. piecetheInvite steps Askof readyone dough involvedthe of to thepresenter heatto story knead in up making time andto while talk givemothers tortillas. aboutshe one speaks. toall Shemakeeach the Havecan ingredientsof tortillas thegive a packagekids. each for and thechild of "BarnyardAtka()"La gee°manzana"Dance /Tcujigo Baile en Infantiles vegetal"byGalue, Tishenpor Cada HugoHinojosa. Vol. nifio liscano1 por /Every Hugo y Javier Child Liscano. ChickenChatoVideos y suSoup cena With and Rice. Chato's (5(11 minutes)Kitchen. minutes each) Q:(2D 87 atI) CD *CP nizotoD ?ozonie: 5F9 a Bo k. ?To nisto- Pozilie: jEspfa famillas! / ails fob' Families better."foraeach diamondare every childwritten There child aor 3" ona are tostar.X the be5"no Theypiece happy" indexguidelines. canof card or paper, write "I or Afterwant piecemountanything mythe of wishesGrandmathem paper such on andshapedas another to "I hopes get wish like piece Lasgooks abuelas tode LilianaScareMostori / Liliana's Grandmothers ?ozonic: by Leyla Spy raptiteol yarnof Spanish.colorfulcolored through backgroundpaper. the hole.Punch Stapleof a hopeshole these at and the to wishes top the and bulletin called string milagrosboard ribbon for or in a GrandmaFamilyChave's /Memories Familia Fina and by /LosHer Diane Wonderfulrecuerdos GonzalesTorres.Delgado. de Umbrellas Chave Bertrand. by /Maria La abuelita Isabel MyUncle Very Chente's Own Room Picnic / Mi / Elpropio picnicGonzalesSdenz.Fina cuartito de y dosus byBertrand.chente sombrillas. Amada by DianeIrma maravillosas Perez. by Benjamin Alire ThisnilaVosbuliettv. bulletin / niTaelesboard Boars will be made up of hopes and wishes. Give 88 nrigeTVA90 chapter.)HeartNave and umbrella.Tags (Patterns are included at the end of the yourRose(This11.1. fist Trevino.traditional faitia and bring Start fingerplay it with close the to was pinkieyour translated heart.) and on intothe lastEnglish line, byclose ng FaIli9 OrServeRefTeshvems1. make Buy empanadas them!a couple Here's purchasedof ready-made a simple at arecipe Mexican piecrusts. for empanadas.panaderia or bakery. Mi mama,papa, todo toda bondad, carino, My father,mother, filled filled with with love,goodness, 5.4.3.2. FillCutFoldThaw centerout over and small andflatten.will circles.seal fruit to filling. keep(about fruitMy pumpkin3 inches) preferenceinside. with Use wouldnuts a fork and be to cinnamon. VivimosYMiNuestro yo, hermanito en encanto,enla casa,nuestro alto el y hogar.dulceformal, nino, WeAndMyOur live me, brother,charming, together. at home, tall sweet and reliable,baby, 8.7.6. ServeBakeSprinkle atwarm 350° with and for a cinnamon enjoyabout 7 minutes andseal sugar edges. or untilcombination golden Rosent(This faiIlia Trevino. traditional Start fingerplay with your waspinkie. translated On the intolast Englishline, grab by 2' Faitg horchatamadeFor a greatwith in rice,Mexicanthe "Mexican cinnamon, drink, Foods" andserve sugar. horchata,aisle Purchaseat your which grocery a packetis a drinkstore. of EstaEsteyour eschiquitothirmb mi mama. and es pointmi hermanito. to yourself.) This onetiny isone my is mother. my littlebrother. EstaEste esaltito mi eshermana. miIY papa. este chiquitosoy YO!!! y bonito AndThis thisonetall oneislittle my is pretty sister.my father. one isME!!! CIG, 6i2 0.17 po co op ap 6(7 o9 &7 aD 0 ab ab oft 89 R.119Deo Orozco.)until the song is over. It is recorded on De colores by Jose-Luis EL(Tradicional) be00 Trevino.)(EnglishThe lass translation by Rose YDe Depor colores, coloreseso los de degrandes colores colores amoresesse s6n elvisten arcoiris los de pajaritoslos muchos camposque vemos quecolores en vienen lalucir. meprimavera. degustan afuera a AlTodasQue abrir unlas mis angel=lianas, ojos, del busco suefiocielo mea besarvieneal despertar WhenThatEvery an Imorning, openangel my from I eyes,dream Heaven I lookathasdawn come to kiss me. y porCanta eso el los gallo, grandes canta amores el gallomf.mi. de con muchos el kiri, colores kiri, kiri me kiri,gustan kiri. a Y en el mismo sitio del angel,veoadonde a mi estoy mama. And where the angel shouldbe,around I see my Mama. yYLosLa porpor gallina, pollitos, esoeso loslos la los grandesgrandesgallina pollitos con amoresamores con elmi. cara,el dede pio, muchosmuchos cara, pio, cara,pfo, colorescolores pio, cara, p1. meme ca gustangustan aa nantta(Tradicional) Trevino.)nonD9(English translation by Rose COPTS(English translation by Rosemi. Trevino.) YMeMi luego buenadalleva la me sopitaa mamita la besa. mesa TakesAndSheMy goodgives methen to mommy she methe soupkissestable me. TheOh, fields the colorsbecome colorfully dressed in Spring time 50215o TheTheThat's rainbow birdsrooster why that thatI sings,like come we this seethe from colorful roosterglowingkiri, afar world singsare is colorful, so withso colorful, much. the kiri, kiri, kiri, kiri, around(ThisDe eoloTeo traditional each other's song shoulders. is often sungThe groupin groups sways with right arms and slung left 90 The chicks,chicken, the the chicks chicken with with the the pio, cara, pio, cara,pio, pio, cara, pi cara, cara That'sAnd that's why why I like I likethis thiscolorful colorful world world so much. so much. EsteQue es cadael juego quien de atienda Juan suPirulero. juego. EveryoneThis is Juan must Pirulero's pay attention game.to what they play. Farictaaanes m14 Activities Farictazgo Hopscotch in Mexico features the el mund.o sing.Trevino.(This Thetraditional The stick children is rhyme used passto is keeptranslated a stick the beat.around into The English the person circle by holdingRoseas they hopscotchtheskydays illustrationand of thethen game week the below. onworld leading the Drawaslibrary upshown toa the in clornin3oel c ielo Cantare.tango,Althe son stick tango,de when un fandango, the last "tran"tango is sung is "out".) Ifandango,With will thesing. sound tango of a tosidewalk play! and teach the children viernes ili.rc olesjtieves sabgeto ConYCantare con el eltriqui contriqui triquialegria triqui tran. Iran, WithI will thesing triqui with triquihappiness, tran.tran, m (Aries lunes tobyjuall (While playRose pivle'ro them Trevino, singing as if thisthethey childrentraditional are in a chooseband rhyme or instruments orchestra. translated One intoand childpretendEnglish is juaz TtrleTo Graft conductorinstrumenttakesong,the musical someone's the conductor choosesbecomes conductor instrument an conductsthe instrumentor new leader. and conductor. for play Whileaand while it. becomes The theWhen and childrenchild then ready,part who pretends ofsing the losesthe theeach tohis nekiCariDirectionsMaterials Tissue FlowersTissueChenille paper pipe in assortedcleaners colors(two per child) tor.)orchestra again. Each child must pay attention to the conduc- 91 everydaynesses,Mexican plazas, tissueevents. etc.flowers Cut They the are aretissue used used paper to for decorate celebrationsinto 5" homes, X 5" andsquares. busi- together,childrentwo chenille placefold stems them the four tointo each tissuean accordion,child. squaresDistribute The four squares of tissue paper in various colors and GeorgeChrysanthemum.Video Washington's (12 Mother.minutes) (20 minutes) floweratpapercenter.and a timetwist by inThey liftingtobloom,one give then chenille and theand separate fluffingappearance twist stern thethe inup topthe tissueone of layer asheet of Guestoncleanerusecentertissue the the paperofstem. otherto the makePresenters toflower. chenille form the leavesTheythe pipe anothergenerationalgrandparent/grandchildtheInvite storytime grandparents for "Family pictures children. toPictures". of share Have pictures.grandma, stories a rocking Set momma, from up chair another their and available childhood child, area for and for withmulti- "Simplemente"SiempreAudio Rea°abuelita" por TcCID50 amor on Cada / Simply ninoEveryHinojosa. for/Every Love"Child Child byon Tish Cadaby Tish Hinojosa. niiio / 92 , Refreshments ce[eloTactories!moth). 'Poonple:$F9 /Parties iL0pfa.Ms** ancC posse fiestas GeLel)Talt0210! ie: andadulce.canServe child panaderiabrother panServe was dulce, sittingas this orthey withbakery.sweetbread at ate the milk. pan tableSome dulceOne that with grocery of candipped Rose'sher be Mom,stores purchasedin favorite bowls Dad,also ofmemories sell andat milk. a pan sistersMexi- as TheBooks BirthdayLast Doll to Swap /La Share altima / Que muliecasorpresaLopez. byde Dianecumpleaiios Gonzales by Loretta Bertrand. Yummm! SalsaManuela'sMagda'sUno, by dos, LillianPiñata Gift tres by Colon-Vila./Magic One, Kristyn Two / Magda Rehling Three y Chavarria byla Estes. Patpinata Mora. Chairez.mdgica by Becky Trevino.(ThisLosF gerp[ay ctfastraditional Raise de one la rhymefinger senalia atis translateda time for eachinto Englishday of the by week.)Rose The Days of the veek Btu.etln Board Jueves,Lunes, Viernes, manes, Sabado,miercoles, iseis! itres! Thursday,Monday, Friday, Tuesday, Saturday,six!Wednesday, three! FromthisCutFiesta chapterout colorful deand LibTosandenlarge paper, position the/cut Book piñata outthem candy, Gelei)ratioD atpatterns the toys, top provided ofand the books bulletin at theusing endboard. the of AFLaucciTDomingo, siete, gov. ique Las fiesta nano es! Sunday, seven, what a fiestathis is! Letboardpatterns the so children atthat the they end write appear of thetheir chapter.to favorite be raining Place titles down them on thefrom on book the the bulletin patterns.pinata. Con(Traditional) esta mano derecha, WithTrevino.)mai)(English this'Your right translation Hands hand by Rose chapter.)PiñataName and Tagsmaracas. (Patterns provided at the end of the 93 Y esta mano izquierda, And with this left hand,(Wave leftright hand) hand) Ruidoso,Se juntan queditolas palmas y mss paraquedito.aplaudir. Loudly,I put them quietly, together and to clap.even(Clap) more quietly. (ThisLasSongs narlaDitas traditional birthday song is recorded on De Colores by 50n9,5 E.L9T2e0 (Clap loud,even morethen soft,softly) then EstasJose-LuisQue son cantaba Orozco.)las mafianitas el Rey David, TheseSung are by the King songs David Bajen(Tradicional) la Pinata Trevino.)Lower(English the translation E.Wa-ta by Rose Despierta,ComoPero no las eran cantan mi tan bien, bonitasaqui. despierta, WakeAsBut they they up, are weren't my sung sweet, now.as pretty wake up, PoquitoQueBajenlaBajen le la den una piñata, poquito tantitode palos LowerAnotherSoLower that the itthey pinata,littlea bit, can hit. give it LaYaMira lunalos que pajarillos ya ya se amanecio, metio. cantan, AndTheLook birdsthe who's moon are awoken, singing, is no longershining. (Tradicional)No cititeTo oro Trevino.)(EnglishI Don't translationVant Gold by Rose PLliataDale,(Tradicional) dale, dale, "PtiiataStrike(Traditional) it, strike it, strike it, EsYoNoNi quebrarquerolo quiero que oro, quiero la plata. piñata. IsWhatI don't to break I wantreally the silver.gold, want pinata. MideNoQue pierdas la hay distancia enel tino.el camino. FromMeasureDon't losehere the yourto distancethere. grip. 94 at7 40 a6 CIC) CID dc, (12, at:, al=> 40 CIL) ac, CIED 0E7 OC) 0E7 cllat. ao at> (119 ap (7j, tries to break through the clasped hands to catch Dona Blanca. Torigtre(Traditional)Cuarkto cuentes Triter arrerito0 Trevino.)(EnglishVheri you translation Tatty byTales Rose isJicotilloWhenDona now Blanca. sheJicotillothe before hasnew Donabeen Donasucceedsshe becomescaught,Blanca Blanca in Donacannotentering part ofBlanca run thethe outside circle. circle, chooses The ofshe thea oldchasesnew circle. Jicotillo NuncaPorqueCuentaCuando sabescuandocuentos cuentes cuentos cuentas cuentoscuentos cuentos cuentoscuentas.cuentas, NoBecauseTallyWhen telling total you when totaltallytales you talestold, tally told. tales ParaRomperemosconDona pilares ver Blanca a Dona de esta unoro Blanca.pilar cubiertay plata. BreakIfByDona Dona pillars a columnBlanca Blanca of silver allnow you surrounded and will gold. hold. saying.(By Mary Rose Zertuche, remembers Rose herTreviiio's mother mom, reciting from this another often.)atcen similar quo Soneorie 5aic YoqueQuien soy anda es ese, eseen yo posJicotillo soy de ese DonaBlanca? IWho am (s)he,chasesis this I hornet Donaam (s)he Blanca? PorEsteAMe aque haberlodicen dicho dicho que estadicho he he muydicho dichoyo. Bien yo, unane dicho dicho SeeingSuchSaidSomeone aa sayingsayinghow said I said sosoI, saidwell it so. aI said saying Graftque*Jicotillo anda en pos de DonaBlanca! (hee coh TEE oh) Who's trying to catch her! howThisDori-'anumber tois play.a Nanatraditional of Chooseplayers. circle a The Dona wordsgame Blanca andcan and therebe sunga Jicotillo* is noor limitchanted. (hornet). to the Here is MaterialsPap4 TissueScissorsString paper in assorted colors taco / 1)9)n Cut outs BlancatheDona outside. Blanca as they The stands sing children or inside chant. join the After hands circle the andand second circleJicotillo verse, around remains Jicotillo Dona on 95 Glue andPapeDirections celebrations picado is used from as the a decoration Day of the for Dead all totypes Christmas of festivities to "Cumpleano"Audio Recovaligo on Infantiles por HugoVol. 1 Idscano by Hugo y Liscano.Javier Galue, inchild.paperhelpbirthday half as inThe again, you assortedparties. children make and The colors. again,this fold illustrations craft. eachandDistribute Cutagain. sheet out at ofLeavingone the6" tissue Xorend 6"more one ofpapersquares the sheetsinch inchapter half,ofat to thetissue each then willtop "La"Las piñata" marianitas" on De on colores De colores by Jose-Luis by Jose-Luis Orozco. Orozco. edgestissuecuttinghearts,edge uncut, andpaper andall thenthe squares theyonce way unfold thenand throughfrom cutit againboth outsmall to moresidesthe and shapes other againshapesof the side.such and folded along They ascut triangles, edgestheout unfold foldedmore without thestars, VideosWinterChicka HolidayChicka Boom Stories. Boom. (27 minutes) (6 minutes) andtwelvesheetNext,shapes hang andthey inchesuntil thefold place the fiesta init sheet overalength. small banner! aof piece Tieamounttissue the of paper string sheetsof glue is or of completely onribbon papa the picadotop approximately edgeunfolded. together of the sheet 1 fold1/2in fold1/2in fold1/2in C1 CI cJ 96 e) FiestasXoTct / parties Search Hispanicswww.brooklynexpedition.org/latin/gateway2.htmlBrooklyn in Expedition: American History Latin America 3t es SHCRTK BAC FCC OK A AKU HXP Latincoloquio.com/galvez.html American Network Information Center EYCYAUSACHGNWSSCLMEJNRMYTTAQLASLIHA I A ATM K DYV Littlewww.lanic.utexas.edunahegionik-12/ Explorers RDOHHNNILFSEHRHAJOPJEPSHASKTMILYBDRG QI AP XZ DT Multiwww.EnchantedLearning.com/Dictionary.html Cultural Calendar PSESJSRFSGAPTNOETZASERS A S A T A N I P Y LC PROSN OS WVSI W I Vel)www.kidlink.org Sites in /KIDPROJSpanish /MCC/for Children TBMORNVREGACKGCYFVRRBIFNQHP BMW ICHDY S A O H Q S Y G S MMVL VOS B EH Diegowww.kn.pacbell.com/wired/amigos/spanish.htmBienvenidos Rivera Amigos! Museo Virtual CASCARONESCANCIONESBIRTHDAYVUNUSFOODCY PRESENTSPINATAPARTY VMBS Libroswww.diegorivera.com/ para ninos en Espanol FOODFIESTACUMPLEANOSCOMIDA SURPRISESONGSSALSAREGALOS Mundowww.mundolatino.org/rinconcito/WWW. Latino nyplo rg/b ra nch/kids/espanol/sprdli.html SORPRESA TAMALES 97 www.solarviews.com/span/homepage.htmVistas del sistema solar www.zoomadrid.comZoo aquarium de la casa /index.php3 de campo de Madrid DiezDe colores deditos and / Ten Other Little Latin-American FingersActionby and Jose-Luis Other Folk Songs SongsPlay Orozco. from Rhymes for Latin Children America and by Jose-Luis Orozco. Although"Pro.fe001021al.they are I books did not that use will manyReocitnceo be ofvery these helpful for this in gathering bilingual additionalchapter, PlaysProgrammingTeatro! From Hispanic Hispanic with PlaysLatino Tales: for Children's One-Act, YoungWadham. People MaterialsRoyalty-Free by Angel by Tim Vigil. LasArrozideas. Navidades: con leche: Popular Popular Christmas Songs andby Songs Rhymes Lulu from Delacre. from Latin Latin America America FolktalesDramatizations by Barbara for Young Winther. People, from Hispanic Stories and HispanicTheThirty-three Emerald Games Lizard: Multicultural and Rhymes:Fifteen TalesLatin RimasPleasantby AmericantoLulu Telly juegos Delacre.DeSpain. by TalesPleasant en Espanol to TellDeSpain. by LibraryTortillitas Services para to mama: Youth and of HispanicOtherGriego.Cynthia Nursery Heritage Downs Rhymes byand Barbara Gloria by Margot Erickson Los pollitos dicen: juegos, rimasdeImmroth. yGames, cancioneshabla Hispana Nursery infantiles / RhymesThe de Baby paises and Chicks Songs Sing: from TraditionalSpanish Speaking MomentosTuck-Me-In mdgicos Tales: /Magic Bedtime Moments StoriesMargaretCountries Fromby Olga Around Readby Loya. Nancy MacDonald. the AbrahamWorld by Hall. Hands-On Latin America: Art ActivitiesY. Merrill. for All Ages by Yvonne 98 Spanish Book and ktrao RecoTcCiriy Email:888-525-2665 [email protected] Ve21,i0TO Anes Records, C.A., Caracas,email: Venezuela. [email protected] Downtown Book Center Raquel247 SE RoqueFirst Street, Miami, FL 33131 fax:www.liscanogalue.comtelephone: 014/204.59.24 014/921.55.03 Fondo de Cultural Econamica USAEmail:faxph. (305) [email protected] 371-5926377-9941 Arte Publico Press www.arte.uh.edu800-633-2783University of Houston Tel:Tollwww.fceusa.com/2293 Free:619/429-0455 Verus 1-800-5-FCEUSAY, Street, - Fax:San Diego,619/429-0827 (532-3872) CA 92154 Bilingual Publications 270NewEmail: Lafayette York, [email protected] NYStreet 10012 Suite 705 Hispanic Book DistributorsTucson,240 E. AZYvon 85704 Books on Wings Email:212-431-3500 [email protected] iLeon.com 12686WestEmail: Division: [email protected] Drive, Unit B Email:415-285-1399973www.booksonwings.comSan Valencia Francisco,[email protected] Street CA 94110 E-mail:www.iLeon.com1-800-300-3975San Diego, [email protected] CA 92128 Chulainn Publishing Lone8421 SweetwaterTree, CO 80124 Road 99 Latin American Book Source,289 Inc.Chula 3rd Ave. Vista, CA 91910 Ph. 619-426-1226 Email:www.latambooks.comFax 619-426-0212 [email protected] Spanish'help Sites nateTta.1.0 VIA IllfoTnattoDLeer OD Lectorum (now affiliated with Scholastic)Email:www.lectorum.com1-800-345-5946 [email protected] Submarino.com www.leer.nisc.com(Similar to OCLC) Libros Sin Fronteras 360-357-4332Olympia,P.O. Box 2085WA 98507 BarohonaChildren Center and Adolescents for the Study of(Similarwww.submarino.com.br/ Books to in Amazon.com) Spanish for SBD Spanish Book Distributor,Email:www.librossinfronteras.com8200 Inc. [email protected] Blvd., Suite 1316 SpanishUS.com www.spanishus.com/supplierswww.csusm.edu/csb/english/ of spanish materials.htm Email:www.sbdbooks.comFaxPh.Dallas, 800-609-2113214-369-3252 [email protected] 75206-3252 (Spanish line 214-369-1655) Spanish Audios (books on tapePlantation, FaxPh.1700publisher) 954-321-5560954-321-5422 NW FL 65' 33313 Ave., Suite 8 Email:www.spanishaudios.com [email protected] 100 (t) GCD 4CD 67 0 5139 AlltDa4-0 NaDetags

ratoncito

osito

101

1 09 Jaguar 11.a0k

102 110 Na.Detago ali(i BooklAroTT2 bookDaTk

- 103 111 3jF°°Ct NaMetagZ

AFFLe and VoTD Glatt

104 112 na.nnel. DoaTi Rhyne

105

11 3 3FAVIT2a40 Nametags

106

114 El. coyote g e. ti.a.ctra.cha

107

115 3F9 Nature Naz leta_go

108 116 11,00

109 117 Sinotrt a Rea-0T

al

110 118 I ctS 6 pool

TTT

f T 6 5139 F°C)CC $uuetin Board

S

112 120 I Sp Fat tiles NaDetago

113 Dri[ce0

0 114 122 I 5F9 "Parties Butte*. Board

115 123 I $jPartteo Bttettli Board

116 124 I 3p9 ?artier buLLetill BoaTcC

117 125 40 I 3F9 ?artier Name-tags

118 1 2 6 T $p9 'Parties NaDetago

119 127 qbt OD CI) CD `-'4" CID CY) 017 CD Op Qo ciD 02 OP CID,I,C7br)(31) (iv .,. ,1/41 CD CV i400CE olArTg90-Ja6ct a3i-racto,1 .eictigood ttologilz .71.tootov. Pozo/131.e: 3F9 frocuieT ?Thva.,20 139 Lelia Parrish a. Bo booko -0 Share Baby Einstein's See and Spy Shapes by Julie Aigner-Clark. I 3p9 FiDge TpLago "Here"Grandma's Are My Spectacles" Eyes" from from Ring Ring A Ring A RingO'Roses. O'Roses. IBrown Spy LittleOn Bear, The Book Brown Farm by byBearJean Richard Marzollo.What DoPowell. You See? by Eric Carle. Song (Traditional)I See the noon 130010 to show. azct booktaLkSevenLookHide andBook Blind Snake by Mice Tana by by Keith Hoban. Ed Young. Baker. I'dTheAndI see like moon thethe to moonmoon see. sees sees somebody me. 13tilLetiD board 5F9 a Book! I'dAndGod like Godbless to see.bless the moon theme, somebody circlesPlaceCover book from the jackets constructionbulletin of boardclassic paper with picture to construction frame books the on book papera bulletin jackets. and board. cut 120 Directions Optional: Markers or crayons ?tippet 5019 papercreate(TellHibenatirig this grocerya paper story bag.bag Beal.with stage,Place a bear cutit puppeton a yourhole and inlap the aand paper side use ofbag the a plainstage.hole asbrown To the ChildrentwoLet antoilet adult canpaper help decorate rolls the placedtoddlers them sidewith wrap by markers sidemasking to or create crayons. tape binoculars. around ter.greatfront ofstick the puppet stage. isA includedbear or "osito" in the Bilingualnametag) thatprograms would chap- make a AcCu[t/CLact GTaft kettritgMaterialsI Spy Bottle ToHeWatchInsideHere get stays some is is anda aoutcave, bear.fresh you'll all (Point air.summer see himto paperin come the bag sunshine outside, stage) (Bringand heat, bear up) Electrician'sTrinketsRiceEmpty pint plastic tape or milk hot bottlesglue with lids SafeButLooking when and forwarm snow berries instarts his and caveto fallgood he he willthings hurries hide. to inside eat. (Bear goes in cave) Directions Childrenbottle.parent/childThis activity Use can a craft. funnelcanchoose be Place to preparedthe add abouttrinkets rice aheadfive to and almost or of themore time pourfill trinkets orthe rice created bottle. with in each as a panel. board 3t0T9 "Here is a Nest" in The Flannel Board Storytelling Book, 2' d exposegluesupervision. or thetape various itIf securely. toddlers trinkets. areThe present, children seal shake the thelid bottleof bottle to with GTatt IEdition 5F9 Binoculars by Judy Sierra. ActuLt/GhtitC Came I 5p9 14-6 n9 Halids Materials MaskingEmpty toilet Tape paper rolls 121 guessbrownGather what grocery items it is. bag.familiar Prompt Let eachtowith toddlers. childquestions reach Place such in one hag, as: item Isfeel it at it,soft, a andtime in a Shouldsmooth, we or takerough? a look? Is it hard or soft? What do you think it is? I 31)9: 12.3 Vel) 3tte www.scholastic.com/IspyKids Fun Online I Spy Books to 311ate One,I1, Spy Three2, 3 Two,Little by Little Tana Three Numbers Kittens Hoban. to the by by Zoo Jean Tanya by Marzollo. Eric Linch. Carle. CD Ran I Spy Junior: Puppet Playhouse. Books to Show' and Boo talkCount! by Denise Fleming. PTafezotoDai. R.esotrive The Flannel Board StorytellingSierra. Book, 2nd Edition by Judy FiveTouchTen, Little Nine, and Monkeys EightFeel: 1,2,by Jumping Molly 3 by DorlingBang. OnChristlelow. The Kindersley. Bed by Eileen Bull.ett/1 Board BooksCut out ?o large Gan numbers Co urit and Ori write titles, authors, and call Nane-ta_g0 Candomlynumbers Count on of the On." picture bulletin books board on around them. thePlace caption, the numbers "Books ran- You 122 chapter.)enterGive eachthe storytime child a number area. (Pattern from 1 toincluded 5 for a atnametag end of whenpreschool they Ft115eTFLagS (Adapted by Leila Raven Parrish.51D9 Three Use a different finger puppet Hickory(From"One, Two, Ring DickoT9 How 0 Ring Do Dock O'Roses You Do" by Flint Public Library.) Iawith spybook eachthree you verse. are introducing.) Tailor the verses to fit the puppets you have or one, two, three Hickory,using(Traditional. the dickory,pattern Make atdock, the a clockend of and this(Place mouse chapter.) hands to go together with this and rhyme move them back and forth) ThreeReading little the bunnies funnies. (Wiggle(Hold 3up fingers) 3 fingers, one at a time) The clockmouse struck ran up one the clock (Clap(Raise hands hands above above head head) once) Sitting...ThreeOne, ontwo, logs.little three. frogs (Place (Bendother arm down in 3front finger, to createone at aa log)time) Hickory,The...The mouse clockdickory, ran struckdown. dock. two (Bring hands back down together) Buzzing...Three littlein trees. bees (Spread fingers of other hand to create a tree) TheThe ...Themouse mouse clock said, said, "Wheee!"struck "Boo!" three (Cups hands around mouth) FiVe"One, Two, Littte Buckle nonkogs My Shoe" from Ring A Ring O'Roses. The...TheHickory, mouse clock dickory,said, struck "No dock. More!"four (Flutter hands down) Sing "Five Little Monkeys" using monkey finger puppets. Hickory, dickory, dock. 123 "Three"Ten LittleLittle Kittens"Indians" removing(Sing this them traditional as the songou counting OYOT indicates.) song using felt figures and Directions forthWith withadult both guidance, hands childrento create roll 3 snakes. pieces Childrenof clay back bend and and AndThere"Roll the were over! little five Rollone in said, over!"the bed. dryshape them the on clay wax snakes paper to or form a styrofoam the numbers tray. 1, 2, and 3 and ThereAnd they were all twothree fourrolled in in in the overthe the bed... bed... bed...and one fell out. Acttittjez NtraeTRefer to Gal the numberse the children were given for nametags. Ask And...There the little was one one said, in the "Good bed, night!" 9.(Adapted12,3them to count stand from up WithMath when Play ne you by say Diane their McGowan.) number. Count from 1 to "Five"One, LittleTwo, Boats"Buckle inMy The Shoe" Flannel inEditionStorytelling The Board Flannel by Storytelling Judy Book, Board Sierra. 2nd Book,Edition by Judy Sierra. Board Storte0 2nd youchildren"clapCount say. with to tothree me", count and "hug with say with youan actionme", each "yawn timephrase and with like then me". "jump do Ask the with theaction me", AcCuLt and chtioi Graf t Audio Recovamo Counting Games and Rhythms for the Little Ones by Ella Jenkins. Materials ClayTable2, 3 Gla9 "This Old Man" on A Child's CelebrationArtists. of Song by Various Wax paper or styrofoam trays 124 Video The Three Little Pigs. (12 minutes) Vel) Site www.childcraft.comChildrcrafi Education Corporation books to Share Blue's Clue My Favorite Letters by Deborah Reber. I Sp9: G prof-040/AL Re0ouTceo MathThe Play Flannel by Diane Board McGowan. StorytellingSierra. Book, 2' Edition by Judy MissI SpyChicka Spider'sLittle Chicka Letters ABC ABC by JeanDavid by Bill Marzollo. Kirk. Martin. books to 511014/* and BooktatkAmazingIDr Spy:Touch Seuss's AnI Spy and AlphabetABC: ABCFeel An ABCby In Amazing Ken Art by Laid byDor LucyBook law.ling Micklethwait.Kindersley.by Dr Seuss. Bulletin Boani StomtiDeltsDo you low Do! your ABGs? our t'oddle'r Storytime.captionstorytime.Let the children"Come Display Join decorate them Us". onlettersInclude the bulletinof the the day alphabet board and timebelow at Toddler of the Toddler 125 DecoTations Suspend the letters of the alphabet from the ceiling. io NaDeta.90 (Herehere isto a ABG?variation to the "Where is ABC" song using puppets Firl9e Tpia9 Let children choose the first letter of their name for a nametag. lettersincorrectcorrectand/or each propsitem one time.) for tothe matcheach second letter the time. lettersthe firstLimit of time the this alphabet.you activity sing. to BringBring 3 or outout4 thean "A"(Traditional)A Is is Forfor alligator, AtligatoT chop, chop, chop! HowHereWhere Iare am!is "A"?you Here today, Where I am! "alligator"? is "A"? (Bring out an "A" item such as an alligator puppet or apple) And"C""B" is"D" for is bouncing,circles, for when around hop,we all hopand sit hop!around. down.(With elbows together clap hands) (Hop 3 times) (Sit) (Turn in circles) HereWhereIVery must Iwell am!isgo. "A"? and IHere must Wherethank I go.am! you. is "A"? Sony Xbe Te to ADG? HereWhereYou're I am!isNOT "A"? Here "A"! Where I You'ream! is (Bring "A"? NOT out "A"!(Bring correct out "A" an item)item that does NOT begin with "A") WhereJacques".)(Adapted is "A"?by Leila Where Raven is "A"? Parrish. Sing to the tune of "Frere Puppet Story IVeryHowHere must arewellI go,am. you andI Heremust today, thank Igo. am. "A"? you. (Bring (Look(Move out at "A"(Hands "A")large up and"A") behind down) back shrug shoulders) FolkmanisReadABc the 211net0 interactive Puppets. soft book, My First ABC Puppets from 126 Materials 13, G Fun Audio R.ecoTallgo "`A'"ABC's" You're on AdorableEarly Childhood (The Alphabet SongsCampfire Song)"by Ella by onSharonJenkins. Sing LoisAround & Bram. the Directions Optional:Markers,AlphabetPoster board paint, stencilsConstruction or stickers paper "Funky Bluesy ABC's" on BigVarious Blues: BluesArtists. Music for Kids by theOptional:stickers.board.Precut letters Childrenlarge Use Childrenor stencils gluethem decorate them tosing of decorate theto the them a letters piece"Where yourwith ofA, bulletin markers, IsconstructionB, ABC" and Cboard. paint, songfrom paper. usingorposter 'elp Site www.folkmanis.comFolkmanis Puppets Activitg thePhotocopyridden end of ABC thisand chapterdistribute katiVit9 and the let sheet "Hidden the children ABCs color Activity the letters. Sheet" at andShowalphabet/flashPrint the Jan the matching Brett's cards card toFlash animal. the alphabet childrenCard Ask Alphabet traditionaltheone children byJan at one www.janbrett.com/ Brett main andto repeat name page.htm.Flash them.the Cardletter Alphabet 127 FirigeTpIA9 Books to Share I Went Walking by Sue Williams. 3p9: backyard Asivelittnres Fun(Adapted 111 OUT by Leila Backyard Raven Parrish.) MushroomIn TheMy WorldLittle In Lawnmower by the Lois Rain Ehlers. by by Mirra Joy Bean. Ginsburg. Stretching,Swinging,ThenClimb on the our ladder,swinging, stretching tricycle and weway todown ride.the up sky. wehigh,with slide; (Reach hands)(Swing arms arms up back high) and forth) (Make a pedaling motion) (Make a sliding motion Books to Show. aricC BooktalkFlowerBailey GoesGarden Camping by Eve byBunting. Kevin Henkes. HavingAround funand in around our backyard. we go, (Stand and turn in a circle) SunflowerOverJack's In Garden the House Meadow: by Henry by Eve An Cole. Bunting.Old NurseryGaldone. Counting Rhyme by Paul R.119x2e (Traditional) nary, Quite CoritTaT9 131111.ettri BoaT4 AndWithHowMary, prettydoessilver Mary, your maidsbells quite garden and all contrary, cocklein grow? a row. shells, Stappcaption,grass.CoverBackyard Hidethe "Backyard bulletin bookAdventures jackets board Adventures". behindwith blue the paper blades and of decorategrass and with add tallthe aswithAs a the tree, the children shapeflower, of enter bug, something thebunny, storytime they bird. might area, see stamp in a theirbackyard, hands such 128 (AdaptedI've Bea. by Raying Leila Raven DI the Parrish. 13.340.1'4 Sing to the tune of "I've Cut en rreU Story Tellby "The Jean AppleWarren. Tree" from Cut & Tell Scissor Stories For Fall AllI'veBeen thebeen Working live playing long On day. in the the Railroad".) backyard "TheTwo First by PaulUmbrella" S. Anderson. in Storytelling with the Flannel Board Book Boa.r4 &tom Can'tRiseJustI've been toup you pass so playing hear early the thetime in in swingschildrenthe the away. day; backyard, a shouting,swinging, Craft Won'tWon't"Now you isyou cometime come to and play!"and play, play? with Won't me-e-e? you come and play? MaterialsDaffodils GreenYellowConstruction ribbon paper cupcakepaper liners WithSomeone'sWon't my you good comein the friend and backyard play,Joe. with Iplaying, know. me? Directions anliner,ChildrenGlue 8-inch attach placepiece it to aof adot piecegreen of glue ofribbon construction on thefor theback stem paper, center and and of two aglue cupcake 3-inch on PlayingFeAnd fi singingfiddlee-i-o, with my fegood fi fiddlee-i-o, friend Joe. /lettVI.0 Sheet pieces for leaves. 129 theGive133401'4 end each of childthis Adventure chapter. a copy of the haze "Backyard Adventure Maze" at Audio Recording Mueo Videos "Over In the Meadow" on Baby Beluga by Raffi. Books to Share Have You Seen My Duckling? by Nancy Tafuri. PTofezziorial. Resource AOverIn Rainbowthe In Tall, the TallOfMeadow. My Grass. Own. (9 (6 minutes)(5 minutes) minutes) Books -0 show. aria BooktaikTheWhoWelcome Shape Took Detectives To the Blue's Farmer's Cluesby Angela Hat? by Angela by Santomero. Joan Santomero. Nodset. Storytelling"Cut & Tell" with Scissor the Flannel Stories Board ForAnderson. Fall Book by Two Jean by Warren. Paul S. Display EachWhoseWeather Peach Shoe?Hat? Games Pear by by Plum Margaret WithMargaret byBlue! JanetMiller. Miller. by Ahlberg.Deborah Reber. andbooksDisplayGail read YOU about hats Fire Guess thoseor Engines tools professions.\01090 for by various Anne React] For Rockwell.community rigexample: These? helpers Show a along fire hat with Rhyne 130 ?tippet glove(ThisQueen ispuppet aof "Mother Hearts by cutting Goose" three rhyme. small Create red hearts a Queen and of attaching Hearts forking.)pinkthem the knave,crownto the forfingerand the on tips queen;the ofthird a on black heart, the secondglove. a blue Onheart, crown the a first brownfor theheart, top put hat a AcCui.t/cLact GTatt MaterialsLittle Citie0 Notebook TheAllShe on KnaveQueen madea summer of some Hearts, day; tarts Optional:YarnHoleTypingCardstock orpunch paperstring Markers cut in and half stickers AndCalledTheHe Kingtookbeat stole for thethemof thethose Hearts Knave tarts, clean tarts, fullaway. sore; Directions andontoPhotocopy a cardstock. notebook the notebook onGive cardstock each pattern child along aat blank thewith end 5sheet or of 6 thisof sheets card chapter ofstock AndBroughtThe Knavevowed back ofhe'd theHearts steal tarts, no more. withcreatepattern.andtyping stickers punch theirpaper. Children twoor Little markers.Adults holes threadClues onalign theNotebooksstring the "X" cardstockor at yarn the and throughtop then and of thedecoratetyping holes notebook paperto them Gut `D. TeU. Story Stangl.Tell "The Little Orange House" from Paper Stories by Jean kettitt9 Sheet panel. boaTcC Story Board"Davy Book Crockett One by and Paul the S. Bear" Anderson. in Storytelling with the Flannel personX110theGame"Distribute children Leftor at theEacha photocopyas end they Clue? of drawthis of chapter athe line "Who between to eachLeft Eachchild.the footprints Clue? Adults Matching guide and the animal that made them. 131 theHideShape children circles, DeteCtiVeS hunt triangles, for them, and onesquares shape in atthe a timestorytime and area. Let say, "Let's findonetime circles of to each look now", shape. for ortriangles." "Now let's Hide look plenty for squares", so every or child "It's can now find pTofezotona.i. geZotilice StorytellingPaper Stories with by Jean the Stangl.Flannel BoardAnderson. Book One by Paul S. Activitg mimingPlayMane a guessing Tatactions commity gameof various with He[FeTcommunitythe children helpers.by bringing Dress-up props hats and anddrivesay,librarycan besay,"I a amfoundpatrons.truck. "I wearing bring atHere's Fora letters teacher's a example, specialanother to your supply hat. clue."put mailbox. I on sometimesstore, Hold a postal orWhoup borrow a worker'scarry groupam I?" athem ofbag hat letters orfrom and Audio Regorctiligo Blue's"We Are Clues. Going To Play Blue's Clues" on Goodnight Blue by Wei 3ttes Childcrafi Education Corp www.nickjr.comNickwww.childcraft.com Jr. www.pbskids.orgPBS Kids 132 books to Share Hide and Seek by Susanna Gretz. "Peek-1 -13" Peekaboo(Traditional) Peek-a-Who?Peek-a-Boo! by by Janet Nina Ormerod.Ahlberg. Laden. Boo!HidingIPeek-a-boo, see you, behind your hands. Books to Sho HidePeek-a-boo and Seek Bugs by JezBrenda by Alborough. David Shannon Carter. Yee. and booktaLk "Teeny Tiny Ghost" by Lillian Moore in Ghost Poems edited by I%) Bulletin board Where Did Bunny Go? by Nancy Tafuri. Song PopDaisy Goes Wallace. the Veaset tinbookboard.Cutpeek board. shapes characters aAttach boo If of possible, thecircles,Shapes underneath shapes laminatetriangles, to theand to bulletinand create reinforce squares aboard "Peek-a-Boo" it. out with of posterfavorite bulle- Pop!TheAll around monkey Goes the thoughtchased weasel.cobbler's the`twas benchweasel. all in fun. FiDgeTpla9 "Beehive" from Ring A Ring O'Roses by Flint Public Library. Pop!That'sA penny Goes the for way the a spoolneedle,weasel.the money of thread, goes. 133 Fir lyn ?uppeto puppetsUse Folkmanis to introduce Peek-a-boo stories/books. bunny/monkey puppets or other "Two Little Bluebirds" in The Flannel2nd Board Storytelling Book,Edition by Judy Sierra. FiligeT ?tippet StoTte0 11°09madeCut out rril'9from a door blackCahoot and poster second board. floor Make window a finger in a puppethaunted of house a ghost PeekaBooMaterials Egg ChickConstruction and egg paper patterns withfrom thewhite Lillian felt andMoore draw poem, a face "Teeny on it. TinyTell aGhost". Peek-a-BOO! story Directions patternsPre-cuttheGlue inside stickeggs at the ofand endan chicks egg of thisto from create chapter. construction a peek-a-boo Children paper glueegg. using aIf chick a childthe to 'Puppet Stories 'PeekABooCreate a simple Pla9 peek-a-boo story/activity using the interactive loe theattaches peek-a-boo chick toegg. the outside of egg, just refold it to create theyourdoPuppets.Bunny bunnies bunny own or For MonkeyPeek-a-boo puppeteat?" example, "Let's andPeek-a-boo Cube carrots."Wherefind hisfrom Playiscarrot! abunny?" box Cube Is by it from "Iscuttinghere?" he Folkmanis here?" Or,flaps create to"What hide Actutt/Chtic (Adapted'PeekaBoo from 'Page Games to Play With Toddlers by Jackie Silberg) Graf t Flannel Boa Tct 3toTtez "Sleepy Mr. Sun" in Storytelling with the Flannel Board Book Materials Glue3-Hole8"Old x magazines12" punch Construction or catalogs paper "Pop Goes the Weasel" in The FlannelBook,Two 2nd by Board PaulEdition StorytellingS. Anderson. by Judy Sierra. 134 SmallScissors binder rings Directions In magazines.advance, cut Children out large glue pictures one or of two familiar pictures objects to each from side of TTeaZtite Hurt holesconstructionthe andconstruction tie paperpaper.it to attach paper.with Children picturesthe An pages adultthread and together. then thea blank 3-holeyarn An piece through punchesadult of cuts the the 130010 to Share Mop'sRainbowBlue's TreasureBig Fish: Treasure Hidden Hunt Hunt by Treasures Martine by Angela Schaap.by Gail Santomero. Donovan. timecompletedpagesThisthe page tois may thereveal without peek-a-boobeginningbe addedmore any of as picturesof thepage time a peek-a-boopicture. bookpermits. into by three turningChildren book. horizontal Additionalone look strip strips. at atthe a kooks to Sonny'sTreasure Treasure of Pirate Hunt Island: by Lisa Great Stubbs. Adventures by Matt Mutter. 311olit and Booktal.k 'Wel) 51te www.folkmanis.comFolkmanis Puppets Buliettri Board Dora'sTreasure Treasure Hunt Hunt byby BillSusanAllan by Cosby.Alison Simon.Ahlberg. Inches. PT*0010/lai R.eootITCeo RingGhostGames A Poems ToRing Play O'Rosesby With Daisy Toddlers by Wallace. Flint Publicby Jackie Library. Silberg. titles,TreasureCut andout goldcall Chest numbersand/or yellow of pirate circles and for treasure coins andhunt write picture authors, Golden Reads TheStorytelling Flannel withBoard the Storytelling Flannel Board Book,Sierra.Anderson. Book 2nd Two Edition by Paulby Judy S. Goldenbulletinbooks on Reads".board them. along Place with the coinsthe caption, in a Treasure "Treasure Chest Chest on theof OP MD 01) .0 ao op 40 ap 00 ao QD .49 ab mo Ot7 ap 00 m, 01, .0 .0 00 0,, 00 019 135 a0 QD 01P aU ,,,,, 00 q, ay a= .0 MD ,0 00 apt .7 AO q, at, 00 07 00 00 07 q, .., a> at, ay RD Shhhh!The pirates Shhhh! are creeping. Display books.5F9Decorate a TTGaStrTePlace an the old caption trunk ason a the treasure side or chest lid of and the fill trunk. it with board Shhhhh!TheAsThey their pirates do feetnot are maketouch creeping. athe sound, ground. Nanetago shapeAs children of treasure enter thechests. storytime (Pattern area, provided give them at end nametags of chapter.) in the Flannel boaTct &OM Read"Jack MacDonald.and the Robbers" in Twenty Tellable Tales by Margaret Decorations Hang a piñata shaped like a treasure chest. Adult and mad cTaft MaterialsTreasure Chests Baby wipe containers with lids Directions aStickers treasureChild attaches chest. stickers to the baby wipe containers to create F Dig OT (AdaptedThe 'Pirates by Leila Are Raven Creeping Parrish) F Lag aDez and ketivittezServeTreasure a treasure Chest chest Cake cake using recipe found at Shhhh!The pirates Shhhh! are creeping. (Index finger to lips) (Tiptoe two fingers up arm) 136 www.BirthdayExpress.com. TreasureDecorate Chesta small Carat,box as aBox treasure chest and fill it with trinkets, 'Who? findstickers, a treasure and/or on theirbookmarks. way out Invite of storytime. the children reach in and Books to Share Where Am I? Learning Riddles by Peter Zeibel. VbeTe? ktrcito R.ecoTccimo "Whose"Blue's Big Treasure Treasure" is This?" on Blue's on BigBlue'sArtists. Treasure Big Treasure by Various by VariousArtists. WhoWhere SankHiding?: Is Baby's the Boat?With Mommy? Bigby Pamela Flaps by WeidnerKaren for Allen. Little Katz. Zoehfeld. Hands by Kathleen Birthday Express Party Source Site Books to Shov arc Booktai.kCaillou TellWhere Me Is Where It? by byFabien Fabien Savary. Savary. www.Bh-thdayExpress.com WhoWherePoky AmSaidLittle Is I?My Moo? PuppyA Baby? Book by by toHarrietby Janette Touch Harriet Zeifert. Sebringand Ziefert. Feel Lowrey. by Alice Wilder. Professtorial.CDRon Resources Blue's Treasure Hunt. NaDetags As the children enter the storytime area, give them nametags GreatTwenty Pirate Tellable Activity Tales Book by by Margaret Deri Robins. Read MacDonald. FiDgeTpLa9 thein the end shape of this of chapter.) large question marks. (Pattern is provided at GO 440 40 617 019 cp cc, pp ao Clt 047 62 q(5 ,17, as a0 .4t7 T, 137 `Where Is Thumbkin?" from Ring A Ring O'Roses. E.119T2e0 20'009 Gat 'Who're Hate You. Deo.? Cham (Traditional)VT leTe? Here! I'vePussy(MotherPussy been cat, Goose)cat, to pussy Londonpussy cat, cat, towhere whatsee the havedid queen. you you there? been? Where's (insert child's name)? Where, where? Vile.I frightened .71.acCe a little the mousePie? under the chair. There'sDown,No,Is he/she no! (insert at upthe child's onfountain? the name). mountain? There, there! IWho(Mother did. made Goose) the pie? INo,Gone see no! (insert out to child's play? name) is here today. 1.--2. SheWhoHe did. did. foundstole the the pie. pie? StoT9 ,3 WeWhoYou all did. criedate did. the for pie? pie? Fujita.Tell "A Mysterious House" from Stories To Play With by Hiroko name!. hoard Sto Ties "Chicken"The Little Little" Rabbit in Who Storytelling Wantedwith with RedTwo the theWings" by Flannel Flannel Paul in S. BoardStorytelling BoardAnderson. Book Book One by Paul S. Anderson. 138 Craft DetectiveMaterials Do5 Graft Video The Poky Little Puppy. (7 minutes) Directions PrecutStaplerScissorsConstruction two long paperovals about two to three inches wide and a Professional Storytelling with Anderson. theRezotrives Flannel BoardBoard BookBook TwoOne by PaulPaul S.S. Activit9 ovalthe2" X child'send to18" eachof strip thishead side ofchapter and toconstruction create staple for dog eachit to ears. fit.child. Remove Wrap andthe stripattach around an paper using the patterns at Anderson. characterpuppets,storytimeSing the substitutingfrom song books the "Where story.with the this Lem Isname Thumbkin" song Is...? of withthe puppet. a and puppet display Introduce that various represents finger a Audio Recordiv-90 "Who"Must BeAll Santa"Is Here?" on Raffi's on African Christmas RhythmsAmerican Album by Folk byElla Raffi.Songs Jenkins. and 139 Hie Rol' 9 Dig koT 9 Dock

1. Reproduce on tagboard. 2. Color clock and mouse. 3. Cut out clock. 4. Cut out mouse card on solid lines. 5. Fold up edge on dotted line to make handle. 6. Show child how to slide the mouse up and down the clock while singing the rhyme.

140 149 BRAT COPY AVAI[LABIZ 141

150 back9aTi ActVerittne haze

142 151 e,ece,k et tool*

143

152 TTeaorne Holt Nametag

144 153 4- Place this end of pattern on fold.

145

154 Detective Dog Graft

Cut 2

Cut 2 or Place on Fold and Cut 1

146 15 5 V110? VI At? Vile Te? NaDetag

147 156 ntootorl 'Pogue: #pREscHooL"PRoGRAns 5F9 a book! an C OD (0 op0,1 Qt3 dp sltj 60 40 co sclb Op Qt7 QO +5 co CO ct3s cio vd nizotoi Pozotue: 3F9 a Bo k. Preschool. ?Tovanz 1D9 Leila ParTioll 1300k0 to Share Big Old Bones: A Dinosaur Tale by Carol & David Carrick. Dinosaur Detectlye0 13rtett21 Board EnlargeDig Up and A Good-copy the React dinosaur bones using the patterns at the DinosaurDiggingBones,Where Bones, Up toBones Look Dinosaurs Dinosaur by For Bob A by DinosaurBonesBarner. Aliki. by by Byron Bernard Barton. Most. abackgroundbooksend Good of onthis Read", the chapter. and bones. on add the List Placeplastic bulletin titles the shovels. and bonesboard. call randomlyCenter numbers the on of slogan, adinosaur brown "Dig Up Books to Show' and BooktatkDinosaurArchaeologists BonesHunters Dig by by Aliki.For Kate Clues McMullan. by Kate Duke. Diop[a9 Ask a local group to display fossils. StoneRareFossil Treasure: Girl, Factory Bone Mary Girl:by NileAiming Story Eldredge. of and Mary HerDon Anning Remarkable Brown. by Laurence Discoveries by Nanetags Aster.)shape children of a enter dinosaur. the storytime (Patterns area, included give atthem the aend nametag of this inchap- the Anholt. 148 FillgOTFIA9 Green construction paper (AdaptedSuppose by Leila Raven Parrish) Directions ofPre-cutStaplerGlue the chapter. the dinosaur Fold the legs, paper tail, plate and bodyin half. from Staple patterns the body at end ButWhoCouldDo youthe isever islittlesuppose smallsmallsmall? talltalltalltall, be child a little a whodinosaur child is tiny (Reach (Crouch toward down) ceiling on tiptoe) bottomtheinside tail the ofon platefoldedthe other where paper end. it plateis Glue folded. with or staple the head the twoat one legs end to theand ToWhoWill reach trytrytryis up highhighhigh. to the dinosaur (Reach toward ceiling) Activity Photocopy the dinosaur bones pattern at end of chapter on card Read poems from Tyrannosarous Was A Beast by Jack Prelutsky. WeanAfterbrushesCoverstock. finding Cutwith and/oray them small them, plastic out pebbles, childrenand spoons place sand, can andone orreconstruct letset rice. themin Givea shallow uncover their children dinosaur. container. the paint bones. For Puppet ?Lay Anton"The Mysterious Wright. Egg" in One-Person Puppet Plays by Denise them.numerousona different large The group containers,children colors activity, of then cardbury reconstructenlarge stock. as above, thePlace bonesthe and only dinosaurs let and one the copy orchildren astwo several a group.bones find sets in Graft paper Plate Dinosaur simplesocietyInviteGuest a talk toSpeakerpaleontologist bring about fossils fossils toor andshowa member prehistoric to the of preschoolers a localplants rock and and andanimals. givemineral a Materials LargeDinosaur paper patterns plate 149 Auccio Rea° Tango "If"When I Had I WasA Dinosaur" A Dinosaur" on Singable on BigAmerica. TroubleSongs Collection by Trout Fishingby Raffi. in 11.90teT9 131.ast off! 'del, 51.-tes Dinosaur Game gooks to Share Harold'sBigAlistairCurious Silver in Trip OuterSpaceGeorge to theSpaceShuttle Gets Sky by aby Medal Marilyn CrockettKen Wilson-Max.by Sadler.Hans Johnson. A. Rey. www.kidsdomain.comDinosaur Maze Books -0 dhow' &Di booktatkBlastBest Book Off To of Earth: Spaceships A Look by AtAan Geography & Ian S. Graham.by Loreen Leedy. O ?Tofe00toria.1 Resource Tyrannosarous Was A Beast by Jack Prelutsky. MeSpace andTo SpaceMy Shuttle Place and Eye InBack Spaceon theby bySallyUniverse Joan Ride. Sweeney. by Jacqueline Camillo. Bulletin Board fromAgainstNast Oriental off a sky-bluefol* Trading a aooccbackground, Company. React! attach Surround "Inflate them Astronauts" with rockets topletterscutnumbers fromof bulletinwith construction ofthe booksboard. words about "Blastpaper space withOff Forwrittenthe Atitles, Good on authors, them. Read!" Place and across calllarge the 150 Display onNastCreate it and off aplace largefor it arocket on Good a table with Read! with"Blast a longOff forblue a Goodtablecloth. Read!" Place written PoeD "High Flight" by John GillespieGardens Magee, byJr. Charlesin Imaginary Sullivan. NaDetago books about space around the rocket. GTalto (AdaptedRoaket frompjn Crafts for Kids Who Are Wild About Outer Space thisshapedAs children chapter.) like theenter Space the storytime Shuttle. (Pattern area, give included them a atnametag the end of Materialsby Kathy Ross.) OldGold neckties and red rickrack trim, cut in 2 '-inch pieces Action R.119De (ByRocket014 Leila Raven Parrish) Directions pointedPrecutLargeFabric safety 3-inch end glue ofpin long the neckties.pieces off Let the each thin, WithInHere a rocket justI am enough (Pointship (Raise roomto self) hands over head to create a point) fieryrackpieceschild to tailselect of the forred flat a the andtie end rocket.and two of glue piecesthe An tieor adult ofstapleto goldcreate attaches two rick- a ZOOM!ReadyToGetting10-9-8-7-6-5-4-3-2-1! the formoon! ready (Jump the countdown?(Pointto up)BLAST to ceiling, (ShoutOFF (Crouch still out crouching)and down) slowly begin to stand up) orOptional:a safety the letters pin Children to "U.S.A." the back may to of add the rocket. starrocket. stickers 151 pp oD trC, dc, `"o op op a0 cp op OP Or:, 6C, Qb orp 00 op DO aO to MaterialsRocket Ship EmptyRock patterns toilet paper roll Books to Share FTeeiop Directions Pre-cutTapeSelf-adhesiveConstruction the cone paperstars and fin patterns at end of this chapter. AmericaStoryLiftThe Ev'ry of FlagA the Patriotic Voice WeStatue Love and Printerof SingbyLiberty Pam by LynnebyJamesMunoz Betsy WeldonCheney. Ryan. Maestro. Johnson. thecoverPrecuta helppiece the pieces of oftoilet an construction ofadult, paper construction the rolls. children paper, Give paper one eachwrap tocone, childan pre-cut appropriate and a toilet twoconstruction fins.paper size With roll,to Books to Show and book-talkFreedom'sGod Bless Gifts: America A Juneteenth by Irving Story Berlin. by Valerie Wilson Wesley. Tapepaperstickingand the aroundtape fins starsit tothe theto toilet decorate topbottom paperof the ofthe rollrocket.rocket, rocket. and rollChildrenattach the itcone withthen pattern, tape.add self- StatueMyThisThe America: ofStar-SpangledLand Liberty is Poetry Your by LucilleLand AtlasBanner byof Penner. WoodyillustratedU.S. by Guthrie.Lee by Bennett Peter Spier. Hopkins. Actfitto ofDistributeNastoff this chapter. photocopies naze of the "Blast Off Maze" found at the end bu[Lettri Board HandprintprintsInvite onchildren white nag attendingcraft paper preschool to create storytimea U.S. flag. to Seeput theirdetailed hand- Pro -feZgolla.1. Crafts for Kids Who Are Wild About Outer Space by Kathy Ross. ReOotriVe0 Display directions in the "Hand Print Flag" craft in this chapter. Imaginary Gardens by Charles Sullivan. 152 PlaceLet Freed0T2 books, videos, Ring and audiotapes about U.S. symbols such as ers.a table thedecorated flag, Statue with of red, Liberty, white, the and 4th blue of July,paper around or on stream-a U.S. flag on 5ong Decorattou Display a U.S. flag and/or hang red, white, and blue streamers cansArmy?alike°the(It inis Frenchsurgeon, believedthe Doodle early and reportedly that1750s. Indian the SomesongWar. wrote "YankeeDr.scholars the Richard tune Doodle"believe to Schuckburg, ridicule it originated is athe variant Ameri-a British during of or banners. officers,versionsridicule,the nursery includingtheand rhyme colonialsparodies George"Lucy tookevolved, Locket". Washington.the songmany Despite for of theirTherewhich the own. are madefact saidCountless it fun began to ofbe their as 3t teker U.S.As children flag. enter the stortyime area, give them a sticker of the Ridin'Yankeemany ason Doodle 190 a verses went of to "Yankee town Doodle".) pony, Actio. 50219 (Adapted by Leila Raven Parrish. Sing to the tune ofAn "I'm American a YankeeChorus:AndStuck called Doodlea feather it macaroni.keep in his it cap HereI'mLittle an isTeapot American, my flag, ".) for look all toat see.me. (Point to self with both hands) (Point to flag) AndYankeeMind with Doodlethe the music girls Dandy, beand handy. the step, up, LetWhen America's I get excited, freedom then ring! I sing; (Cup hands around mouth) ketivit9 illustratedRead the book, by Lynn "God Munsinger Bless America" and play by the Irving accompanying Berlin and CD Poen GardensRead "On by Freedom" Charles Sullivan. by James Russell Lowell from Imaginary 153 by Barbra Streisand. GTattO GUGOt Speakers MaterialsFTeecton Hat RedHat patternand blue construction paper folding.AmericanInvite a Scout Legion Troop to demonstrateor member of proper the VFW, flag Elksetiquette Lodge and or flag Directions Pre-cutStaplerSelfGlue stick the silver red stripes,stars blue paper, and the hat using the Atka.° R.ecorcaligo "This"Living Land in the is YourPromised Land" Land" on Sing onArtists. SingAmerica America by Various by Various Artists. strippaperbluepattern paperto atthe end tohat theof to thiswhitefit each chapter. hat child's and Children then head. attach attach stars red to stripes blue andwith the help of an adult. An adult staples a 18" x 2" V1.000 This Land is Your Land. (7 minutes) HancMaterials trills flag WhiteBlue craft and paperred tempera paint Star-SpangledThe Story of Banner.the Statue (7 of minutes) Liberty. (7 minutes) Directions temperadrawInPie advance, tins a square paint precut in separatethe craft upper paper pie left tins. into corner. Thea large Placechildren rectangle blue dip and theirand red Vet) 5ite0 Starwww.ushistory.org/betsyBetsy Spangled Ross Home Banner Page stripesthecorner,hands flag. in onleaving Theyblue the flag. paintmake white Hang and seven spaces make the lines completedbetween handprints of red them handprints flag in to inthe create storytime upper to starscreate left area on www.treefort.orgwww.orientaltrading.comOriental Trading Company or on bulletin board. 154 Professional, Resource Imaginary Gardens by Charles Sullivan. Books to share 12 Ways to Get to 11 by Eve Merriam. I Spy: NtIDIDells 130010 to Show. and BooktafkMissionMissingMathThe Doorbell Curse MittensAddition by Rang John by by Stuartby Scieszka.Loreen Pat Murphy. Hutchins. Leedy. 13ttettn. 130aTcC MathIfHow YouGrapes Muchfor Made Allof is Math Seasonsa a Million Million? by Gregby by Gregby David Tang. David Tang. Schwartz. Schwartz. ematicalbulletinPlacenathenatical book board. equations jackets Surround11.9stelteo inof variousbooks them about colors with math numbersand andsizes. numbersand simple on math-the Decorations Hang large numbers from the ceiling. 155 NaDetago endlikeAs children ofvarious this chapter.) enternumbers storytime from 1 area, to 5. give (Patterns them arenametags included shaped at the flannel. 130avt StoTte0 withhas 3 2 cookies. dozen smaller When cookiesGrandma on arrives, it. add a gray felt square FillgeTFLa.9 Library.`Enumeration" from Ring A Ring O'Roses by Flint Public "Bridge"Five Little of Crocodiles" Chickens" inin TheThe 2ndFlannelFlannel2nd Edition Edition Board by by JudyStorytelling Judy Sierra. Sierra. Book, "Arithmetic""One To Ten" by Carlby Janet Sandburg S. Wong in The Children'sin Marvelous New Oxford Poems Math Treasuryby by Michael Lee of Harrison. Graft stickerMaterials Ntri2be'r0 Small stickers I. Bennett Hopkins. Directions PrecutConstructionGlue thestick numbers (optional) paper one (optional) through five from construction Song "Three Blind Mice" paper.Optional:numberassortment Give one; Childreneach of two stickers. child stickers glue three The to to children the five number different affix two one numbers and sticker so on.and to the an nath 3t0T9 chocolateRead The chipDoorbell cookies Rang on bya flannelboard. Pat Hutchins. As Place friends 12 largearrive felt andDooTiDeu. Rang largestickerthe piece on numbers them of paper. to with a the arecookies 4 children appropriatelyare shared, and 12 do cookies, onthe the math flannelboard. 12 with divided the children byFor 4 example, = and3, each divide there child 156 Ha-WV .71,90-tellez Activities childrenHide large hunt number for them. shapes around5F9 storytime area and let the DeT0 Books -to ShaTe A Daniel'sColor Of Mystery His Own Egg by Leoby Alma Lionni. Flor Ada. onePrintNumbernumbers by Jan one Brett's Flash andflash askNumbers Galtcards them Csmain.htm. to at readwww.janbrett.com/numbers/ the Show numbers the children with you. the cards Mixed-UpWhere Do Chameleon the Animals by Live?Eric Carle. by Stephanie Peterson. Videos How Much Is A Million? (12 minutes) Books to Show and Book-talkIChamelons LikeWhat Bugs Color Areby isMargaret Cool Camouflage? by MartinWise Brown.by Jenkins. Carolyn Otto. Xelp Sites ScholasticIf You Made Kids A Million. Fun Online (12 minutes)Games and Contests Nametagz GivePlants each That child Never a chameleonBloom by Ruth nametag Heller. made from the pattern at www.janbrett.com/numbers/numbersJanwww.scholastic.com/kids/games.htm Brett's Numbers flash cards main.htm R.119ne the end of the chapter as they enter storytime. 2Tofe001orial. MarvelousThe Flannel Math Board by Lee Storytelling Bennett Hopkins.Book, 2nd Edition by Judy Sierra. Re0or7tC00 WhetherleatherOr(Traditional) whether the weather the weather be fine be not, RingThe A New Ring Oxford O'Roses Treasury by Flint of Public Children'sHarrison. Library. Poems by Michael 157 OrWhether whether the the weather weather be hecold hot, "Fisherman's Surprise" from The Storytelling Handbook by Whether,WhateverWe'll weather wethe like weather,the itweather or not. Flannel"The Mysterious Board Storytelling Soup" in StorytellingBook,BookAnne 2nd TwoPellowski. Edition with by Paulthe by Flannel JudyS. Anderson Sierra. Board or "Soup from a Nail" in The Action Sony (AdaptedC10,3'24601 by Leila Raven Parrish. Sung to "Battle Hymn of the "The Caterpillar" in The FlannelEdition Board by Storytelling Judy Sierra. Book, 2nd TheRepublic) little green chameleon(Point had toa flynose) upon his nose, GTat to Crafty CIAT2eleori Stick Puppet The little green chameleon(Point had toa flynose) upon his nose, Materials CraftGlueConstructionChameleon sticks pattern paper, several colors Yum!And he licked and it was(Stick(Rub gone. out belly) tongue and try to lick nose) Directions andthePrecut endglue chameleons of them this chapter.together in many Childrenwith differenta craft choose stick colors two in between usingdifferent pattern to colors make at MaterialsNature Canoutage Bpace[eta chameleon stick puppet. Storgteiling TellLiteracy The Mixed-Up Bag (#353797 Chameleon in catalog). by Eric Cade using Childcraft Directions PlaceSmallMasking aleaves large tape andassortment flowers of leaves and small flowers on a Flannel. Board StoTteo Tell A Color Of His Own by Leousing Lionni felt as figures. a flannel board story 158 leavessidelong out,table. and around flowersAn adult the to wristwraps the maskingof a thepiece child. tapeof masking The to create child tape, aattaches bracelet. sticky Nature 5F9 Materials PlasticHalf Wrapgallon milk or juice carton plastic wrap rubber band Video The Caterpillar and The Polliwog. (7 minutes) containerTapeOptional:Rubber of band goldfishAquarium or milk carton Web Site www.childcraft.comChildcraft Education Corporation Directions tohelp,bottomIn oneadvance, the end of children the of remove cartoncartons. attach theusing With top plastic tape anand adult's and/or wrap a rubber band. Chil- "Professional. geooneez One-Person Puppet Plays by Denise Anton Wright. adren goldfish may useor two the inNature a container, Spy it toor looklife in at ponds life in or an puddles. aquarium, StorytellingThe FlannelStorytelling with Board the Handbook FlannelStorytelling Board byAnderson. Anne Book, Book Pellowski. Two by Paul S. 2ad Edition by Judy Sierra. Activity animalsSheet"GiveViltab each found andto child anthen at theklitnaL?a letcopy end them ofof thecolorthis Actiitty "Which chapter. all of theisSheet Ask an pictures. Animal? them to circleActivity the atreot Speakers them.groupInvite toa representative bring animals fromto the a librarypet store, and the tell SPCA, children or aabout nature 159 Books to Share Shiyer 11.e TIDIDev! Decorations Hang pirate and parrot pinatas. Books to show' anti book-talkPirateToughPieCaptain RatsPete Boris andAhoy!by KimbyMatey Memby Kennedy. RichardSet Fox. Sail Starry.by Daniel Laurence. FillgeTpLa9NaDetago pirateAs children or parrot. enter (Patterns the storytime are included area, give at the them end nametags of the chapter.) of a PirateOoeyIDo Spy Pirates GooeyTreasure School Take by by Hunt Mercer Baths?Cathy by Mayer.JeanE.by Dubouski.Kathy Marzollo. Tucker. Pirates,(AdaptedPITatO, pirates by Pirates Leila everywhere, Raven Parrish.) (Motion around room) Btiae-tiri Board Alloy nate91 Cole Aboard for a Good Reat[! PiratesPirates givingclimbing sittingshouting stares, onstairs, "Ahoychairs. (Hand (Climb There!"(Pretend above stairs) eyes)(Cup to sit hands) down) Display piratestitles,bulletinCreate authors, aon board.large the pirate andPlace call shapes.shippirates numbers and across place of thebooksit on hull the and of lower ship.videos half Write about of bookthe Pirates,PiratesARGH! washing pirates(With frustration)everywhere! hairs! (Rub (Motionhands on around head) room) hunts.%LynCreate Use ane displaya pirate nnbeTs! ofpiñata books as and the videoscenterpiece. about pirates and treasure 160 aC) ,ar,CC) OC) a cc,

167 Dinosaur Nametago

168 178 'Parer 'Plate DiDoZatiT

179 0 Pager Rate anozan

170 180 Diziosatirhones

Nowl.1.0

171

181 Dt/lozatiT Bo nes

172

182 Dinosaur bones

....memoa.m..

173 183 Rocket Ship Craft

174 184 Nast Off haze

START

175 I 8 5 0 $ lac e 5huttLe NaDetag

,

176

186 N N cov....,N w I SFNm7bers-- Nape-tags

178 188 CLaDe[eori Na Detay

179 189 Chane[eori 'Puppet

180 190 Viltch to arl Ar412a1.? kettvit9 Sheet

0 O 0 O i

181

191 5htver ne TIDI3er0 NaDetags

21Tate Hat Graft

Pirate Patch

182 192 "Pirate Hat

183

193 QD OD cD 69 43 CID qo Op OD 61D OD Op Qt) op OD aD CD 61) v so, CID Qo i400q ASVINalpaga 6a2 IAL.Yasoad. :elctiogoa ttoioonst n1001011 2000t lie: 5109 a Elie Do-tam by Lea 'Parrish 1?Togra.D0 oa k. Books to Share Case of the Backyard Treasure by Joanne Roddin. Secret Cosiez 13t7aetili Board InBTeak code, thewrite GocCe: in titles READ! of classic juvenile fiction books on book MysteriesUnbreakableCase of theof Harris Double Code Burdick Crossby Sara byby Hoagland CrosbyChris Van Bonsall. Hunter. Allsburg. boardcovers.coversthe insidetitleand cutAttach scrambledletout of the ofthea bookchildrenconstruction key on coverto the the decipher covermadecode paper acrossand fromthe folded thetitles. construction bottom unscrambled to Variation: look of like paper. bookWritetitle on bulletin Books to Show' and BooktalkNavajoLuFolds and Clancy's Codeand Dead Talkers Secret Man's by Codes NathanProps by by Aaseng.Adrienne Sharon Bailly. Mason. Display PassUsborne It On!: Book All About of Secret Notes Codes FromO'Hare.Inks by Secret EileenTo Fancy Codes O'Brien. Secret and SpecialCodes and Hidden Messages by Jeffrey nizotowithlettersOn a booksposter Possible:and in fromboard, Morse the 5F9write Code.Texas a"Mission Book!DisplayReading Possible: booksClub bibliography.on Spy Morse a Book!" Code inalong 184 3tamp Stamp children's hands with Kidstamps Navaho Dancer. Cheer /Rhyne Crafts Listen,ListenBut(Add you'll listen,cheerleading never hear motions) MaterialsDoor Hanger MarkersPoster board Yaaa!(insert Yaaa! child's (Silently name) wave give handshis/her over secret head) cheer. Directions code.booksCut door on hangerscodes and and let give them one write to each a message child. Bringin a secret out Stories to Tea "The"Pass PrincessIt On" by and Elizabeth the Ogre" Ellis adapted inBaltuck. Crazy by Gibberish Kaye Lindauer by Naomi in Invisible(Adapted "Paintfrom Science Arts by Mary Ann Kohl.) Reader's Theatel. Joining In by Teresa Miller. Materials WaterBakingCups or soda small jars rewriteJonWritenath Sciezka. a Diveitreader's as a Choose dialogue. theatre an script Aexciting narrator based and will on fun thestate part book descriptive of Maththe book Curse infor- and by Directions PaintPurpleWhiteCotton brush paper grapeswab juice Shepard'smation. For Reader's more information Theater Page on at reader's www.aaronshep.com/rt/. theater, see Aaron whitewaterswabsoneMix inpaper cup4 cupstablespoonsas or pensand jaror smalla peror cotton brushes2 of jarsto baking 3swab. tochildren. and create sodaThey dip "invisible Giveand themwill 4 use eachintablespoons thetheink". child "invisiblecotton Make a sheetof of Story-team Book"Master 2nd of Edition All Masters" by Judy from Sierra. The Flannel Board Storytelling 185 completelywillink" thento create brush dry an topurple invisible reveal grape their picture juice secret orover picturemessage. the paper or Themessage. when children it is GA:1'2e "PigorExplain speaking Latin Pig inLatin Pig toLatin. the children Learn about and letPig them Latin practice at the Pig reading Latin childoverchoosesTheGoo children his/herwho nakeT a childbecomes eyes. sit toin Thebea thecircle, the librarian "Code "Code facing Maker". Breaker"then each silently other.The and Code points placesThe Makerlibrarian to a blindfoldanother piglatin/.SearchHome PageGoogle.com at www.idioma-software.com/pig/home.htm. Igpay Atinlay at www.google.com/intl/xx- rhythm.Theseveralperforms children times. The an action Codecontinue Then Breaker andthe to Codeclaps perform must Breakerin a guess rhythm.the removesaction the The identity and thegroup clap blindfold. of repeatsinthe Code it andexplainpictures.ARebus rebus ask what'Writingthem isShow a representation theyto the try are.children and Give decipher of somethe a name,children examplesthem word, individually a sheet of or rebus phrase of rebus puzzlesor using as puzzles a and thatBreakerMaker child while becomessuccessfullychooses the agroupthe child guessesnew repeatsto Code be thethe theBreaker. identity new code. Code ofTheWhen theMaker. former Code the Code Maker,Code www.eastbourne.vic.edu.auviewedcreategroup. some Whenat the of Middlethe their children own. School /studentsExamples are Fun comfortable Puzzle /middle of rebus Page /puzzles/ with puzzlesat them, may let bethem lietiVitteS Hie.rogl9pRes G en 51) ea.keT Hire a magician to perform for the children. www.eyelid.co.uk/hierol.htm.hiero.htm.OnlineLet the Hieroglyphicschildren Read translate more Translator about messages hieroglyphics at www.quizland.com/into hieroglyphics at using the Vel) Sites Aaron Shepard's Reader's Theater Page andPwzlemakernake parents. a ?Ingo Createis a puzzle and printgeneration customized tool for word teachers, search, students cross- www.google.com/intl/xx-piglatin/www.aaronshep.com/rt/Google.com Igpay Atinlay puzzlemaker.school.discovery.com/.wordthe andchildren math andpuzzles show using them your how word to make lists. their Make own a puzzle at http:// for 186 www.eyelid.co.uk/hierol.htmHieroglyphics Middlewww.eastbourne.vic.edu.au/students/middle/puzzles/ School Fun Puzzle Page www.barbie.comMystery Squad /mysterysquad Books to Share BalladCase of Mulanthe Detective by Song in DisguiseNan Zhang. by James Preller. Mao Navajowww.quizland.com/hiero.htmOnlinewww.history.navy.mil/faqs Code Hieroglyphics Talker's Dictionary Translator MeetFa Mulan: Addy: The An StoryAmerican of a WomanGirl bySouci. Connie Warrior Porter. by Robert D. San PuzzlePigwww.idioma-software.com/pig/home.htm Latin Maker Home Page gooks to Shover and BooktaikChina'sThe Bad Bravest Beginning Girl: (A Legend Series ofLemony HuaUnfortunate Mu Snicket Lan Events, by Charlie Book Chin. 1) by 2Tofe0Otolla1. ReOotITCOO http://puzzlemaker.school.discovery.com/ Toliver'sSecretHarry theSoldier: Secret Dirty ThebyDog Esther Story by Gene Brady.of Deborah Zion.McGovern. Sampson by Ann TheCrazy Flannel Gibberish Board and Storytelling Other StorySierra.Storyteller's Book Hour 2nd Stretches: BagEdition of TricksFrom by Judy aby Naomi Baltuck. Stories Tell "Burglar's Hideout" from StoriesFujita. To Play With by Hiroko ScienceJoining In:Arts: An Discovering Anthology Scienceof AudienceKohl.How Through to TellParticipation ArtThem by byMaryann StoriesTeresa Miller.and ,eacteT's The Hidden One: A Native American Legend told by Aaron 'heater The Secret Code is Read: TexasManual Reading by JeanetteClub Program Larsen. 1990 187 Shepard at www.aaronshep.com/rt/RTE12.html. for Elementary"The Magic Students Fan" inby Multicultural Suzanne I. Barchers. Folktales: Readers Theater Gameo aria Acttvittez Grafts narks Facefound5upeTDistribute atPalming Herothe endphotocopies Atta0 of this fiordchapter. of the search "Super Hero Alias Word Search" MaterialsBraman.)(Adapted from Kids Around the WorldMask patternCreate! by Arlette N. other'sbrushes,Hire or faces. invite and sponges a local face for thepainter. children Or, supplyto paint face their paint, own or each PlasticMaskingScissorsPoster boardstraw tape atiot Speaker playInvite and a drama discuss club make-up, or theater costumes, group toand perform acting. a scene from a Directions DecorationsGlueMarkers (sequins, glitter, paper confetti, beads, feathers) Vel:$ Site Aaron Shepard's Reader's Theater Page thenpatternsonPrecut 9" cut x the 7" tothem piecemasktrace out, ofaand mask reshapingposter nose and board.patterns nosethe eyeholeEach onto at the childposter endif needed. will ofboard. thisuse To thechapterThey A www.lemonysnicket.comwww.aaronshep.com/rt/Series of Unfortunate Events strawandforhalf,make a tape unfoldflap. toa nose, thethe They backit,flaps they and then right to cutmake insidecut aor triangle the anotherleft of center side the using fold mask.of of mask the alongthe Finally, flap pattern,and the on decorate bottom theythe fold fold tape itedge in a Videoo Harry the Dirty Dog. (19 minutes) decoratetheir masks the with mask. marker, sequins, glitter, and feathers to 188 Sylvester and the Magic Pebble. (11 minutes) PTofeOgorial, ReOotITCeS MulticulturalKids Around theFolktales: World Create!Readers Studentsby Theater Arlette by for N. Suzanne ElementaryBraman. I. Barchers. 130010 to sham Aero and Officer Mike Police Partners by Kris Turner. Dog Detectreo StoriesStarting To Face Play Painting With by by Hiroko Fiona Fujita. Watt. JaneOfficerTheCase Morton, Great of BuckleDog Corgiville Dog Camp and Detective MysteryGloria Kidnapping by by EvePeggy Judy by Bunting. TashaRathman.Katschkle. Tudor. Books to Show* aria Book-talkSAM:BombOriginalFive DogDetection True AdventuresDetective Dog DogsStories by by of Mary by CharlesHank Margaret Labatt. the George. Cow Davidson. Dog by John Erickson. Stapp BuckleStamp the and children's Gloria" stamp. hands with the Kidstamp's "Officer Story UseWith puppets by Hiroko to tell Fujita."Doggie Policeman" from Stories To Play 189 Crafts .71.111(Adapted GaTtov. from Stories To Play With by Hiroko Fujita.) Puppets stick.end of this chapter. Draw a face and attach it to a craft Materials MarkersScissorsMilk or juice cartons (pint or quart) Ganes aria ActiAttez theactivityDetectiveSing puppets "I Amshown Dog canDetective above.Gone" interact. HaveusingDog" children puppetsand/or "Oh writecreated Where additional from Oh either Where verses craft Hasso Directions bottomnallyOpen fromthe of carton theeach carton other)top, cutas leaving shown two opposite twoin the inches illustrations corner uncut edges at at the(diago- the end allot Speakers Invite a representative from a dog club or pet store to present a Thepasteofuncut the open facescorners/edgescartonchapter. flap and is is Openshowing.bodies the mouth.andup of the Whenfoldinganimals cutTrim opencarton the orextra peopleflapsvery by carton. pushing wide,back on theChildren sodraw carton.inthe onor inside thecan explainusesdog trainingdogs training and demonstration. invite and duties.an officer Or, and ask his if youror her police dog to department come and oitgami Dog Puppet aStoriesmaycreate police be any Toused dog puppet.Play forand With puppet a Ancat by examplepuppet showsHiroko areis ofFujita. the howrequired. "Doggie Formilk this carton Policeman" puppet puppets show, in cD-R,ano Scooby Doo:Doo: ShowdownPhantom of in the Ghost Knight. Town. Materials TapeCraftMarkersOrigami stick or plain copy paper Itiel) Site www.kidstamps.comKidstamps Online Directions Fold the square piece of paper as shown in illustrations at the 190 PT4e$Otorial Resource Stories To Play With by Hiroko Fujita. Pirates BringPleaseTheBring pirates back bring back, mysail back bring treasure over my back, the treasure to ocean, me, to me. gooks to share A TimeRobinPirate's Warp Hook: Life Trio: for Pirate Me!:Not HunterSo A JollyDay by RogerAboard EricThompson. by Kimmel. a Jon Pirate Scieska. Ship by Julie (repeat)Oh,Bring bring back, back bring my back, treasure to me. gooks to 51101,4, aria BooktalkWomen Pirates: Eight Stories of Adventure by Myra Weatherly. Story AdventureRead one by of Myra the stories Weatherly. from Women Pirates: Eight Stories of Decorations PiratesBooty:GreatGrace GirlPast Piratethe PiratesNoonPirate Activity byOn MaryKatherine the Book High Pope by SeasLasky.Deri Osborne. by Robins. Sara Lorimer. GTatGaDez to aria Activities Make your own Treasure Hunt at www.scholastic.com/Ispy TradingGive eachCompany. child a plastic pirate eye patch from Oriental TreasureMaterials 71AF TeaTreasure bag (pekoe map or black work best) Song Bonnie(Adapted Lies by OverLeila theRaven Ocean".) Parrish. Sing to the tune of "My Pirates Directions Optional:NewspaperWater Ball point pen The pirates sail over the ocean,sea, 191 theisGive included treasure each child atmap the a using endphotocopy of a thisballpoint chapter.of a treasure pen. Children To map.age the mayAn map, example add to dry.dampenCrumble a tea the bag paper and into rub a it ball across and theleave paper it on to newspaper stain. to whichfascinating ones facts.are true Read and them which to onesthe children are not. and let them guess TreasureSadler.)(Adapted fromChen Kids Can Press Jumbo Book of Crafts by Judy Ann Let"Pilateusing(Adapted the children black Face from face Patrittngpaint Starting paint, their aFace facesstipple Painting to sponge, create by happy andFiona paint orWatt.) scary brush. pirates The Materials SmallScissorsScraps jars of wrappingor containers or tissue paper Paintlibrarianthethen aneyebrow. let archcan the begin overchildren Dip each by the paintingpaint eyebrowstipple their onesponge and own child's add andin featheryblack faceeach as paintother's followslines and faces.below daband to Optional:ShoeboxGlueCraft stickspaint with Stickers, brush lid sequins, glitter fromFillthebeard. each sidein theTo ofear create shapethe to thenose, mustacheand chin next add and painta paintacrossthin a curly aline theline alongtopend. from lip the the to top createtop of lip thea up lip. to Directions ofmixturePremix the shoebox equal in small amounts with jars the or of gluecontainers. glue mixture, and water Children attach and abrushplace piece thean of area Thepirateonsymbolsencourage pirate grave Flag flag ofstones) a death hastywas and(adesigned surrender. skull may and have to Thestrikecrossbones got Jolly itsfear nameRoger into was fromvictims commonlyoften the depicted and devil seen -Old Activit9 Theyandwrapping continuelidsequins. are or covered tissueadding paper,and glue then and decorate papersmooth until it with the stickers,aentire craft boxstick. glitter, www.ebs.hw.ac.uk/EDC/CAC/pirates/life.htm.designredRoger flag -their but- Jolie isown more Rouge. flag. likely A Let picture derived the children of fromthe Jolly drawthe FrenchRoger a Jolly isname Roger at for or the Piratewww.piratesinfo.com/main.phpRead QUIZabout pirates at Pirates in Fact and and make Legend a list ofat true and false 192 atiezt Speakers orinviteInvite scenes thea singer fromlocal ThedressedGilbert Pirates andas a ofSullivan pirate Penzance. to Society sing sea to shanties, perform songsor Audio Recording various"Song of artists. the Pirates" on Musical Adventures of Peter Pan by Boolo to Sham Adam Sharp, the Spy Who Barked by George Edward Stanley. Vel) Site WWW.National p iGeographic ra tesinfo .com/main.php Pirates JacobHenryEncyclopedia Two-Two's and Mudge Brown First and and Spythe the SneakyCase CaseSobol. by ofCrackers Mordecai Two Spies by Richter. Cynthiaby Donald Rylant. Pirates!www.orientaltrading.comOriental Fact Trading and Legend Company PhoebeOwen the Foote, Spy Super by Judith Spy byBerry Stephanie Griffith. Green. www.ebs.hw.ac.uk/EDC/CAC/pirates/pirates.htmQuestwww.piratesinfo.com/main.php for Pirates Books to 31101,4t and BooktavkSpyLuHarriet & by Clancy's RichardSpiesthe Spy Again Spy byPlatt. LouiseStuff by Helen by Fitzhugh. Adrienne Ericson. Mason. 2Tofessto1al Rezoureez StartingKids Can Face Press Painting Jumbo Book by Fiona of Crafts Watt. by Judy Ann Sadler. Spy in the Sky by Kathleen Karr. board DisplaywithAttach5F9 magnifyinga book6004 jackets React glasses to the cut bulletin out of constructionhoard and surround them paper. 193 libraryDisplay books, a poster audiotapes, of a recent and spy videotapes movie and about surround spies. it with Decorations Box cutter (for use by adult only) talGive Trading each childCompany. a pair of Black Nomad Sunglasses from Orien- Directions whiteupsorsChildren as paper and shown thencut to eachinoff cut the he oneside drawingtop side of and the of bottombelow. carton.the carton ofThey Then, a cartonso next theythat glueusing itdraw lays sheets scis- flat of Cheer/R.1191 e (AddTIT cheerleadingTop 6F100 motions.) secondouteightdowsequally 2 windows,identicalon floorsized each window squaressection windows. the first foronof floor the sideAnfirst inside adult windowsB,floor as uses ofindicatedand the on asecond cartonbox side incutter A floor thefor and illustra- a to win-thetotal cut of TipWeOurNow always nevertopspies here's spies! stop,are wina tiptop namestheandtion. uncutpig Children appear that windows are incolor atthe the on thediagram. endthe pictures insideof thisThe ofof chapter animals thethe raccoon,carton and will gluewhere show rabbit, them their cat, to C)CJI St0T9/GTat windowonlyWhenthrough A telling and theat a B,cut time. the B window and story, C or thewhen D children and it is A folded show flatten andon the top then house of open them. so one MysteriousHiroko(Adapted Fujita. from House" Children"A Mysterious or make make5F9 up House"an theirHouse I Spy own in House Stories stories.) and To thenPlay Withtell "A by Clue Rabbit Here WindowCut Here Upstairs Glue Pig Here Materials GlueWhiteQuart milkpaper or juice carton Glue Raccoon Here Clue Cat Here Cut DownstairsWindow Here AnimalScissorsMarkers/crayons pictures/drawings 194 Side D Side C Side B Side A pointingDoThe you to 5#1.9: the like top my Awindow house? ngsteTtpuo onIt hasB) two House floors. (Show sides A and B, aanez aril ketivittez (Adapted5139 Handshake from On Stage aane Theater Games and Activities for Kids window)anyone one home? (Open window)Hmmm?HelloMy friend Mrs. I Mrs.wonder Rabbit, Rabbit whohow livesare you? here Bye, on the see secondfirst you floor? later. floor. (Point(Close Is to TheRules:by Lisa goal Bany-Winters. of this game is Six to guessor more which children child may is the play.) spy. One party.bottom I would window love on to Side come. A) Can IOh,Is bring anyone it's my Mr. one friend Raccoon. home? Mrs. (OpenI Rab- say, itwindow) looks like you're having a slumber,beginsselectsgame.child is Everyone whenthe selected rock Spy the & by elseasroll,Host patting the sitsbirthday, announces,"Host" down one ofchildanddance) the "Welcome closes on party party." the their whohead. Everyoneto eyes.begins myThe (tea,The game the gets Host up Rabbit.tobit? Sides Great, (Open B andI'll go window.)C. getPoint her. to (Close the top window. windowOhRemember my youSecretly on whoSideare not movelivesB.) my here?carton friend Yes, Mrs. that's Rabbit, right you my are friend Mrs. Mrs. Pig. theremovearoundand insidepretends andguests of shake theirto from be hands at the the party withwhenkind by the ofshaking gently partyother named.guests.it.scratching The SpyTheyThe or doesSpy walktickling mustnot findYOURWhat Mrs. are house? Rabbit.you doing (To (Secretly audience) at my friendturn overThis Mrs. cartonis Rabbit'svery to strange. Sides house? D I andwill This A.) have is to tell Mr. Raccoon, I cannot otherverywaitshave important children'sten to seconds eliminate forhands before the everyone sovictim leaving as not whoseto to waitthe give partyhand ten away secondsverythey the dramatically.shake. identity and Ashake victim of theIt is mystery!lower window, as you open it.)Hello,This is I'mwhere back...0ops! my friend HereMr. Raccoon is Mr. Cat lives, right? (Point to this is quite a theanother'sonemustSpy. Spyperson A leavebecomes hand.child has the mayleftThe party,the the guessperson Host party.too. whoof whoA Ifthe child thethe correctlynext Spyguess cannot party. is at isguesses refusewrong,any time tothe he shakeafter identityor she at least of aD dO o0 dm dr, co do,cic) `-do op ap ap dr, acr, 00 cit7 qb at) ab oc) do av cc, 195 ReacCeT's Theater "The Seven Pairs of Slippers"Readers inBarchers. Multicultural Theater for Folktales: Elementary Students by Suzanne I. Audio Reconitrigo StrTittroTO "Spy"Secret Kids Agent (Save Man" the onWorld)" Mission on Various& Accomplished:Spy Cops Kids byArtists. Soundtrack Hal Blaine.Themes by for Spies gooks to %ate HeroineThe Butterfly of the Titanic: by Patricia A Tale Polacco. of Both True and Otherwise Life CD-RanoVel) Sites Secret Agent Barbie. gooks to $1101,,r and book-talkTheSadako Yellow by Eleanor Star: The Coerr. Legend ofof Carmen MollyKing Christian Brown Agra Deedy.by of Joan Denmark Blos. by InteractiveLetwww.scholastic.com/IspyOnline each I Spychild Online Picture create Game an I Spy picture to print. HeroineSadakoMyIsland Side ofof and theofthe theTitanic: Blue MountainThousand Dolphin The Real byPaper by Jean MollyScott Cranes Craighead O'Dell. Brown by Eleanor by George. Elaine Coen. Landau. www.orientaltrading.comwww.scholastic.com/IspyOriental Trading Company Decorations Hang paper cranes from the ceiling. ?To-bolo/al, Resources, StoriesOn Stage: To Play Theater With Gamesby Hiroko and Winters. Fujita.Activities for Kids by Lisa Bany- Echo StoT9 .(AdaptedSuITIY0Tthe librarian.) by Hike Leila Raven Parrish. Children repeat each line after 196 AllLet's right. go on a survivor hike. LookLet'sOkay. go.what I see. "Mollie Whuppie" in Multiculturalfor ElementaryBarchers. Folktales: Students Readers by Suzanne Theater I. Barchers. Can'tA big gool' overunderaroundtree. it. it. it. "The"Baba Giant Yaga" in in the Multicultural Garden" in MulticulturalFolktales:TheaterElementary for Readers Elementary StudentsFolktales: Theater by Readers StudentsSuzanne for byI. Barchers.Suzanne I. Barchers. Okay.AllClimb,Have right. to climb. climb it. "Sally Ann Thunder and DaveySuzanneFolktales: Crocket" I. Readers inBarchers. Multicultural Theater for Elementary Students by ...AVerses:Let's big go. ol' field...Have to go throughpalms together) it...Swish, swish. (Rub Crafts Parer Crane origa221 ...A bigbig ol'ol' river...Havebridge...Have to swimto crosschest (Makethrough it...Thump,with swimming palms)it...Swim, thump. motions) swim. (Pound DirectionsMaterials DirectionsOrigami paper can be found at www.sadako.com/howtofold.html. Whew!...A big We ol' made hill...Have it, let's torun fast)climb down!thighs) it...Huff Whee-e-e! and puff. (Slap thighs (Slowly slap Materials(AdaptedbutteTfL9 from Puppet Kids Create! by Laurie Carlson.) Yea! We survived and made it back to the (insert name) Library. ScissorsGlueSequinsPaperMarkers plates R08.01'90 Theater "Gawain and the Green Knight"Readers in Multicultural Theater for Folktales: Elementary Students by Suzanne I. 197 Stapler Directions halfwithDraw tomarkers a form butterfly a and crease onsequins. the and back then Fold of unfold the a paper decorated it. plateCut another sideand decorateof platepaper in it kuito Recorarlyz The Unsinkable Molly Brown by the Original Broadway Cast. cludedinthehalf.plate other round Staplein at halfto theedges flap theand end thehalf only.trim of butterfly piecesthis one Insert chapter. inch to wings.a the thumboff back of An thein of illustration oneflat the side butterfly andof is each fingersin- along 'Web 5t,te www.sadako.comSadako Film Project MaterialsThe Yellor Stax Craft sticks 21,0feootonat. Roonge MulticulturalKids Create! by Folktales: Laurie Carlson. ReadersStudents Theater byfor Suzanne Elementary I. Barchers. Directions NewspaperPaintbrushesYellowGlue Paint pointedtriangle,TheCover children a star, tableglue and gluewithone paint trianglethreenewspaper. the craft onstar stickstop Giveyellow. of togethereachthe other child to to 6 form createcraft a sticks. a six- kettrit9 Havehazes the children create mazes for their friends using the diagrams found at the end of the chapter as a guide. 198 U/IcieT5TotiricC Rati.ToacC Display Books to Share Aunt Harriet's Underground RailroadRinggold. in the Sky by Faith UricteTvourictFreedomCreate a largeby Marcia quiltRailroaci/SecTet Vaughan.using the patterns Goode found Quilt in Secret to SweetSecretUnderThe PeopletoClara theFreedom Quiltand Could the ofby Fly:Freedom NightMarcia American by Vaughan. QuiltDeborahHamilton. Blackby DeborahHopkinson. Folktales Hopkinson. by Virginia 50115 My"Follow Head the Off! Drinking by Kathleen Gourd" Krull. on pages 32-33 of Gonna Sing 2.130010 Drinking Gourd: A Story of the Underground Railroad by F. W. to $ 11ov azct Booktalk Activities thePlay book the audiotape by Jeanette of Winter.Follow the Drinking Gourd while showing If HiddenFollowYou Traveled theIn Plain Drinking On View: the GourdUnderground A Secret by JeanetteMonjo. StoryUnderground Railroad of Winter. Quilts by andRailroadEllen the Levine. by Jacqueline 1. Tobin. endDrinking of this Gourd". chapter. Information isDiscuss on the theweb origin sites andlisted meaning at the of the song, "Follow the Minty: A Story of Young Harriet Tubman by Alan Schroeder. 3t0T9tell. tri5 byTell Julius an African-American Lester or Jump on story Over!: from The The Adventures Tales of Uncle of Brer Remus Rabbit Brill.ett21 Board using1101101jRecreate large the thestars. Dl'inkin9Big List Dipper titles GoiTc constellationof books or names on a black of conductors background of by Joel Chandler Harris. the Underground Railroad on each star. 199 Gliat to GaDeo aria Actlyttio MaterialsUricteTvotrg Railroad /secretCardboardWallpaper books Code Quilt Interactivewww.headbone.comEscape to Internet FTeeion game ]derby about the Underground Railroad. PencilsGlueScissors12" X 18" Construction paper Multimediahttp://quest.arc.nasa.gov/ltc/special/m1k/drink.htmlFollow the presentationDri.rikirly G,ourct of "Follow the Drinking Gourd". Directions usepatternswallpaperAsk the a wallpaper patterns such books as founda orto wagon departmentthe on library. wheel,the book Onstorea logjacket cardboard, tocabin, donate of Secret and pre-cut outdated a toshoofly, Free- quilt or Guest Speaker itsInvite heroes a storyteller and heroines. to tell about the Underground Railroad and constructionsecretusingdom. Children thecode patterns quilt. paper will The to totrace create makechildren and theiran cut mayindividual shapesan glueunderground fromthe quilt shapes wallpaper or torailroad/ to a large Arra() Recovallgo Follow the Drinking Gourd by Rabbit Ears. MaterialsDitliktrig thepiece library. of butcher paper to create a large quilt to display in onct Couteltation Steal"Get OnAway: Board" Music on Chooof the Choo Underground BoogalooReggie Harris.Railroad by Buckwheat by Kim Zydeco. and Directions BlackCreateSelfDark markeradhesive blue the constructionBig silver Dipper stars constellation paper using star stickers on Victeoz Harriet and the Promised Land. (8 minutes) "gourd".dark blue paper. Draw lines between the stars to create the 200 Xel) Site www.Lyrics contemplator and History .comof "Follow /folk2 /gourd.htmlthe Drinking Gourd" http://questarc.nasa.gov/ltc/special/m1k/gourd2.htmlExplanation of Lyrics of "Follow the Drinking Gourd" XIACtirilitt? www.nationalgeographic.com/railroad/main.htmlNational Geographic's "The Underground Railroad" Books to share ArtTheCam Fraud Case Jansen Detective of andthe Climbingthe by Mystery Anna Cat Nilson. of by the Cynthia Gold Coins Rylant. by David Adler. 2Tofe0Otorlai. Resources QuiltingGonna Sing Activities My Head Across Off! theby WendyKathleenCurriculum Buchberg. Krull. (Grades 1-3) by DetectivePrivate I.Mole Guana: by Robert The Case Quackenbush. ofLaden. the Missing Chameleon by Nina JUMPThe TalesOn Over!: of Uncle The RemusAdventures byFamily Julius of Brer Lester. by Rabbit Joel Chandler and His Harris. Books to show. and Book-talkEek:This StoriesGum for To Hire Make by YouBruce Shriek Hale. by Jane O'Connor. pecoTattor10 GiveNate theeach Great child by a smallMarjorie magnifying Sharmat. glass. Riddles Q: What happened to the kid who ran away with the circus? A:Q:A: A WhatcrimeThe police dowave. you made get whenhim bring you crossit back. an ocean with a thief? 201 (SungDetectives to the 50/19tune of "McNamara's Band") Reader's pleat Te Theater"The Forty for Thieves"Elementary in MulticulturalStudents by Suzanne Folktales: I. Barchers. Readers We'reAlthoughAndOh-h-h! we the comeWe we'refinest are from fewthethere the detectivesin cannumberlibrary. be. bag.Props:(By'ho LeilaTook Library Raven The book Parrish.) hook covered FT012 in brown The paper Library from a Shelf? grocery Oh-h-h!WeAndWe'llOn always when findthat youyourweshout findcan lost HURRAH! beit, item, sure. ReaderunlessStage Direction:they 1: (Holding are reading. All book) readers Who have took their the backbook tofrom the the audience library WeWheneverAndThe alwaysaredrumsthe thehorns weshoutgodetectives findtheybang HURRAY! it,blare and theaway. cymbals clang, libraryReadershelf? shelf? (Taps 2:Who Reader me? 2's shoulder) Did you take the book from the YesAIt's credit all sirree! so to grand the Library! to see. ReaderReader 2: 1:1:YesNot Then me. you. who? (Hands book to Reader 2) fromReaderReaders the 2: library1 (Taps & 2: shelf?Reader 3's shoulder) Did you take the book Who took the book from the library shelf? 202 Reader 3:Who me? Reader 2: Yes, you. Reader 2:Then3: Not me. who? (Hands book to Reader 3) Materials(Adaptedntriny Pi from 74 Make op .nagnets Yourself a Monster by Kathy Ross.) audience.ContinueReaders 1,2,3: until onlyWho the took last the reader book has from his/her the library back to shelf? the WhiteWigglyGlueWooden shoelace eyes ice cream spoon Lastfrom2"' to Reader: theLast library Reader: Who shelf? me?(Taps last Reader) Did you take the book Directions theCoverSafetyStyrofoam shoelace bothpin ortray sides aroundsticky or of wax back athe wooden paper entire magnet spoon withso that glue. it looks Next, like wrap a TN..)14=t, Last2" to Reader: Last Reader: YES, IYes, took you.the book (takes book) from the themummy. spoon SeparateTuck on the the opposite theend shoelace of theside lace orslightly front under ofon on thethe the mummy.small back end of theof Alllibrary Readers: shelf! Yes! You? Couldn't be. styrofoamshoelacesout.magnetAttach Rub gluetwo intotray. place.the wigglyover When back. Letboth eyes the the sides glueso mummy that of is thedry,they dry mummy addappear on a waxsafety toto bepaperhold pinare the orpeeking LastAll Readers: Reader: ForCould YOU!WHO? too. (Hands book to Librarian) www.pitara.com/activities/craftionline.asp?story=111MakePetecth'e a toy 2OTIZCOF0 periscope following the directions at 203 * Look around the library and findit down. a good place to hide. Write Activities The501Veandkids.mysterynet.com/ Mystery magic a 71.90terg Net'stricks. Kids Read Mysteries features some of mysteriesweb the sitemysteries at to http:// solve, and scary ask the stories, * Find something that is livingWrite and them something down. that is dead. www.geocities.com/logicSelectLodechildren "Puzgeslogic to solve puzzles them. for the puzzler/. kids to solve at Mystery Masters at Guest Speakers StorytellerInvite a Police to tell Officer detective to fingerprint and mystery the stories.children or invite a crayon.GiveDetectivetheir each guideAn child oldSeayetigeT for crayon a the piece scavenger broken of Holtpaper in hunt halfor a andwill notebook, directwork best.them a pencil, Act to do as and the a Iftelp Sites www.kiddonet.comKIDDONET Detective Game following* Step out questions, into the orcheckout make up areadowneyes, your of and atown. the least listen library, three for closeasounds moment. your that Open you heard. your eyes and write Mysteryhttp://kids.mysterynet.com/MysteryNet'swww.geocities.com/logic Master Kids Mysteries puzzler/ * DrawAreFind there three the shapeplants items of inand leafthe make library?you likethreemakedifferent Writebest. "mystery a mystery Why downkinds is rubbings".ofhow itrubbing, leavesyour many favorite? can placeTo you a see? sheet of paper over an CD R0.71.0 Detective Barbie. suggestatheobject number object and possible ofbecomes rub appropriate it items. gently visible. with items Note: a oncrayon Librariansa table until for themay the outline childrenwish to of setor 2Tofezotoral ReSaTTCOO Kids Create by Laurie Carlson. * Think of two clues apiece torubbing.rubbings help people are. Write guess downwhat the clues underneath the mystery 204 MulticulturalMake Yourself Folktales: a Monster Readers by KathyStudents Theater Ross. byfor Suzanne Elementary I. Barchers. 216 Super He To h[taz VoTct Search

Circle these words in the puzzle below:

SUPERMAN CLARK KENT WONDER WOMAN DIANA SPIDERMAN PETER PARKER HULK BANNER BATMAN BRUCE WAYNE CATWOMAN SELINA KYLE

S U P E R M A N I C P E P E H U L K E RL M LA TS A BATMAN I B E AB A N N ER S N T RDI ANASKP A M P A M S P I D K I T WOMAN ED YBRUK C A CEWAYNE L C K A TWOMA TR EN EWONPEDRM O S R U PEFMZVA W O ND ERWOMAN

206 217 .71.11.k Carton craft

open top of cut edges milk carton B & D to 2" from the bottom

fold fold flap back flap back

push in-- 11 I < push in

mouth draw a face and a body

207

218 Dog Detectre oTtgapt

208 219

0 1 5F9 House

210 221 Beittetiy9ptrppet 241 naze katiVity

212 223 °4b OD C74 C4D CD di? QD OP 619 Pp O GP OP CID dP L41)., SID 0) ap Ploog o1ArTaisoga 2111-maY9NclosA :01ctigood ttoloollz ntootem Pozonie: 5F9 a b9 AcCTIalla noTe0 andYong ViatoT kiuLt Sala. Programs Book. Young dolt geacang GO* now: G0a1,5 goalsTeens for are the experimenting Young Adult with Reading their Clubindependence. at a variety Establish of reading DOZCTtptiOrl eightOperation: programs Top Secret!for teens includes on topics a Young including Adult espionage, Reading Clubspies, and operation Top Sec Te l levelslevels and are let described them choose below. how they will participate. Three andthieves, superheroes. codes, mysteries, private investigators, strategic games, Gifts winFor eachall three level, gifts. participants Ask local receive businesses gifts. for Teens gift certificates.can potentially Target Age GTotIF ThThis through chapter 12"' is written grades. for Teens librarians who will who be work most with interested teens fromin orderRequest to redeemthat teens the not gift be certificate. required to purchase anything in programsandparticipatingenjoy the teensparticipating are in mostlythat the willprograms 11th in be the andmost programs.are 12th interested the graders. 7111 through in Both assisting groups 10th withgraders will the Lei,*Security 1: Pass Required youngGoal: adult Teens library read event.five books of their choice and attend one OFeTa.tiori: Top Secret! 213 certificateGift: One free from book local from business. the library's bookstore or a gift Level 2: operation: To Secret phoneprogrammer logo. numbers and This it will of interested allowhelp create you teens. to a develop sense of a importance list of names to andthe ArptholizecC ?error al 0111.yyoungGoal: adult Teens library read events.fifteen books of their choice and attend two libraryingMay club, and has distributethe for summer teens. flyers programs, and/orVisit andbookmarks, middle the resources schools discuss andthat the highthe read- schools during the month of certificateGifts: Two from free local books business. from the library's bookstore or a gift judgingtheon thefollowing is library needed. storyweb Participation sitestarter, or on or a Hostinventis bulletin the a reward! shortyour board own.story Post in contestthe short library. stories for Teens Try who visit the library. No HighestopeTa.tiori: MoTity youngGoal: Teens adult libraryread twenty-five events, and books write of a theirbook choice,review attendor enter two Top secret seemafternoonWhen right. Anna after She Marie softball thought entered practice to herselfher house things "What's that didn't cold certificateGift:short Threestory from contest.free localbooks business. from the library's bookstore or a gift Solvehomemissing?"the pictureshadAnna Anddisappeared Marie's hanging then shemystery andon realized the were and walls what replacedsend of it orher was. drop with...families' All off PT0Dottori Totional create bookmarks a buzz about dates the of teen programs summer and events, a separate create calendar promo- of ProvaDo community events in local newspapers.Make friends Invite with themyour the to person/s endinglunch to to....in charge of reporting inandAdvisory eventsaudiences creating forBoards, teensthefor eventsflyers andwith Teen andandcolorful bookmarks.assistVolunteers graphics. at programs. canThey Teen assist also Councils, in become designing Teen built- YALSAreadingtalk about andweb the promotesite teen at www.ala.org/yalsaprograms. it to the paper'sGatherMore statisticseducationinformation about writer. on teenspromotion and of teen programs is on the smallthem aincentive flyer as agift reminder such as about a coolInvite the pencil date teens orof to penthe sign withprogram up the for sum- andthe programsa in advance. Give 214 operation: UT1)all Lege lict0 139 Victor $4111. MeaningsThe CompleteVanishing by Jan IdiotsHaroldHitchhiker: Guide Brunvald. Americanto Toropov.Urban Legends Urban Legends by Brandon & Their Length 50-90 minutes Rrogran Books to Booktatk Alligators in the Sewer: and 222 Other Urban Legends by 2TovaD DezeTtptio Although the serious study of urban legends is relatively recent, SpidersSouthern in Fried the Hairdo: Rat and Modern Other Gruesome UrbanThomasCohen. Legends J. Tales Craughwell. collectedby Daniel and becomesharethethis topic.type urbanpart of This of storyfolklore. electronic program is an integral cultureprovides part through an of opportunity folk web culture sites to devotedand hear has and to retold by David Holt. 6\-.)r\.) ?TepatattOrl Invite a storyteller from the community to present a storytelling TOUF kett.vitgtheAsk top teens five to favorite share their urban favorite legends. urban legend and make a list of recommendedposeinformationprogram and ofplace urban about inin thisfolk legends.the program originculture. Request of Bookmarkand urban createthat legends the websome storyteller andand of theirthebook webinclude pur- bibli- sites Vel,--13azei Act cities Thiswww.urbanlegends.comThe is AFU a subject & Urban guide Legends to urban Archive legends that teens will enjoy ographies. www.scambusters.orgInternetsharing withScambusters their peers. Books to 1]isp[a9 The Big Book of Urban LegendsRobert by Robert F. Boyd, Loren Jr. Fleming and 215 categoriesends,A free and e-zine scams.and on share. internetLet teens fraud, pick computertheir favorite crimes, example urban in leg- these Thiswww.usnews.com/usnews/doubleissue/mysteries/great.htmU.S. site News lists Online various Mysteries hoaxes andof History mysteries that will interest OpeTattori: Poetr9 SIAT2! knowledgeteens. There of is mysteries. a link to a quiz teens will enjoy that tests Length 4 ?ToyTa72 50-90 minutes Victor kucao Records rlY Spiders in the Hairdo: Modern Urban Legends by David Holt. Provan Invite local poets to the library to discuss writing poetry, to 1)Videos TO? e001011a.1 Resource I StillKnow Know What What You YouDid LastDid LastSummer. Summer. (101 (100 minutes) minutes) summer.ownmayread frompoems.read poemstheir If possible,works, by published and host to severalmoderate poets and/orpoetry a poetry writeevents slam. and during readTeens the their Edwards.Teen Library Events: A Month-by-Month Guide by Kirsten ?reparation agevariousprovideArrange teens poetrycoffee, the to bringmeeting anthologiessoft their drinks, area own in fromand poetry.an informal,snacks which forteens coffeehouse the may Slam. read. Select style Encour- and DecoTatioDs Display poems and pictures of poets. 216 Books to Booktatk nagaztrieZ Aloud:YouThe Rose HearVoices ThatMe?: from Grew Poems the From Nuyorican and ConcreteWritingBetsyAlgarin. Poets' by by Franco.Teenage CaféTupac edited Shakur. Boys by edited Miguel by TeenCicada. Ink. Books to Display Angst!: Teen Verses From the Edge edited by Karen Tom and www.freshangles.com SlamPoetryHow toedited Slam: Write by The Poetry Cecily Competitive by Von Paul Ziegesar. B. Art byKiki.Janeczko. ofGary Performance Mex Glazner. Poetry edited Atka° Recordings The LanguageRose That ofGrew Life: From A Festival Concrete of Poets by Tupac by Bill Shakur. D. Moyers. A Teen Writer's Dream, PoeticallyWright. Correct edited by Kristine Videos ActivSlamnation.PoetryFooling in with (92 Motion. minutes) Words (90 with minutes) Bill Moyers. (120 minutes) anthologiesEncourage teens and/or to magazines. contribute originalInvite teens poetry to forcontributeittez publication original in poetry. Compile the XelD 3tte0 Poetic License Online Poetry Journal poemsyoungerpublications.library. into Post childrena notebook themLet them aton the forthe present library displaylibrary's a and/orInvite children'sin web the thecommunitysite. teen teens poetry area to at festivalselect center. the children's for poems from various Austinwww.austinslam.com/www.itvs.org/poeticlicense/youth Poetry Slam poetry.html reading events at local schools duringEncourage the comingteens to school volunteer term. to plan and produce poetry 217 www.poetryslam.com/Poetry Slam Incorporated operation: ?tick It Up! DeCOV,310/10 Create a display of humor hooks. Reproduce some jokes and Le Nth o One hour 2TogTaD 1)9 VigtoT Sabi It Books to Dtop[a9 riddles on poster boards for a display in the library. 2TovaD DeocTiptio Invite the teens to the library to participate in a humor festival 3650101 Jokes, Spanish Puns, Riddles: & Riddles Understanding by AnneFoxgrover,Culture Kostick, Spanish Through and Charles LanguageMichael Humor J.by and Pellowksi. Rafael Falcon. applause.andjokesin which choose that they make a first, compete you second, groan. by tellingand The third audience puns, place shaggy will winner judge dog by tales,the general tales and Jokes,Giggles, Puns, Gags and Riddles& Groaners by David by Joseph Allen Rosenbloom.Clark. 2Tepa.11.-tiov. Advertise the "Yuck It Up" humor contest in advance and Books to boottaLk Ha!FunnyGreatest Ha! You Ha!: JokesShould 1,000+ on Ask: Earth Jokes, How by Riddles, toMattwith Make Rissinger Wordplay Facts, Up Jokes and and by andMore PhilipMarvin Riddles by Yates. Tertian.Lyn Selectandingidentify materialin funthe and teenprizes displayfor area. the such contest.humorSelect as a fruitcake abooks Place teen orthatsigns oradult teensa throughoutmoonpie emcee can use for and the forthe RC library select-event. cola KeepHa! Ha! em Ha!:Laughing: Over 400Jokes Very to Amuse Thomas.FunnyMik andBrown,Jokes Annoy by and Tim Your Tania Archbold, Friends Hurt-Newton. by summerperformanceforhumorlibrary the winning program. conteststo sign-up for contestants. the over as general contestants.the summer. Encouragecommunity Consider Encourage teens at the having who endthe visitteens ofseveral the the to have a Louis Phillips. 218 < ac;20 CC> co <70 ap qtz) dc, 0:7 OC) 40 CIO 6t7 Qt) Qb at, 6C7 dc, pc, 2triitatt9 Here is an example of an announcement to publicize the event. nagaztrie Mad. storiesThegroanerUp Festival. will story. feature This The contestants festival audience of willgroaners,attempting determine puns, to tell the and thewinner shaggy worst by dog Library invites you to the First Annual Yuck It Video The Best of Saturday Night Live: Classic Years 1975-80. (93 walksthe mosthome boos with and Bronx cheers. The first place winner . , the second place with , and third MontyThe CarolPython's Burnett Flying Show: Circus: A Reunion.Volumeminutes) 13. (90 (60 minutes) minutes) Festival!place with Come have a laugh riot at the Yuck It Up Vel) Sttez BigPuns.comRosie O'Donnell's Kids Are Punny. (30 minutes) Acttritte0 sign-updisplaycomposeInvite teens usingto their select to the collectown aexamples. "Tom examples, examples Swiftie" Also, and of of"Tomask to the create for daySwifties" teens afor bulletin to a rotatingvolunteeras well board as to http://funandfunny.homestead.com/FunandFunnywww.bigpuns.com/ saying.betweenhumorcreateddisplay. by ForbyA the using"TomEdward example, speaker anSwiftie" L.adverb and "Stratemeyer 'I theknowis to named import establish who (1862-1930),for ofturned "Tomwhata punning off theSwift", the speakerand relationship lights,' acreates character is Tom its www.PuzzleTom puzzles ParadiseSwifties .cwc.net Page"Tom at /tomswities1.htmlSwifties" Thinks.com hintedeventate for darkly." for younger youngsters children at the and library. planEncourage and produce teens a tofunny select joke funny riddles and jokes appropri- http://thinks.com/words/tomswift.htm 219 OpeTatiori: Teeri Coco RatcteTS Victor SCULL. Books to Display HowCodes, to Keep Ciphers, a Secret: and WritingSecret Writing andElizabeth Talking by Martin James in Code Gardner.and by Carol Barkin. Length o 50 90 minutes "ProvaD LearnThe toJoy Sign of Signing:the Fun Way:The Illustrated Let withLanguageYour Games, FingersGuide and forPuzzles, Do the Mastering the Manual Talkingand Activities AlphabetSign in by American Lottie L. Sign Riekehof. 'PrOgiaap DeSCTIFt1011 Not all codes are intended to be secret. In this program, teens Language by Penny Warner. N.)CA)TJ signlearn language. about communication through Braille, Morse Code, or 30010 to Booktatk RadioOperatingCode Breakers: Rescue Codes by From byLynne NickHieroglyphs Barasch. Manns. to Hackers by Simon Adams. ?reparation librariansstrateInvite Braille,qualified may Morse use individuals the Code, suggested andfrom sign web the language. communitysites and Asbooks toan demon- alternative,to present G,TorlD kettritteo alphabetLet teens or learn practice to sign sending their firsta message name usingby morse the sign code. language an introductory program. EachGivecontaining pair a prize will a standtoshort, the in firstsimple front teen ofphrase. to theForm "read" others Let the it them teenscorrectly.and signlearn into their pairs.to sign phrase. Give it. each team a piece of paper Decorations societyanCreateDisplay adventure afor examplesdisplay an storyancient based of in Braille, artifact whichon the themorsemovie,possessing heroine code, Lara greatmust andCroft: signpower.battle Tomb language. a Ask secretRaider, teens board"Your andmission have is a tocontest read." to Display see whoAcronymCreate the can messagea secretbe Challenge. the code firston the tomessage Ask bulletinsolve teens it. such to asfind "Reading the meaning Is Fun" of orthe medievaltombs,to help pyramids,createcastles, the and display,hieroglyphics, gargoyles. using pictures, runes, astrological for example, symbols, depicting 220 www.ucc.ie/acronyms/DOS,following UNCLE. acronyms: Direct CIA, them and OSS, toto booksthe NSA, Acronym in MI6, your KGB,Databaselibrary CI, to FBI,atlocate IC, the American Foundation for the Blind Braille Bug Site Ve1DBased Act tyttiez againsttoothpickanswers.message a hot or on smalllight paper. bulb brush After and into theread the juiceLet the juice teens message.dries, to squeeze write they anhold the invisible thejuice paper of a lemon onto a plate and dip a kidio R,ecolicijigo http://ac6v.com/morsepages.htmwww.afb.org/braillebugThe Morse Code Pages PuzzleBuilder.html.Marshallpalindrome,Createhttp://kids.msfc.nasa.gov/Teachers/WordFindBuilder/ Spacea puzzle cryptogram, Flight using Center such espionage, Wordwords Find as: spy, anagram, Pii77,1e scams, Buildercipher, hoax, code,secret, StormbreakerBlueYour Avenger Introduction Cracksby Anthony to the Morse Code Horowitz. Code;byAmerican Norma Morse Howe. Radio Code PracticeRelay League. by puzzlessolve.spyplane,message, Let to agent,teensswapmissile, andusecamera, jamesbond. thesolve. web gadget, site Print tomission, create and distribute theircomputer, own wordfor false, teens to VicteoTeco:cctinv Antitrust. (108 minutes) Teenswww.odci.gov/cia/ciakids/index.htmlCIA's Homepagecan follow for the Kids links to codes and word puzzle activities. IndianaBreakingLara Croft:Jones the Code. andTomb the (90 Raider. Temple minutes) (102 of Doom. minutes) (118 minutes) lie13 5ttes Teenshttp://blackdog4kids.com/games/word/martin.matrio/BlackDog's use this Anagram fun web Creator site to create and solve anagrams. www.ucc.ie/acronyms/The Acronym Database 221 www.historic-uk.com/HistoryUK/England-History/ \i/10 5toLe ActlianaopeTatton: gores be C1101411 Jesite[s? 14ealtt of theColonelBlood.htm.this "Who program Stole to thehelp Crown teens Jewels?"brainstorm.InviteLet teens members Planning create aofSheet new the atcommunityculprit the end to steal to attendthe crown the playjewels. and Use let Length 10 hours Workshop: 1 hour 2TogTai2 the audience guess "whodunit" before the culprit is revealed. Performance:Rehearsal:ProductionWriting: 2-3 2 (props, hours 1 hour etc): 2-3 hours DecoTattoris program,Jewels?"questionPlace pictures marksondate, the of time, surroundingbulletin the Towerand hoard. location. of the London, Include words "thea Whodescription crown Stole jewels, the of theCrown and "PrograD DeocTLF-tioD triesTeens to write, discover produce, who stole and theperform missing a play crown in whichjewels. the audience Vartattoi Thecopies library on staff the library's writes the web mystery site and in inadvance the Teen and Department. displays PTeFaratioD Invite someone from the community, such as an English receiveonelibrary'sThesummer. forlibrarian theall web of correctClues site.thegives clues, Teensare and teens placed oneplace are one foreligible intheclue the the names perincorrect Teento weekparticipate of Department those guesses.throughout whoin two After submitand theraffles, on teens the atworkshopplaywriting.teacher, the end or ofbaseda localAlternately,this onprogram. playwright titles librariansin the to BeginofferProfessional may awith brief develop a workshopof Resources history and host onof section the a British Crown Jewels and theofentries incorrectthe summer raffle with names tothewith "unveil" name incorrect in another of the the entries.real thief raffle. thief, in Host Giveone the araffle, a winners,party gag andgiftat theand tothose theend distrib- withwinner of modationCrownColonel Jewels".Guide Thomas for For England,Blood, details, known Scotlandsee The as History theand "Man Wales and who webHeritage stole site attheAccom- 222 pected"ute the raffle or "Mystery prizes. Role-playingPerform Game: the The "Readers' Body in Theater the Program: Uncover the Unex- theClubBilliard Texas and Room" ProgramState fromLibrary Manual No and Limits by Archives Lisa Read: Youngblood Commission.Young Adult published Reading by Pliofe00torial R.e0ot7rCe0 No Limits Read: Young Adult Reading Club and Program 1500k0 to DifiFIA.9 How to Steal the Crown Jewels by Nicolas Green. Putting On A Play: The Young Playwright'sGuthrie.Directing,Manual by andLisa Guide Performing Youngblood. To Scripting, by Nancy Bentley and Donna TowerThe Queen's Of London: Jewels: The The Official Personal GeoffreyLeslieHistory Collection Field. by Parnell. Edward Of Elizabeth Impey and II by PuttingWriting On Your A Play: Own A Plays:Guide Creating,To NeighborhoodWritingCarol Adapting, Korty.And Producing Drama Improvising by Susan by and Stephen Judy. Atictto Recording Film Music by Maurice Jarre. Vtdeoz Treasure! Jewels of the British Crown. (50 minutes) Xel) Site ScotlandColonelBlood.htmwww.historic-uk.com/HistoryUK/England-History/The History and Wales and Heritage accommodation guide for England, 223 Vho Stole the GTowli jeveL,s?" Ramit215 Sheet

Time Period-

Plot:

Clues: 1.

2

3

4

5

6

Pozonie Cast of Characters

King Description:

Motive:

Queen Description.

Motive:

Princes/Princesses Description:

Motive:

Palace Guards Description:

Motive:

224

236 Jewel Guards Description-

Motive.

Soldiers Description.

Motive-

Yeoman Description.

Motive.

Maids Description:

Motive.

Servants Description.

Motive.

Foreigners "Traitors" Description.

Motive.

BEST COPY MI LE

225 237 opeTa.tiori: Superheroes aricC Conte Book Vizil List If I could buy the top ten best comic books for the library, they Japanese by drlana Flores IeaTc art Exhibit 2.would1. he: Length ,of PTogran 50 minutes .._. 6.5.4.3 2T051.1.2:, bookstore,Invite representatives or invite a localfrom acartoonist local comic to the book library store to or present regular a DeOCTLFtLOD 9.8.7.10. basedexhibitinventively.comicprogram onbook in onthe the popularcharacter, Asktopic teen teen ofsection comics. theartists developing program. of to the bring library, a story a drawing or line, hold or and a drawing contest host an art Possible topics are: developing a Variation If your city does not have a comic bookstore or a bookstore, pTepaTattorl * Schedule the time and date and invite a presenter at least triviaaboutinvite contest,withteens others. to "Behindbring Begin their the thefavorite Mask?" program comics at the with end to the share of comic the and program. book talk * IfCreate your alibrary bibliography does not of have comic attwo-threea comic yourbooks library. book andmonths comic collection, in advance.book createseries Books to Dtopta9 Batman:Creating The The Ultimate X-Men: Guide How Comic ToBeatty. The Books Dark ComeKnight To by Life Scott by * Recruit teens to create a displaya "Wish to advertise List" and let teens suggest titles. program. 226 Dragon Ball Z. Vol. I. Story andJames Art by Buckley, Akira Toriyama. Jr. How to Draw Comics the MarvelBuscema. Way by Stan Lee & John Video Rea°T CR119 StarSpider-ManSailor Wars. Moon Episode Volume 2 by Naoko II, 1 Attackby Takeuchi.Stan Of Leeby The Georgeand Clones Steve Lucas; based Ditko. written on the storyby R.A. Salvatore. Superman.Spiderman.PrincessThe Castle Mononoke. (151 (121 of Cagliostro.minutes) minutes) (133 minutes) (109 minutes ) The Superman Madman Hullabaloo!Allred. Story and art by Mike nagaztrie0 Wizard. Books to Booktaik UnderstandingManga Mania: HowComics: To DrawThe Invisible JapaneseHart. Art Comic by Scott by Christopher McCloud. Wizard Anime Invasion. Velp Stte0 BBC's The Science Behind Superheroes Game: Are You a ?To. e00joial. Resource The 101 Best Graphic Novels by Stephen Weiner. www.bhc.co.uk/Superhero?http://ublib.buffalo.edu/Iml/comics/pages/Comic Books forscience Young /hottopics Adults: A/superheroes Guide for Anime Librarians /index.shtml for librarians DCThewww.dccomics.com/ Comics Librarian's Guide to Anime and Manga Marvelwww.marvel.com/www.koyagi.com/Libguide.html Comics 227 Match the Superhero with The Correct Alias Col* Book DI:1'1a Go Dten 13e14214 the .,ask? Go* Book TTIVia Coriten: Behirld the naok Superhero1. Wonder Woman a. JonathanBehind the "Johnny" Mask Storm Superhero A/1014teT Keg Behind the Mask 5.4.3.2. RobinSupermanBatmanSpider-man e.d.c.b. RobertNathanStevenMatthew GrantBruceGrey Michael RogersBanner Murdock 4. 3.2.1.Superman WonderBatmanSpider-man Woman f.g. Clarkm.Petern. DianaBruce ParkerKent PrinceWayne 14:1%..) 9.8.7.6. InvisibleDaredevilIncredibleWolverine Woman Hulk i.h.g.f. MayClarkPeterNorman "Mayday" ParkerKent Osborn Parker II 8.7.6. Wolverine5.DaredevilIncredible Robin Hulk d.k.1. DickLogane.Matthew Robert Grayson MichaelBruce Banner Murdock 13.12.11.10. CaptainSpider-GirlGreenX-Man America Goblin j. Susanm.1.k. DickLogan Bruce Storm Grayson Wayne Richards 12.9. I10.Invisible Captain1. X-ManSpider-Girl WomanAmerica j. Susanb.i.c. MayNathanSteven Storm "Mayday" GrantGrey Richards Rogers Parker 14. Who are the Super Friends? Human Torch n. Diana Prince 14.13. HumanGreen Goblin Torch Q: Who are the Fantastic Four? a.h. JonathanNorman Osborn"Johnny" II Storm Who are the Fantastic Four? A:Q: Superman!Mr. Who Fantastic, are Batman!the the Super Thing, Wonder Friends? the HumanWoman!Girl Torch Aquaman! and Invisible The 228 Wonder Twins! Wendy! Marvin! Wonder Dog! Operation : .71.90-teTy Book Dizetrssiori DiscussionNeed to Know, by Rachel from Choosing W. Jacobsohn Members or a to similar Leading title to kitaza. noTez Heard * PurchaseCreate posters notepads and fordisplays teen learnparticipants andthe howprograms.titlesadvertise to that orlead askwillthe a abook program.be local discussed discussion news List and group. the dates and times of PTOVaDLogth of De0CTIFt1011 1)Tova1 Four programs of 50 minutes in length. * Let Teen Volunteers or Teen Advisoryfun.setpaper of rulesor businessBoard to make help to the donatedevelop book them. discussionsa productive and andGame.theHost summer. a a notebook Participatingmystery Begin booktwo the teensweeks discussion book receive before discussion series a thecopy first everyseries of bookThe otherwith Westing discussion. Theweek Westing Gameduring Decorations willCreate read. artwork Copies inspired of book by jackets the jackets may be for viewed the books or downloaded the teens thetheyAfterdiscussion book. think reading TheyOn "did andtheeach mayit" asksday orchapter, also predictofteens thewrite teenstoprogram, what shareany write willthoughts who the inhappen theytheirlibrarian they thoughtnotebooks at have the begins endaboutwas whoofthe the includefrom amazon.com. the artwork Makeand a posterssnappy andsynopsis bulletin of theboards plot. that culprit at various points during the book. Recoppericiect books to DiscussHauntedThe BodyDark Sister Sideof Christopher of by Nowhere Lael Littke. Creed by Neal by Carol Shusterman. Plum-Ucci. PTIDaTatt011 * TheChoose book dates discussion and times series for begins theavailable.Select program. with three The additional TeenWesting Advisory books Game. for Board which and multiple Teen Volunteers copies are LockedThe Killer'sWesting in Time Cousin Gameby Lois byby Duncan. NancyEllen Raskin. Werlin. * Read or review The Readingpurchasemay Group suggest Handbook: additional titles. EverythingRequest paperback additional You copies. copies through ILL or 229 VtcLeo Murder by Death. ( 94 minutes) www.readerville.com/[email protected]@.f024863Readerville-Young Adult Reading Group Sites Operation: Board Gar eo by Actrialia foxes Heard Video GA Deo Nancy Drew Message in a Haunted Mansion. 1)TogTaT2Ler 156 of DeocTipt10/1 2TOVan 2 hours profesztorial Resorme The Reading Group Handbook:fromJacobsohn. Choosing Everything Members You Need to Leadingto Know, Discussion by Rachel W. Winnersgames,suchinSchedule the as library diceChess, receive a game games, meeting Checkers, candy day dominoes, orroom as evening Clue,prizes. or teenMonopoly, Chinese eachAt area. the week endTeensCheckers, Scrabble, duringof playthe program,theUno, gamesand summer Risk.card createboardcharades,atthe least entire games,a onesense orgroup game Pictionary. soof receivescommunity.games everyone thatTeens candy. playsinclude seem Rotate together everyoneto staythe such playersin aretheir as important bingo, and/orclicks withhave to PTer.Tatioll favorites.Buy popular board games and/or ask teens to bring their 230 ?ToDottori andCreate include a flyer a catchyadvertising phrase the such date as and "Don't time beof Bored.your programs Play Board Games on Wednesdays from 1-3 p.m. at the Library Branch!" I HateThe IncredibleCharades: IndoorAnd 49 Games Other Book:New Games 160 Group by Phil Projects, Wiswell. Games Vattatiov. Focus on one type of game like chess and have a tournament. WOO R000TCC1110 and Activities by Bob Gregson. andcandyoneOr, playweeksmall for a andthepeanutdifferent playingcheckers butter game pieces, orcups. eachdominoes forDraw week. example,Checker athe Forboard next. example games peppermint game are onplay easyposter pattieschess to create. Buy different types of 'help Sites Yahoo-GamesChess Starts Here! (60 minutes) 130010 to Dt0F1.3.9 board. Teens who win a series of games get to keep the candy. IfTeenshttp://games.yahoo.com/ toregisterparticipants choose play for games from. a are family forBoardunder free account. thegames by age registering Thereinclude: of 13, are parents asBackgammon, a membersbroad must range offirst Yahoo.Checkers,of games TheCompleteChess New for CompleteJuniors:Idiot's Guide A Hoyle, Complete To ChessRevised: GuideM. by Snyder. ThePatrick for Official the Wolff. Beginner Rules ofby All Robert Reversi.Chinese checkers, Chess, Dots, Go, Naval Command and The New Games Book: Play Hard,AuthoritativeeditedMorehead,Popular Play by GamesFair Andrew RichardAdvice Nobody of SkillFluegelman. onL. HurtWinningFrey, and ChanceGeoffrey Play with by Mott-Smith. Alfred the Most H. Pliofe0Otorial Resources Games Galore for Children's Parties and More: 80 Fun Games OccasionsCarnivals,and Activities byCompany Sharifor Parties, Ann Picnics, Pence.Classrooms, Rainy Days Youth and Groups, Special 231 Teerl Zone E.eacteTZ f or GTacCe$ 6.6 up! _de\

232 BEST' COPYAVAILCBLIE 4. 4 .71,1zotoi "P000nie: 5F9 a 330010. BIBLI0GREPHY op 62 aP ao Cti7 nizotov. Pozotue: spy a Bo Biiitogica p119 Keybooks to abbreviations for age recommendations: TheNavahoAaseng, role CodeNathan.of the Talkers. Navajo Walker, Indians 1992.in World (I+) War(OP) II is described in P=T=Y=I= PreschoolToddler Elementary Young Adult DanielsAda,detail. Alma Mystery Flor. Egg. Green Light, 2001. (P) L=interest.+ for = "and the Librarian up" All ages above the one listed will find the book of LaAAda,In gallinita, roosterthis Alma Level andel Flor. gallo2 a Green hen y findel Light frijol. a bean Reader, Hampton-Brown, on theirDaniel walk. finds 1992. a lizard (T-P) egg. Aardema,throughNote: Titles interlibrary Verna. marked loan.(OP) are out of print and may be borrowed TheElAda, gallo Rooster Alma que Flor. Whofue a Went la boda to His de suUncle's ao. Putnam, Wedding: 1998. A Latin (P-I) American howlingABorreguita little lamb underneath yand elnamed thecoyote. Coyote. theBorreguita Scholastic, moon. Knopf, outwits 1993.1991. Coyote (P-I) and sends him ding.ingAFolktale. cumulative in the Putnam,cleaning tale 1998.in of which Rooster's (P-I) the sunbeak sets in timeoff a forchain his ofuncle's events wed- result- 233 ThisandTheAda, porquoi Spanish.Lizard Alma taleFlor.and Doubleday, setthe inSun ancient / Lagartija1997. Mexico (P+) y el is sol: the Astory Folktale of a lizard in English who JoinAhlberg,Treasure in the Allan. funHunt. of Candlewick,a treasure hunt 2002. in this (T &delightful P) picture book. A OlmoAda,searcheslittle Almaboy y la for tries mariposa Flor. the to sun. catch azul. a butterflyLaredo Pub. that Co.,flies 1992. in and (T-P) out of his bookToddlersSeeAigner-Clark, and in theSpy and Baby Shapes preschoolers Julie. Einstein (Baby Series.Einsteinwill enjoy Books). pointing Hyperion, out the shapes2001. (T) in this Adams,windowCode Breakers: Simon.and all through From Hieroglyphsthe town. to Hackers. Dorling Kindersley, Angels(P-I)bicicletaAlarc6n, Ride yFrancisco otrosBikes poemas and X. Other de Otorio.Fall Poems Children's /Los angelesBook Press, andan 1999. en 2002.Discusses (I+) secret codes throughout history. FromAlarcon,One of the four FranciscoBellybutton bilingual X. poetryof the Moonbooks andthis Other award-winning Summer Poems poet. / Del JansenthiefAAdler, Cambox in David.camera seriesJansenthis Cam for and Jansenthe thegold beginning Mystery coinsAdventures disappear of reader. the Series. Gold as Coins.CamSee also tries Puffin, the to Youngcatch 1998. the Cam(I) poet,Summerombligo1998. Alarcon. (P-I) deis thela Luna focus y ofotros this poemas poetry collectionde verano. byChildren's award winning- Book Press, book.ChildrenEachAhlberg, Peach spyJanet. Pear nursery Plum. rhyme Penguin, characters 1999. in (T) this lift the flap board Hidepage.YoungAlborough, and Seek.readers Jez Candlewick, search for animal 1999. (Tfriends & P) underneath flaps on each Peek-a-Boo!PeekAhlberg, through Janet. Viking, die-cut 1997. shapes (T) in the pages of this board book. States.AAloud:Algarin, collection Voices Miguel. of from poems the by Nuyorican Puerto Rican Poets' authors Café. H. living Holt, in 1994. the United (Y) 234 ID DiggingandDescribesAliki. provides Up Dinosaurs.how facts fossils about Crowell, are dinosaurs. discovered, 1988. (P preserved & I) and reconstructed, baseballTracesStoneAnholt, the Girl,player Laurence.life Bone of and a manGirl: as a whosecretStory managed ofagent Mary during twoAlining. successful World Orchard, War careers II. 1999. as (P a & I) DinosaurTellsAliki. the Bones. story Harper,of dinosaur 1990. bones (P & and I) how we learn about dinosaurs. Archbold,tionsA fictionalization of a dinosaurTim, Mik of in MaryBrown, England Anning's and in Tania the discovery early Hurt-Newton. 1800's. of fossils and excava- smallestAAllen, Whoseries Pamela. Sank ofone animals climbsthe Boat? climbaboard. Paper into Star, a boat 1999. until (T) it sinks after the last and Ashton,whenAHa! collection Ha! he Christina. Ha!:coughed? of Over riddles 400Excuse andVery me,jokes Funny I'm such justJokes. as a "Whatlittle Kingfisher, horse". did the 1999. pony (I+) say ClassicStorytellingAnderson,(L) book Paul with of S.simple the Flannel flannel Board board Book stories One. and T. patterns. S. Denison, 1963. ProvidesMessages.readersCodes andthe canBetterway, Ciphers:history make andbehind 1993.Hundreds use (I+) codestheir of own Unusualand secretciphers and codes. andSecret explains Ways howto Send Storytelling(L)Anderson, with Paul the S. Flannel Board Book Two. T. S. Denison,1970. WhenIAuch, Was aBrian'sMary Third Jane. Gradedog Arful Spy. suddenly Holiday beginsHouse, talking,2001. (I+) Brian and his two TheAllred,Classic Superman Mike,book of Laura Madman simple Allred flannel Hullabaloo! and board Sean Konot.Darkstories Horse and patterns. Comics, 1998. Baca,forfriends the Ana. schoolsend the talent dog show. to find out what their classmates are planning Andryszewski,Superman(Y+) and MadmanTricia. collide with each other. Benito'saasAs magical "bizcochitos", they Bizcochitos prepare butterfly to Christina's /Los makefirst bizcochitos introduced the grandmothertraditional dethese Benito. Christmas sweet tells Piñata, her treats cookiesthe 1999. to story her known(P-I) ofgreat how Amazing(I+) Life of Moe Berg: Catcher, Scholar, Spy. Millbrook, 1996. 235 Anthonygrandfather, Accardo. a shepherd in the hills of New Mexico. Illustrated by FancyPassFeaturesBailly, It FoldsOn!: Sharon. a All andlighthearted About Dead NotesMan's text From Props.with Secret brief Millbrook, factsCodes about 1995.and Specialpapermaking, (I) Inks to the radioInRadioBarasch, 1923, station, Rescue. afterLynne. alearning Francestwelve-year-old-boy MorseFoster, Code 2000. and sends(Y) setting a message up his that own leads amateur to HideBaker,ABCsReaders and ofKeith. graphology,Snake. are challenged Red Wagon,and paperto find 1999. folding. a snake (T) on each page of this board MulticulturalBarchers,experiencesthe rescue Suzanne of Folktales: of a thefamily author'sI. Readersstranded father. Theater by a hurricane for Elementary in Florida. Students. Based on Balcavage,book.The Federal Dynise. Bureau of Investigation. Chelsea House, 2000. (I+) DinosaurBarner,DozensTeacher Bones. Bob. ofIdeas, reader's Chronicle,2000. theater (L) 2001. scripts (P) for elementary school children. BagDiscussesCrazyBaltuck, of Tricks. Gibberish theNaomi. historyLinnet, and of 1993.Other the FBI (L)Story and Hour some Stretches: of its most From famous A Storyteller's cases. Bones,Barton,Introduces Bones, Byron. fossils Dinosaur to the Bones. very young.Crowell, 1990. (T & P) Bang,CollectionTen, Molly. Nine, of Eight.classic Tupelo, storytime 1998. stretchers, (T) including riddles. Bateman,bones.Simple Available picture Teresa. book in board features book paleontologists format. searching for dinosaur Bany-Winters,African-AmericanBoard book edition Lisa. girl of theand classic her dad. bedtime counting story of an TwoHuntingBean, siblings Joy.the Daddyosaurus. follow clues to Whitman,find their dad.2002. (P) games.IncludesPress,On Stage: 1997. basic Theater (L) theater Games terms, and puppetry,Activities andfor Kids.pantomime, Chicago along Review with lawnmower.ThisThe lift-the-flap Little Lawnmower. board book Random, takes 2002.readers (T) on adventures with a 236 Beatty, Scott. Bertrand, Diane Gonzales. ABatman hideouts.Kindersley,broad :history The Ultimate2001. of Batman's (Y+) Guide friends, To The foes, Dark high-tech Knight. Dorling hardware, and begins.I)PlansUncle change Chente's for Picnic Uncle / Chente'sEl picnic picnic de Tio when Chente. a big Piñata, rainstorm 2001. (P- PerezheartMartina,PerezBelpre, y onMartina.and Pura. Perez,a Martina.cockroach, Warne, a mouse, Warne. is1966. lookingwhen 1960. (P-I) she for (P-I) hears a suitor his tosong. marry and sets her MollyHeroinetheRecountsBlos, Titanic.Brown. Joan.of the the WilliamTitanic: legend Morrow,Aof TaleMolly of 1991. BrownBoth (I)True who and survived Otherwise the sinking Life of of Directing,PuttingBentley, On And NancyA Play: Performing. and The Donna Young Millbrook, Guthrie. Playwright's 1996. Guide (Y) To Scripting, PrivateATheBonsall, message Case Eye Crosby of written Club.The Newell.Double in a secret Cross. code Harper allows Trophy, girls 1982.to join (P the & boy'sI) formingBerlin,crewAn easy-to-read and the Irving. play.cast, preparing how-to-do-it the stage,guide rehearsingfor writing thea script, lines, choosing and per- the PrivateTheBonsall, Case eyes Crosby of theWizard, DumbN. Tubby, Bells. HarperTrophy,Skinny, and Snitch 1966. match (P-I) wits with an America".life.LynnGod IncludesBless Munsinger's America. a CD illustrations of HarperCollins, Barbra Streisand bring 2002. this singing classic(T & P) "God patriotic Bless song to TheCaseBonsall,invisible Private of the Crosbydoorbell HungryEyes Newell. Clubringer. Stranger. searches HarperCollins, for a missing 1992. pie. (P & I) cousinsDanielFamilyBertrand, meets /at Familia. Dianea family and Gonzales. becomesPiñata reunion Books, friendsheld in1999. withSan (P+)Antonio.his newly introduced onIntroducesPoliceBoraas, educational Detective. Tracey. the careerrequirements, Capstone, of police 2001. duties, detective, (I+) workplace, and includes salary, information employ- ATheBertrand, doll Last named DollDiane Sarita/ La Gonzales. 'Varna patiently muneca. waits Piñata, to be bought. 2000. (P-I) 237 ment outlook, and possible future positions. Brady,To liver's Esther. Secret. Random, 1993. (I) No1999. sewing (L) is required in these simple quilt projects. IncludesKidsBraman,Disguised Around Arlettecrafts as athe boy,from N.World Ellen many Create! delivers cultures. Wiley, a message 1999. (Ito &George L) Washington. AKindersley,CreatingBuckley, behind-the-scenes The James 2000. X-Men: Jr. (I+) Howlook Comicat how Books authors, Come illustrators, To Life. Dor and ling layout Galileo'sBrighton, Treasureoldest Catherine. daughter, Box. Walker, Virginia, 2001. finds (P & five I) treasures in a box. FlowerABunting,artists child Garden. create plants Eve. oneVoyager, a flower of the 2000.gardenmost (Tpopular for & hisP) comicmother books in a window ever. box. PictureHoughtonRareBrown, Treasure: bookDon. Mifflin, biography Mary 1999. Anning of (P Mary &And I) Anning, Her Remarkable 19th century Discoveries. British pale- JaneSolvesBunting, Martin, three Eve. Dog cases Detective. involving Harcourt, dogs. 1988. (I) AIBrown,ontologist. Like poem Bugs. Margaret about Golden, bugs Wise. is 1999. brought (P) to life with illustrations by G. Brian AtSpyingteen-year-oldBunting, a boarding on Miss Eve. school Muller.Jessie in must Clarion,Belfast deal at 1995. with the start her(I+) suspicionsof World War about II, athir- teacher TheBrunvald,Karas. Vanishing Jan Harold.Hitchhiker: American Urban Legends and Their SunflowerwhoseBunting, father House. Eve. was German.Voyager, 1999. (P) Haroldlegends.AMeanings. classic Brunvald. See collection Norton, also other 1981. and titles explanation (Y) concerning of the urban phenomenon legends by of Janurban ThisIBurnard,A Spy boy board in delights the Damon. book Jungle. as will seeds Chronicle, enchant grow intoyoungsters 2001. a backyard (T-P) as they sunflower spy animals house. whose QuiltingBuchberg, Activities Wendy. Across the Curriculum (Grades 1-3). Scholastic, 238 names begin with different letters of the alphabet. StoneJulian,JulianCameron, book.Secret Huey, Ann. Agent.and Gloria Random become House, crime 1988. busters (P & in I) this Stepping Carrick,ArtKidsCarlson, and Create! craftCarolLaurie. Garethprojects and David. Stevens, for three 1999. to nine-year-olds. (I & L) IntroducesSpaceCamillo, Shuttle Jacqueline. the Eye Space On Shuttle the Universe. to children Crabtree, ages 1998.4 through (P & 8. I) Carter,EntertainingBig Old David. Bones: story A Dinosaurof the early Tale. days Clarion, of paleontology. 1992. (P & I) Campbell,House,Forensic 2000. Andrea.Science: (I+) Evidence, Clues, and Investigation. Chelsea LiftPeekabooChavarria- the flaps Bugs. Chairez,and Little turn Becky.Simon,a wheel 2002. to find (T hidden & P) bugs. criminals.ExaminesTheCarle, Mixed-Up Eric. forensic Chameleon. science and Harper how itCollins, can be 1987.used to(P) apprehend Magda'stratedMagda(P-I) by Pinata decides Anne Magic Vega. that she / Magda wants yto la save piriata her magica.brother's Pinata, pinata. 2001. Illus- A Carle,lookchameleon like. Eric. becomes mixed-up as he chooses other animals to Magda'sveryMagdaChavania-Chairez, different Tortillas learns tofrom /Las make Becky.her tortillas tortillasgrandma's. de on Magda. herIllustrated seventh Pinata, by birthday 2000.Anne Vega.(P-I) with results Carle,Carle.ThisOne, boardTwo, Eric. Threebook containsto the Zoo. simple Philomel, text with1990. illustrations (T & P) by Eric America:AnCheney, children's A Lynne. Patriotic alphabet Primer. on patriotism.Simon-Schuster, 2002. (P & I) transformsALa Thecaterpillar oruga Very muy into Hungry eats hambrienta. a butterfly.his Caterpillar. way through Scholastic, Collins a bunch 1989. Publishers, of munchies 1979. and (T-P) then China'sChin,1993. Charlie. Bravest(I) Girl: Legend of Hua Mu Lan. Children's Book Press, 239 girlBilingual who, disguisedretelling of as popular her brother, fifth bravelycentury defendsChinese her legend country. about a RobberyChristelow, at the Eileen. Diamond Dog Diner. Econo-Clad, 1999. (P & I) Jack'sCole, Garden. Henry. Mulberry, 1997. (T & P) Christopher,are.Jewel thieves Matt. are in town and the detectives must discover who they Salsa.ThisRitaColon-Vila, cumulative Piñata,imagines 1998.Lillian. storybecoming (P-I) tells ofa salsa the delights director of in a this backyard bilingual garden. book. T.V.Clark,out,The Adams heSpy David receives on knows Third Allen. a wherefewBase. warnings. Little,the ball Brown, will be 1990. hit, and (I) when others find Children'sCorpi,Where Lucha. Fireflies Book Press, Dance 1997. I Aht (P-I) donde bailan las luciernagas. collectionTheJokes,hippies, jokes, Puns, cover hairdos,riddles, and aRiddles. range puns,and hermits. of "daffinitions",Doubleday, subjects from 1968. and nuts (I+)comebacks at the wheel in tothis Cosby,ofLucha TheSan TreasureandSebastian,Bill. her brother Hunt. a ghost Cartwheel, Victor said loveto haunt1997. to hear a(T-I) local their house. grandmother's story Young.Sadako.Sadako'sCoerr, Putnam,Eleanor. story is1993. retold (P for& I)a younger audience. Illustrated by Ed AlligatorsCraughwell,collectors.Little Bill in discoversthe Thomas Sewer: thatJ. and the 222 best Other treasure Urban cannot Legends. be boughtBlack Dog by effortsSadakoCoerr, to survivesand Eleanor. fold the 1,000 Thousand the paperatomic Papercranes bomb Cranes. lead only to to aPutnam dieworld-wide of cancer. 2002. peace (I Her & Y)brave Curtis,Aand collection Leventhal, Jamie of Lee. 1999.urban (Y)legends. RelatesSouthernCohen,movement. Daniel.twenty-one Fried Rat andgruesome Other Gruesomeand disgusting Tales. tales M. drawnEvans, from 1983. (Y) Cushman,Answers(P)Where Doan Doug. ageBalloons old mystery Go? An with Uplifting rhymes. Mystery. Harper Collins, 2000. folklore; most are from urban legends. 240 ThisAuntteries. ReadingEater Loves Rainbow A Mystery. title features Harper AuntTrophy, Eater 1989. solving (P &I) four mys- forInspectorInspectorCushman, their insect Hopper. Hopper Doug. friends. Harper and his Collins, assistant 2000. Mc (P-I) Bugg solve three mysteries A andHouse,collection shared. 1999. of Latin-American(L) stories just waiting to be learned TheFiveDavidson, story True of DogDox,Margaret. Stories. the greatest Scholastic, detective 1987. dog (I) in the world. told.AnotherThirty-ThreeDeSpain, compilation Pleasant. Multicultural by DeSpain Tales to that Tell. includes August folktales House, 1993.ready (L) to he ThePeachtree,TheDeedy, legend Yellow Carmen of 2000. Star:King Agra. The (I)Christian Legend and of theKing Danish Christian people of Denmark. during World missingDogLuDickson, and detectives, Clancy's puppies. Louise. LuCrime The and book Science.Clancy contains are Kids off simple, Can, to solve 1999. crime-solving the (I+) case of the activi- ArrozDelacre,War conII. leche: Lulu. Popular Songs and Rhymes from Latin America. HispanicDenison,Downs,ties. Games Cynthia 1996. and (L) and Rhymes: Gloria RimasErickson. y juegos en Espanol. T.S. Delacre,AScholastic, delicious Lulu. 1989.mixture (L) of songs and rhymes from Latin America. HiddenDonovan,A collection Treasures. Gail. of popular North South, Latin 2001games (T) and rhymes. style.GetScholastic,Las Navidades:ready for 1990. Christmas Popular (L) Christmasand enjoy Songssome wonderfulfrom Latin songs, America. Latin TouchDorlingChildren and Kindersley. play Feel: hide 1,2, and 3. Dorlingseek with Kindersley, this Rainbow 2000. Fish (T) board book. ChildhoodChave'sDelgado, Memories Maria visits Isabel. to /Los a grandparents' recuerdos de ranch Chave. are Piñata, recounted. 1996. (I+) DorlingchildrenThe simple Kindersley. to count.text and textures in this board book teach the youngest TheDeSpain, Emerald Pleasant. Lizard: Fifteen Latin American Tales to Tell. August 241 SimpleTouch and text Feel and ABC. texture Dorling teach toddlersKindersley, the 2000.alphabet. (T) Dubouski, Cathy East. EightElya, SusanAnimals Middleton. on the Town. Putnam's, 2000. (P-I) ArchaeologistsTwoPirateDuke, young School. Kate. pirates Grosset/Dunlap, Dig discoverFor Clues. buried Harper, 1996. treasure (P 1997. & I)with (P & amusing I) results. OriginalErickson,Eight animals Adventures John. participate of Hank in assorted the Cowdog. activities. Puffin, 1998. (I) LockedChildrenDuncan, in go Time. Lois. to a Laureldig in aLeaf, cornfield 1991. with (Y) an archaeologist. Ericson,readHank other is a Helen. scruffy, titles in smart-aleckthis series set sleuth in West with Texas. a nose for danger. Also Edward,likestrangeCan discussingEleanor past Kirsten. before discover this theysuspenseful the are secret able thriller.behindto make her her new part stepfamily's of it? Teens will ThisEstes,tures.Harriet new Kristyn seriesSpies Again.takes Rehling. the Delacorte, reader on 2002. more (I) Harriet the Spy adven- Ehlert,theDescribesTeen year. Lois.Library library Events: programs A Month-by-Month that teens will enjoy Guide. for Greenwood, each month 2002. of Manuela'sFalcon,birthday.Manuela Rafael.Gift. is disappointed Chronicle, 1999.when (P-I)she doesn't get a new dress for her Ehlert,CuckooHarcourt,Cuckoo: Lois. comesa 1997.Mexican to (P+) the Folktale rescue /and Cucu: ends un up cuento a hero. folkloric° mexicano. SpanishCollectionCulture101 Spanish language. Through of Riddles: riddles Humor. in Understanding Spanish McGraw useful Hill, Spanish for2001. self-instruction (Y)Language and in the FossilEldredge,Die-cutIn My Factory.World. shapes Nile. Harcourt, ofRoberts familiar Rinehart,2002. items (T) found 2002. in (P+) a toddler's world. IncludesAAbradale,Field, Thedetailed Leslie.Queen's a 1997.historyfamily Jewels: (Y+) treeof jewels (OP)andThe lotsPersonal owned of pictures. by Collection the British Of Royal Elizabeth Family. II. IncludesFact-filled a listactivity of 50 book sites about where discovering fossils can andbe found. collecting fossils. 242 secretEleven-year-oldHarrietFitzhugh, notebook the Louise. Spy. Doubleday, ofHarriet what sheloves 2000.sees. to spy (I) on her friends and keeps a science.ProfilesSolvingFridell,(I+) Ron.Crimes:the work Pioneers of six individuals of Forensic who Science. shaped Franklin the field Watts, of forensic 2000. CountingCount.Fleming, H. Denise. funHolt, from 1997. 1 to (T) 10. Imagination.StoriesStoriesFujita, To Hiroko.for Play storytellersAugust With: House,Kids who Tales 1999. work Told (L)with With young Puppets, children. Paper, Toys and Brunvald.ATheFleming, collection Big Book Robert of of urban LorenUrban legends andLegends. Robert adapted Paradox, F. Boyd, from 1994. theJr. works (Y) of Jan Harold OverGaldone,1989. In the(T Paul. &Meadow: P) An Old Nursery Counting Rhyme. Aladdin, PublicRingFlint PublicA Library, Ring Library. O'Roses: 2000. (L) Finger Plays for Pre-School Children. Flint Galindo,tenIntroduces in poetry. Mary animals Sue. and their young and the numbers one through Fluegelman,A Thecollection New Games ofAndrew, finger Book: Ed.plays Play in EnglishHard, Play and Fair Spanish. Nobody Hurt. Dolphin, ThreeIcyGardner, Watermelon generations Martin. / Sanckagather tofda. enjoy Piñata, watermelon 2000. (P-I) and a story. VeryToughFox,1976. active Mem. (I+) Boris. games Harcourt, for outside 1994. play. (P) invisiblevariousExplainsCodes, Ciphers, ciphers, ink.in simple anddescribes terms Secret how codingWriting. to encode machines, Simon and and anddecode Schuster, gives messages formulas 1972. (I+)in for YouFranco,A simple Hear Betsy. storyMe?: ofPoems a pirate and who Writing cries by when Teenage his parrot Boys. dies.Candlewick, (I+)CrimeGardner, Lab Robert. 101: Experimenting with Crime Detection. Walker, 1992. issuesAn2000. anthology (Y)that concern of stories, them. poems, and essays by adolescent boys on 243 someThis book do-it-yourself is filled with ideas. tidbits about crime detection and includes BombGeorge, Detection Charles. Dogs. Capstone, 1998. (I) BasedHowGreen, to on Nicholas.Steal Colonel the Crown Blood's Jewels. attempt IS` toBooks steal Library, the jewels 2000. in 1671(Y) MyAGeorge,Photographs Sideyoung of Jeanboythe ofMountain.survivesCraighead. police dogsin Penguin, the at wilderness work. 1988. (Ifor & one Y) year. Owen'sOwenGreen, Foote, Stephanie. investigative Super Spy. skills Clarion, are pushed 2001. (I)to the limit. Ten-year-oldKidnapthisGiff, entry Patriciaat the in Minnie Catfishthe Reilly. Adventures setsCafe. up Puffin, a ofdetective Minnie 2000. agencyand (P &Max I) with series. her cat Max in Activities.GamesGregson,The Incredible are Pitman Bob. separated Learning, Indoor into Game three1982. Books: categories: (I+) 160 Group spur ofProjects, the moment, Gamesa and MushroomDiscoverGinsburg, inthe Mirra. the secret Rain. of Aladdin, what happens 1997. to(T a & mushroom P) in the rain. Gregson,littleThe preparation, Outrageous Bob. andOutdoor plan Gamesahead. Book: 133 Group Projects, Games Press,PoetryUsefulGlazner, 2000.Slam: guide Gary (Y)The to Mex. Competitivecompetitions Art for of the Performance oral interpretation Poetry. ofManic poetry. D tion.betweenThisand Activities. collection the ages Lake,of ofgames 62000. to is16 (I+)for years groups old. ofGames 10 to require30 players little who prepara- are VillagersGollub,The Twenty-Five Matthew. become suspicious Mixtec Cats. when Tambourine, a healer in 1993.a Oaxacan (P-I) village Hidebook.ChildrenGretz, and Susanna.Seek. can Atheneum,play hide and 1986. seek (T) with (OP) the animals in this board FeaturesBestGraham,brings Book home excitingand of twenty-fiveSpaceships.Ian S.photographs and Aan. cats.Kingfisher, of spaceships. 1998. (P & I) Nursery(L)TortillitasGriego, Margot. rhymes para mama: from Latin and Other America Nursery just beggingRhymes. to H. be Holt, chanted. 1981. 244 ThePhoebeGriffith, true the Judithstory Spy. of Berry. Scholastic, a free black 1992. woman (I) who disguised herself as Harrison,MoserThis third contains David.collection less familiar of Brer stories.Rabbit stories illustrated by Barry TheGuthrie,housekeeperThis classic Land Woody. American Isand Your who Land. folkwas reallysongLittle by aBrown, spy.Woody 1998. Guthrie (P-I) is richly illus- cageADetective (I+)frolicsome in the Bob zoo. ape and eludes the Great Detective Ape Escape. Bob's effortsParents to Magazine, return him 1980. to his tratedThisHale, in Gum Bruce. this forbook. Hire. Harcourt, 2002. (I) 1995.TheHarrison, New (P-I) OxfordMichael. Treasury of Children's Poems. Oxford University, playersHall,theChet Chet Gecko,Nancyare Gecko disappearing Abraham.fourth-grade Mysteries before series.private the eye,big game must discoverin this sixth why entry football in Mangachildren.Hart,Classic Mania:Christopher. collection How ofto oldDraw and Japanese new American Comic. andWatson-Guptill, British poems for RhymeshablaLos1994. pollitos hispana (L)and dicen: Songs / The juegos, fromBaby Spanish Chicksrimas y SpeakingSing: canciones Traditional Countries. infantiles Games, Little,de paises Nursery Brown, de Japaneseculture.Hart2001. helps (Y+) comic the book reader characters understand and the provides different insight characterization into Japanese of TheHamilton,Latin People songs Virginia. Couldin English Fly: Americanand in Spanish Black along Folktales. with musicalKnopf, 1993. notes. PlantsSeaweedHeller, That Ruth. growsNever toEver be giganticBloom. Paperand mushrooms Star, 1999. glow (P) at night in this Harris,WinnerofHumor, stories Joelofmagic, drawn the Chandler. 1986 freedom, from Coretta the andAfrican-American Scott mystery King are Award. themes folktale in thistradition. collection rhymingLeftBaileyHenkes, out natureGoes ofKevin. a Camping. campingmystery. trip, Mulberry, Bailey 1997. has her (T own& P) camping adventure at Voyager,Jump On 1998.Over!: (I The & L) Adventures of Brer Rabbit and His Family. 245 home. LaughingHarperHerrera, Collins,Out Juan Loud, Felipe. 1998. I Fly: (I+) Poems in English and Spanish. John'sHunter,Unbreakable grandfather Sara Hoagland. Code. explains Northland, how the1995. Navajo (I) language and ingenuity LookA Hoban,bilingual Book. Tana. poetryGreenwillow, collection 1997. that (T is & wonderful P) for reading aloud. LlamanHutchins,helped win a laPat. World puerta. War Greenwillow, II. 1994. (T-P) Classic1,A Hoban,peek-through-the-hole2, 3. Williamboard Tana. book Morrow, for babies. 1985.book. (T) El Hutchins,ChildrenThepaseo Doorbell de learnRosie. Pat. Rang. the Aladdin concept Greenwillow, Paperback of division 1986. / Libros through (T-P) Colibri, sharing 1997. cookies. (T-P) Collection(Y)SpidersHolt, David. in theof urban Hairdo: folklore Modern retold Urban by Legends.David Holt August and William House, 199 9. Rosie'sImmroth,herRosie as Walk. thedinner. Barbara.hen Scholastic, goes for 1987.a walk (T-P) and is oblivious to the wolf who sees MarvelousHopkins,Mooney. Lee Math. Bennett. Simon and Schuster, 1997. (P & I) ThisLibraryFoundation(L) includes Services programConference to Youth presentation ofwhich Hispanic was materials heldHeritage. in Tampa,from McFarland, the Florida. 4'h Trejo 2000. SweetHopkinson,A collection Clara Deborah.andof poetry the Freedom about math's Quilt. many Random, wonders. 1995. (P & I) Impey,(Y+)Tower Edward Of London: and Geoffrey The Official Parnell. History. Merrell Holberton, 2000. Hopkinson,Railroad.ClaraUnder sews the a Deborah. Quiltquilt fromof Night. scraps Atheneum, to make a2002. map of(P-I) the Underground Inches,historyMore than ofAlison. the just Tower a coffee-table from its originbook, tothese the pagesyear 2000. hold the intriguing Sequel to Sweet Clara and the Freedom Quilt. 246 helpDoraDora's in and Treasure this Boots sticker Hunt.are book. off Simon on a treasure Spotlight, hunt 2002. and (T) need the reader's TheJacobsohn, Reading Rachel Group W.Handbook: Everything You Need To Know, From directions,Guides readers and puttingthrough on character a play. Alsodevelopment, contains adialogue, glossary stageof stage James,theirJacobsohn'sChoosing libraries. Elizabeth, Members 2' edition and To CarolLeadinghelps Riekehof.professionals Discussion. Hyperion,start great 1998.book (L)clubs at ASecretKahn,terms. child Fernandoin slips the Dungeon.away from Clarion, the group 1983. and (P discovers & I) a sleeping dragon PresentsHowmessages.1978. to Keep(I+) various a Secret: methods Writing of writing, and Talking speaking, in Code. and Lothrop,signaling Lee, secret Jump,Salta,in Kathe lan, ranita,castleFrog, Robert. Jump. dungeon.salta. Morrow, 1991.1994. (T-P) (T-P) HowJaneczko,poetry.Provides to Write Paul. practical Poetry. advice Scholastic, with 1999.checklists (Y) on the art of writing TrueSpyKarr,Frog in story the beware,Kathleen. Sky.of Civil Hyperion,there War is someonespy 1997. Thaddeus (I) on your Lowe trail! who launched the Johnson,Jenkins,DoubleChameleons Martin.Crockett. page Are. spread Cool. of variousCandlewick, types 2001. of lizards. (P & I) Mary-KateCaseKatschkle,Balloon of DogCorp Judy.and Camp for Ashley's President Mystery. basset Lincoln. HarperCollins, hound, Clue, 2001. disappears (I) while at Johnson,Mars.WithHarold's his TrippurpleJames to Weldon.thecrayon, Sky. HaroldHarper drawsCollins, himself 1981. (P)on a rocket voyage to Katz,camp.Where Karen.New Is AdventuresBaby's Mommy? of Mary-Kate Little Simon, and Ashley 2001. (T)#24. Judy,IllustratedLift Ev'ry Susan Voice picture and andStephen. book Sing. of Walker,the Afric'an-American 1993. (P) song. Kellogg,ChildrenThe Missing Steven.play hideMitten and Mystery. seek in Dial,this simple 2000. (Pboard & I) book. hoodPutting Drama. On A Atheneum,Play: A Guide 1982. To (Y)Writing (OP) And Producing Neighbor- 247 A retelling of the 1974 classic, The Missing Red Mitten. PirateKennedy, PetePete. Kim. is Abrams, looking 2002.for treasure. (P) eachFeaturesGonnaKrull, song Kathleen.Sing American along My Headwith folk aOff! musical songs Knopf, for arrangement. children1992. (L) with a brief history of Fast-pacedRobinKimmel, Hook: Eric. pirate Pirate fantasy. Hunter. Scholastic, 2001. (I) SAM:ALabatt, detective Dog Mary. Detective. series featuring Kids Can, a mystery-solving1999. (I) sheepdog. whoThisMissKirk, arealphabet Spider'sDavid. planning ABC.board her Scholastic, book surprise tells birthday1998.the story (T) party.of Miss Spider's friends Ten-year-oldSpyingLabatt, on Mary. Dracula. Jennie Kids Levinsky Can, can1999. "hear" (I+) what her new neighbor's RedcoatsasMembersKirkpatrick, spies and for of thePetticoats. aKatherine. family Revolutionary in Holiday the village Army House, of of Setauket George1999. (I+) Washington.on Long Island serve LupitaBigLachtman,sheepdog, Enough discovers Sam,Ofelia / Bastante is thatD. thinking. she grande. is big Pinata,enough 1998.to help. (P-I) Science(L)Kohl, Arts:Mary DiscoveringAnn. Science Through Art. Bright Ring, 1993. RhymingLaden, Nina. board book. Chronicle, 2000. (T) eneum,Korty,IncludesWriting Carol. 1988. simple Your (Y) Own science (OP) Plays: experiments. Creating, Adapting, Improvising. Ath- 1995.Private (I) I. Guana: The Case of the Missing Chameleon. Chronicle, Nina. Private I. Guana searches for the missing chameleon in 3650Kostick,General Jokes, adviceAnne, Puns, forCharles andwriting Riddles. Foxgrover plays. Black and Dog Michael and Leventhal, J. Pellowski. 1998. (Y) AmazingLaidlaw, I SpyKen. ABC. Dial, 1996. (T) detective spoof for young readers. A compilation of jokes, puns, and riddles. 248 A lift-the flap alphabet board book. Heroine2001.Landau, (Iof &Elaine.the Y) Titanic: The Real Unsinkable Molly Brown. Clarion, BlastALeedy, spaceship Off Loreen.To Earth: of aliens A Look take At a Geography.trip to earth. Holiday House, 1998. (P) TheLarsen,A biography Secret Jeanette. Code of Molly is READ: Brown, Texas survivor Reading of the Club Titanic. Program Manual. ShortMissionLeedy, math Loren. Addition. lessons Holiday in comic House, strip format. 1997. (P) Lasky,secretThisTexas 1990 Statecodes. Katherine. manual Library, features 1990. (L) many programs and craft activities on Rabbit.AcclaimedLester,The Tales Julius. author of Uncle Julius Remus. Lester Dial, retells 1985. the (I adventures& L) of Brer Laurence,A CaptainGracegreat pirate the Daniel.and Pirate. adventureMatey Disney, Set story Sail. 1997. thatHarperCollins, (I) includes puzzles 2001. and(P) activities. andReadersIfLevine, You answer Traveled Ellen.are format. introduced On the Undergroundto the underground Railroad. railroad Scholastic, in a question 1993. (I) HarrietLawrence,theySail thesearch andseven Jacob. thefor seas adventure.Promised with Captain Land. Aladdin, and Matey 1997. and (P-1) two silly pirates as Don'tLexau,Sam(I+) Be Joansends My M. Valentine:Amy Lou Aa meanClassroom valentine Mystery. which HarperCollins, almost ruins the1999. day HowTheLee, heroic to Stan Draw story and Comics Johnof Harriet Buscema.the Marvel Tubman. Way. Simon and Schuster, 1984. forThreeLinch, him andLittle Tanya. for Kittens. his friends. Levison, 2001. (T & P) TwoLee,(I+) masters Stan, andreveal Steve the Ditko.mysteries of how to draw comics. A Lionni,AColor retelling of Leo. His of Own. the classic Knopf, rhyme. 2000. (P) TheSpider-Man first eleven Volume issues 1. ofMarvel, the amazing 2002. (I+)Spider-Man. 249 A chameleon is in search of a color of his own. ASwimmy.Lionni, little fish,Leo. Knopf, the lone 1992. survivor (P & I) of a school of fish, devises a plan to FolktalesMomentosLoya, Olga. from mdgicos Mexico, /Magic Guatemala, Moments. Colombia, August House, and other 1997. Latin (L) Janine'sHauntedLittke,camouflage twin Sister.Lael. sister himself H. Holt, died and as1998. his a child friends.(Y) and now she sees her again after HelpsMcCloud,countriesUnderstanding the areaverageScott. included Comics. librarian in this Kitchen understand collection. Sink, why 1994. people (I+) love comic sion.overNowa nearly herLenore fatallife. is Acar outsurprise crash for revenge takes ending her and makes on inhabits a quick this a Janine's detourgreat book to body, the for afterlife. taking discus- WhileShadowsMcDonald,books. working in Megan.the asGlasshouse. an indentured Pleasant, servant 2000. for (I+)a Jamestown Two1997.TheLopez, sisters Birthday (P-I) Loretta. swap Swap birthdays / 'Que. so sorpresa that the de younger cumplearios! one can Lee celebrate and Low, SecretMcGovern,sabotage.glassmaker Soldier: Ann.in 1621,The Story twelve-year-old of Deborah Sampson.Merry uncovers Scholastic, a case 1999. of (I) TrueBooty:Lorimer,hers inadventures Girlthe Sara. summer. Pirates of womenon the High pirates. Seas. Chronicle, 2002. (I-Y) McGowan,RevolutionaryThe true story Diane. ofWar a woman by dressing who andbecame acting a soldier like a man.in the American ThisLosLowell,1996. tres southwestern Susan.(P-I)pequefios jabaliesadaptation / The of Three "The LittleThree Javelinas. Little Pigs" Northland, features DinosaurMathMcMullan,Children Play. Hunters. exploreLittle Kate. Hands, Scholastic, math through1997. 1989. (L) games, (P) nature, arts, and crafts. WherePokyLowrey,bristly-haired Little is Janette the Puppy. poky javelinas. Sebring. littleGolden, puppy? 2001. (T) Scientists who study dinosaurs hunt for new information. ThisHouse,MacDonald,Tuck-Me-In multi-cultural 1996. Margaret (L) Tales: collection Bedtime Read. Storiesof bedtime From stories Around includes the World. a couple August Marsh,taryyear-old compound. Valerie. Graham encounter ghosts from a nearby abandoned mili- MacDonald,of TwentyLatin American Tellable Margaret Tales:tales. Read. Audience Participation Stories for the Begin- A&Mystery L)collection Fold: of Stories imaginative to Tell, stories Draw, for and young Fold. children. Alleyside, 1993. (Y NinaMachado,Twentyning Storyteller.bonita. simple Ana Ediciones Maria.stories H. W. andWilson, Ekare, instructions 1994.1986. (T-P)(L) on how to tell them. childThisd'OsoBrownMartin, contemporary interested.pardo, Bear, Bill. osoBrown Boardpardo classic Bear que book What yeswith edition ahC? Dorhyming You H.available. Holt, See? text 1998. H.keeps Holt, (T-P) the 1992. youngest (T P) Maestro,makeA white himself rabbitBetsy. black. is so enchanted by a black child that he tries to AChickaMartin, board ChickaBill. book version ABC. Little of the Simon, acclaimed 1993. preschool (T alphabet book, P) format.TheStory history of the ofStatue the Statueof Liberty. of Liberty Mulberry, presented 1989. in(P-I) a picture book IMarzollo,Chicka Spy Little Chicka Jean. Book. Boom Scholastic, Boom. 1997. (T) sequelBeginningBookstoreMaitland, to Bookstore Barbara. Burglar.readers willPuffin,Ghost. delight 2001. as (P) the "ghosts" catch a thief in this IMarzollo,Board Spy Little book Jean. Letters.version Scholastic,of the popular 1999 I SPY(T) book. ExploresSecretManley, Agents: Claudia the life Life B.of aAs spy. a Professional Spy. Rosen Central, 2001. (I+) Marzollo,learningA perfect the pointJean. alphabet. and say book for toddlers and preschoolers who are OperatingManns,Upon Nick.moving Codes. to Little, Sentinel Brown, House, 2001. five-year-old (Y) Matty and fifteen- 251 BoardI Spy Little book Numbers.version of Scholastic, the popular 1999. I SPY (T) book. IMarzollo, Spy Treasure Jean. Hunt. Cartwheel, 1999. (P) 12Merriam, Ways toEve. Get to 11. Scott Foresman, 1996. (P) IMarzollo,A Spy treasure Treasure Jean. map Hunt: and rhyme A Book reveal of Picture clues Riddles.that lead Scholastic, to a treasure. 1999. ThisHands-OnMerrill, mathematical Yvonne Latin Y. America:adventure Art offers Activities a new fortwist All on Ages. counting. Kits, 1997. (L) turesThis(T+) collectionto show children. of riddles is filled with an rich assortment of pic- I Spy:Micklethwait,Instructions An Alphabet for Lucy. making In Art. LatinGreenwillow, American 1992. crafts. (T & P) Rhymingtic,IMarzollo, Spy, 2001. Year verses(I+)Jean. Round ask Challenger: readers to A find Book hidden of Picture objects Riddles. in photographs. Scholas- PresentsMiller,letters ofobjectsMargaret. the alphabet. found in art with first letters that correspond to the TheLuMason, and clever Clancy'sAdrienne. canine Spy sleuths, Stuff. LuKids and Can, Clancy, 2001. solve (I & L)the mystery of Miller,ChildrenWhose Margaret. guessHat? Econo-Clad, whose hat is 1999. in the (T) photographs. LuMason,Aunt and Izzy. Clancy'sAdrienne. Secret Codes. Kids Can, 1999. (I & L) Miller,ChildrenWhose Shoe?Teresa. guess Greenwillow, whose shoe 1991.in the (T) photographs. Mayer,prints,Cartoon etc.Mercer. illustrations teach readers about analyzing foot prints, teeth storytellingAtoJoining greatTell Them. In:book An and forYellow Anthology audiencebeginner Moon, ofparticipation.storytellers 1988. Audience (L) with Participation information Stories on and How Meltzer,PirateOoey Gooey. Captain Milton. Random, Short Bob 1998. has (P) a sweet tooth. Mitter,1998.The TreasureMatt (T) of Pirate Island: Great Adventures. Reader's Digest, plainsFromCase what Closed: crime it's to Thelike witness Realto be Scoop anda detective. from on Detectiveclues to solutions, Work. Orchard, this book 2001. ex- (I+) 252 Pirates search for buried treasure in this lift-the-flap board book TaleTrophy,DrinkingMonjo, of a 1993. youngF.Gourd: W. (I) boy A Story whose of quick the Underground mind saves a Railroad. family of Harper slaves. Martina:LaMoreton,Martina Cucaracha unDaniel. gets cuento Martina: dressed folklorico forA Caribbeanher del trip Caribe. to townFolktale Turtle, to find /La 1997. thecucaracha beautiful (P-I) noise Eggnapped!PictureMontes, book Marisa. HarperCollins, mystery about 2001. a missing (P) egg. ThisTheMoss,that book Rosenberg"made Francis. discusses her feelEspionage the all famous funny Case. inside". espionage Lucent, 2000. trial of(I+) Julius and Ethel TheP)Mora, Desertdesert Pat. providesIs My Mother the inspiration / El desierto for es this mi poeticmadre. journey. Piñata, 1994. (T- Most,Rosenberg.Where Bernard. To Look For A Dinosaur. Harcourt, 1993. (P & I) LoveAMora, collection to Mama: Pat, ed. ofA poemsTribute devoted to Mothers. to mothers. Lee and Low, 2001. (P-I) HarperCollins,MissingMurphy,This title MittensStuart. includes 2001. (Mathstart: a list (P) of museums Odd and Eventhat display Numbers dinosaur Level 1).fossils. andAMora, Uno,rhyming Spanish Pat. dos, text trestells presenting/ theOne, story Two, ofthe Three. two numbers sisters Clarion, oneas they1996. through go (T-P) from ten shopin English to Karas.BillReaders locate investigate his animals' odd missing and even mittens. numbers Illustrated as they helpby G. Farmer Brian Morehead,shopThe buying New AlfredComplete birthday H., HoyleRichardpresents Revised: L.for Frey, their The Geoffrey mother. Authoritative Mott-Smith. Guide to the ArtCanNilson, FraudNodset, you Anna.Detective. find Joan. the differences Kingfisher, between 2001. (I) the paintings? games,IncludesDoubleday,Official and adult Rules more.1991. and of (I+) Allchildren's Popular card Games games, of Skill dice and games, Change. board Nofi,A Whofarmer Albert Took solves A. the theFarmer's mystery Hat? of Harperhis missing Trophy, hat. 1988. (T & P) 253 DescribesSpiesCivil in War. the the Civil covert War. actions Chelsea, that 2000. occurred (I+) on both sides during the andNye,The StoriesSchuster, Naomi Tree fromIs Shihab, Older1995. Mexico Than(P-I)ed. With You PaintingsAre: A Bilingual by Mexican Gathering Artists. of SimonPoems JackPiratesOsborne, and AnniePast Mary Noon. are Pope. back Random with House,a pirate 1994. adventure. (I) Also read other O'Connor,thisTexas rhythmic poet, Jane. Nye, compilation. has compiled a wondrous collection of poems in ThisWhatOtto,titles title inCarolyn.Color inthe the Magic Is Let's Camouflage? TreeRead House and HarperCollins,Find series. Out Science 1996. series (P) shows the IslandO'Dell,NotEek: too Stories of Scott.spooky the To Blue Makestories Dolphin. You illustrated Shriek. Houghton, byStern G. 1990. Sloan,Brian (I) Karas.1992. (I) JuniePark,many B.Barbara. waysJones animals and Some camouflage Sneaky Peeky themselves. Spying. Random House, O'Hare,Newbery12-year-old Jeffrey. Medal American winner inspired Indian girl. by the real-life survival story of a Paulsen,inSix-year-old1994. kindergarten. (I+)Gary. Junie loves to spy on people which gets her in trouble Peek-a-Boo!Ormerod,InformationSecret Codes Jan. Dutton, about and Hidden codes1998. and(T)Messages. messages. Boyd Mills, 1997. (I) ComeLaThe tortilleria. andTortilla visit Harcourt, Factory. a factory Harcourt,1995. where (T-P) tortillas 1995. (T-P)are made. DeDutton,Orozco,Children colores 1994. Jose-Luis. andpull Other down(L) Latin-American the flaps to play Folk peek-a-boo. Songs for Children. Pence,StorytellingPellowski,The StorytellingShari Anne. guide Ann. withHandbook. stories fromSimon around and Schuster, the world. 1995. (L) DiezOrozco,Musical deditos Jose-Luis. notes / Ten accompany Little Fingers the wordsand Other to popular Play Rhymes Latin songs. and Action Activities(OP)Picnics,Games Galorefor Rainy Parties, ForDays Children'sClassrooms, and Special Parties Youth Occasions. and Groups, More: Funcastle, Carnivals, Fun Games 1996. Company and (I+) andHereSongs share. is from another Latin great America. collection Dutton, of songs 1997. and (L) rhymes ready to sing 254 4-12.Each game specifies a recommended age range. Most are for ages InformationStatuePenner, of Lucille. Liberty. on the Random construction, House, history, 1995. (P-I)and symbolism of the Plum-Ucci,howChristopherThe Bodyhe and Carol.of his CreedChristopher friends is missing treated Creed. and him. Hyperion, Torey They Adams team2001. up feels(Y) to findguilty out about what 2000.MyPerez,statue. Very (P-I)Amada Own Irma.Room / Mi propio cuartito. Children's Book Press, Polacco,happenedThe Butterfly. Patricia. to him. Philomel, Ambiguous 2000. ending (P-I) aids in good discussion. own.andA young begins Illustrated girl to gets search by tired Maya her of houseChristinasharing for a Gonzalez.rooma little with space her she five can little call brothers her Pomerantz,bookTheThe story format. Tamarindo of Charlotte. the French Puppy resistance and Other during Poems. World Greenwillow, War II in 1980. a picture (P-I) Phillips,AnPeterson,Where interactive Louis. DoStephanie. Animals board bookLive? about Innovative animal Kids, habitats. 2001. (T & P) Porter,lifeA collection the Connie.joy of of childhood. poems in English with a few Spanish words brings to Pietrapiana.AKeep 1996.collection em (I+) Laughing: of jokes, Jokes puns, to Amuseknock-knock and Annoy jokes, Your and Friends.riddles. Viking, IPowell,AddyMeet Spy Addy:Ondresses Richard. the An Farm. as American a boy Puffin, to avoid Girl. 1997. Pleasant,being (T) caught. 1993. (I) Tomasa,Platt,Tomasa Kin. the the one Cow horned /La vaca cow, Tomasa. searches Piñata, for her 1999. place (P-I)in the world. Preller,SpyCase animals ofJames. the on Detective the farm. in Disguise. Little Apple, 2001. (I) DKPlatt,BigMax Readers:Max. Richard. is theHarperCollins, world'sSpies! Dorling greatest 1992. Kindersley, detective. (P) 2000. (I+) Preller,catchIn this a title brownieJames. in the thief. Jigsaw Jones series, Jigsaw goes undercover to history.Presents information about men and women spies throughout 255 ballJigsawThe cards. Case and Milaof the are Stolen out to Baseball solve the Cards. case Scholastic,of Eddie's missing1999. (I+) base- A TyrannosarousPrelutsky,collection ofJack. humorous Was A Beast. dinosaur Greenwillow, poems. 1988. (P-I) WhatBlue'sReber, are CluesDeborah. Blue's My favoriteFavorite letters?Letters. Simon Spotlight, 2001. (T) stories.DetectiveQuackenbush, First Mole.Mole title Robert. findsLothrop, in the solutions classic Lee, 1976. mysteryto mysteries (P-I) series in forfive beginning easy-to-read read- ThisReber, Weatherboard Deborah. book Games uses With clues Blue! to help Simon children Spotlight, discover 1999. the (T) weather. Rainis,ers.Crime-Solving Kenneth G.Science Projects: Forensic Science Experiments. GeorgeCuriousRey, Hans endsGeorge A. up Getsin space. A Medal. Houghton Mifflin, 1974. (P) Ramirez,tionsIntroducesEns low, for 2000.related Michael various (I+) projects. Rose. aspects of forensic science and provides sugges- JacobphyrenownedInRich this Two-Two'steacher ler, third Mordecai. spymaster, adventureMiss First Sour Spy helpsof Pickle, JacobCase. him and Two-Two,Farrar foil Mr. the Strauss, I. plans M. Mr. Greedyguts, of1997.Dinglebat, his mean(I) world-the geogra- new Raskin,eventsA Thelittle Littleit antEllen. holds seeks Ant responsible / restitutionLa hormiga for from chiquita. its brokenthe humans, Rizzo leg. li, animals, 1995. (P-I) and natural TheToRide,headmaster. story Space Sally. of and a space Back. shuttle Lothrop, mission Lee, from1989. beginning (P-I) to end. charactersheirsInThe this Westing come Newbery and to Game. solve a winner,quirky Scotthis deathending a Foresman, millionaire and make claim 1997. thisdies the a (I+)mysteriously winner.inheritance. andLots his of fun AguageRiekehof, Thevaluable andJoy Lottieofthe guide Signing: Manual L. to learning TheAlphabet. Illustrated basic Gospel, sign Guide language. 1987. for Mastering(Y) Sign Lan- CaldecottOfficerRathman, Buckle Peggy.winner and about Gloria. a police Putnam, dog 1995. named (P-I) Gloria. AuntRetraces(PRinggold, &Harriet's I) the Faith. Underground steps slaves tookRailroad on the in Undergroundthe Sky. Crown, Railroad. 1995. withAnGreatestRissinger, illustrated such Jokes titlesMatt, bookon asand Earth. "Rude of Philip jokes Sterling, Food", Yates. and riddles "Furry1999. (I+)organizedTales", and into "Check-Up chapters whenAnaUnaRobleda sorpresaCristina she Moguel, reaches parestries Margarita.it.to Ana get Cristina. to the cookie Sitesa, jar 1992. and (T-P)finds a big surprise AnTheRobins,Chuckles". activity Great Deri. Pirate book Activityfor wannabe Book. pirates. Kingfisher, 1995. (I & L) LizTheRoddin, theCase Whiz Joanne. of the finds Backyard the treasure Treasure. with Cartwheel, the help of 1998. a secret (I) message. AComoRobleda child los decides Moguel, animales. that Margarita. Sitesa, there is 1996. much (T-P) to learn from animals. rhymes.AGiggles,Rosenbloom, collection Gags ofJoseph. and the Groaners. best, worst, Sterling, and silliest 1987. riddles, (I+) jokes, and AElRobleda childgato dedreams Moguel, las mil about Margarita.narices. a cat Sitesa, with an 1990. assortment (T-P) of noses. &CraftsRoss, L) Kathy.for Kids Who Are Wild About Outer Space. Millbrook, 1997. (I ARobleda Unchild grill° discoversMoguel, en mi Margarita. cocina.that the Sitesa, sound 1992. he hears (T-P) is that of a cricket. MakeRoss,A simple Kathy.Yourself collection a Monster! of crafts A Bookon outer of Creepy space forCrafts. school-age Millbrook, children. 1999. JosePulgas,Robleda Luis el Moguel, hasperro a dogde Margarita. Jose named Luis. Fleas. Sitesa, 1991. (T-P) Ross,dish,Collection(I & L) aStewart. puppet, of monster and a necklace.crafts made from materials such as a soap canASanaRobleda child to ranita, make pretendsMoguel, sana.her well. her Margarita.S.A. doll de isC.V., ill and 2000. that (T-P) she must do everything she Roy,ThisSpies bookRon. and Traitors.introduces Copper spies Beech,and traitors 1995. throughout (I+) history. 257 The Canary Caper. Random House, 1998. (P-I) pearingDink and all his over friends town. investigate why pets are mysteriously disap- StarBasedSalvatore, Wars. on Episode the R. A.story II, by Attack George Of Lucas.The Clones. Ballantine, 2002. (I+) Rylant,ThisFlagRyan, Wepatriotic Pam Cynthia. Love. Munoz. picture Charlesbridge, book celebrates 2000. (P) the American flag. susAfterGrandmaSaenz, sombrillas friends Benjamin Fina maravillosas. and and Alire.family Her Wonderful notice Cinco that Puntos, Umbrellasher favorite 1999. / (P-I)Layellow abuelita umbrella Fina yis tratedAlsoBunnyThe read byCase and G. other Jack ofBrian the titles help ClimbingKaras. intheir The neighbor Cat.High-Rise Greenwillow, find Private her stolen 2000.Eyes binoculars. series(P & I) illus- El ASalas-Porras,torn,ratoncito nursery Grandma pequefio rhyme Pipina. Fina in / SpanishThegets Littlequite and Mouse.a surpriseEnglish. Cinco on herPuntos, birthday. 2001. (T-P) secretHenry(PRylant, & I) message.and Cynthia. Mudge Also haveand read the fun otherSneaky with books a Crackers.new inspy the kit SimonHenry as Henry Schuster,and decodesMudge 1998. a adesAFaSan retelling Mulan: Souci, as a boy TheRobertof andthe Story Chinese fightsD. of ain Woman poemthe army. about Warrior. a young Hyperion, girl who 1998. masquer- (I) Greenwillow,TheRylant,series. High-Rise Cynthia. 2000. Private (P-I) Eyes: the Case of the Climbing Cat. Blue'sture.SteveSantomero, Big and Treasure Blue Angela. go Hunt. on a Simontreasure Spotlight, hunt to find 1999. who (T) set up the adven- KidsSadler,neighbor'sThe High-Rise Can Judy Press binoculars. Ann. PrivateJumbo BookEyes ofsearch Crafts. for Kids the cat Can that Press, stole 1998. their (I & L) ShapeBlueSantomero, Detectives. finds shapes Angela. Simon in this Spotlight, lift the flap 1998. board (T) book. AlistairInSadler,A collectionthis In ReadingMarilyn. Outer of Space. handicraftsRainbow Simon book, for Schuster children. Alistair 1985. is off (P) on another adventure. PlaySantomer,Welcome Blue's Angela. Cluesto Blue's in thisClues. lift-the-flap Simon Spotlight, board book. 1999. (T) Savary,Caillou Fabien. Tell Me Where. Choette, 2001. (T) MathScieszka, Curse. Jon. Viking, 1995. (P & I) TheSavary,Caillou popular Fabien. Where PBS Is character It? Choette, explores 2001. in (T) this pull-the-tab book. TheNotScieszka,In this SoTime book,Jolly Jon.Warp Roger.life Triois one Viking, meets big math 1991.Blackbeard problem! (I) in this clever and fun title. PieScarry,Sneaky Rats Richard. Ahoy. pirates Random steal Uncle House, Willy's 1994. pie. (P & I) ThisDr.ABCs.Dr. Seuss's is Seuss. a delightful ABC: An Dr. Amazing Seuss boardBook. bookRandom of rhymes House, that1996. teaches (T & P) the Schroeder,MopMop'sSchaap, the Treasure Martine. sheepdog Alan. Hunt. has McGraw a treasure Hill, hunt 2001. in Granddad's (T) living room. ATheShakur, collection Rose Tupac. That of Grewpoems From of love Concrete. and hope. Simon and Schuster, 1999. (Y) Schroeder,FictionalizedMinty. Dial, Joanne 1996. story F.(I)of the childhood of Harriet Tubman. AHarperCollins,MoreShannon, collection Stories George, ofto folktales2000.Solve: editor (I+)Fifteen for children Folktales to fromsolve. Around the World. storyteller.SimpleFun Puppet puppet Skits skits for andSchools patterns and forLibraries. the beginning Teacher puppeteer Ideas, 1995. and (L) YetStillShannon,World. anotherMore Morrow, George,Stories collection to1996editor Solve: of (I+) folktales Fourteen for Folktales children from to solve. Around the format.PresentsHowSchwartz, Much concepts David Is a Million? M. of a million, William billion, Morrow, and 1985. trillion (P in& pictureI) book Stories2000.Shannon, to (I+) Solve: George, Folktales ed. from Around the World. HarperCollins, AIfSchwartz, Youmathematical Made David a Million. magicianM. Pearson, guides 1989. the reader (P & toI) learn about money. 259 Another collection of folktales for children to solve. NateSharmat, the Great,Marjorie San Weinman. Francisco Detective. Delacort, 2000. (P-I) officer.A nonfiction story about a dog whose job is to protect a police DetectiveNateSharmat, the Great.GreatMarjorie Nate travelsYoungfinds W. his toYearling, friend'sSan Francisco 1977.lost picture (P to & solve I)of a a dog. mystery. Also read DetectivethreeDetectiveSkofield, cases. Dinosaur. James. Dinosaur HarperCollins, and Officer Pterodactyl 1996. (I+) are challenged to solve JasonShusterman,otherThe titles MillerDark in Side livesNeal. the of Nate in Nowhere. the the most Great Tor,boring series. 1999. city (I+) ever. At least that's what TheHarperTrophy,TheSnicket, three Bad Baudelaire Lemony.Beginning 1999. children(A (I) Series find of Unfortunate themselves Events,in one unfortunateBook 1.) Sierra,sciencehe thinks Judy. fiction before for strange boys and things reluctant start happening. readers. This is great ChessSnyder,adventure for Robert Juniors: after M.another. A Complete Read Guideall nine for books the Beginner. in the series. Random older,Rhymes,(L)The withFlannel chants, accompanying Board songs, Storytelling and flannel stories Book, board for children2nd patterns Ed. H.W.from Wilson,preschool 1997. and TheSnyder,House, basics 1991.Zilpha of chess (I+) Keatley. are presented along with strategies for winning. theirActivitiesGamesSilberg, development. To Jackie. forPlay parents With Toddlers. and teachers Gryphon to use House, with toddlers 1993. (L) to enhance feelingsnearbysuddenWhenSpyhole Hallie building death, ofSecrets. anger and Hallie andDelacorteandher hermothergrief.begins involvement Press, tomove spy 2001. toon a helpsa new (I+)troubled hertown begin familyafter to her livinghandle father's in her a InteractiveTreasureSimon, Susan. Hunt. board Dutton, book for2002. toddlers. (1) EncyclopediaDelacorte,Sobol, Donald 1999. Brown BrownJ. (I+) andsolves the tenCase new of themysteries Slippery including Salamander. "The Case AeroSinneberg, and Officer Mike Mike: Turner. Police Partners. Boyd Mills, 2001. (I) 260 of the Slippery Salamander". EncyclopediaEncyclopediaSobol, Donald. Brown Brown and saves the Case the dayof Two and Spies.solves Skylar, ten cases! 1995. (I) AdamAdamStanley, Sharp, Sharp George The does SpyEdward. it Whoagain Barked. in this fun Golden, spy story 2002. for (I) early readers. What'sChato'sChatoSoto, Gary. y cooking Kitchen.su cena. in Putnam, Chato's 1995.1997. kitchen? (P-I) Chato the cat prepares frijoles, hunt.SonnySonny'sStubbs, the Lisa.Treasure duck is Hunt. bored Barrons, so his grandfather 1999. (T) sends him on a treasure Soto,mice...orguacamole, Gary. will fajitas, the mice and be other Chato's tasty dinner? treats as dinner for a family of Sterling,CleverSukach, Quicksolve Jim.1999. (I+) Whodunit Puzzles: Mini-Mysteries for You to Solve. masaMariaQueToo mont6n for managesMany the deChristmasTamales. tamales.to lose Putnam, hertamales. PaperStar, mother's 1992. 1996.diamond (P-I) (P-I) ring while kneading AmericanImaginarySullivan,Children canCharles. poetsGardens. try aretheir pairedAbrams, hand withat 1989.solving American (L) these artists mini-mysteries. in this delightful Stevens,Carlos Janytriesand el Romero. zorrillo. theto showSkunk. Turtleback, off Northland, and gets 2001. more 1997. (I+) than (I+) he bargained for. MeSweeney,poetry and collection. My Joan. Place In Space. Dragonfly, 1999. (P & I) PeterTheSpier, Star-Spangled SpierPeter. illustrates Banner. the national Yearling anthem. 1992. (P-I) HaveTafuri,A motheryoung You Nancy. Seen astronaut duck My searches Duckling? leads forreaders herBeechtree, duckling. on a tour 1996. past (T) each planet. ers.SimplePaperStangl, Stories. Jean.cut and Fearon, tell stories 1984. for (I beginning& L) and experienced storytell- Tafuri,A Wherehide Nancy. and Did seek Bunny story Go? with Scholastic, Bunny and 2001. Bird. (T) 261 toPictureTang, Grapesembark Gregory. Puzzles of on Math: some accompanied Mind inspired Stretching problem by clues Math solving. in verseRiddles. encourage Scholastic, readers 2001. (I) A An1996.Thompson,Pirate's exciting, (I) Life Julie. Forfact-filled Me!: A voyage Day Aboard of a crew a Pirate on a Ship.pirate Charlesbridge,ship. RhymingMathTang, forGregory. Allmath Seasons. puzzles Scholastic for a younger 2002. audience. (P & I) Railroad.Tobin,AHidden scholarly Jacqueline Bantamin Plain mix Doubleday, L.View:of oral A history Secret 2000. andStory (I) cultural of Quilts exploration and the Underground with in- PopularSailorTakeuchi, Moon, TV Naoko. show's Vol. 1. graphic Mixx Entertainment, novel counterpart. 1998. (I+) Angst!:Tom,depth Karen. Teeninformation Verses Fromon quilts the Edge.and the Workman, Underground 2001. Railroad. (Y) storeMartyTashjian, owner, FryeFrye, Janet. solves Privateand his three Eye.younger separate Holt, sister. 1998. mysteries (I+) for a classmate, a toy Toropov,TheAn anthology Complete Brandon. ofIdiot's poems Guide written to Urban by teenage Legends. girls. Alpha, 2001. (Y) Wordplay.FunnyTerban, You Marvin. Houghton Should Ask: Mifflin, How 1992.to Make (I+) Up Jokes and Riddles with DragonToriyama,Urban legends Ball Akira. Z. madeVol. 1. easy. Viz Communications, 2000. (I+) Ha!Thomas,engagingAn Ha! abundance Ha!:Lyn. riddles 1,000+ of andideas Jokes, jokes. for Riddles,using words Facts, and and wordplay More. Firefly to create LasTorres,GerardMeet abuelas the Leyla.Jones. TV de characters Liliana / fromLiliana's Dragon Grandmothers. Ball Z. English Farrar, adaptation 1998. (P-I) by brainA Books,treasure teasers, 2001. trove and (I+) of word jokes, games. intriguing puzzles, challenging riddles, Torrey,oneLiliana who Michele.has lives two in grandmothers, another country. one who lives down the street and FamousThomas,Undercover spies Paul. andAgents. secret Raintree agents Steck-Vaughn, in history are profiled1998. (I+) in this book. 262 skillsDrakeThe Case to and solve of Nell the a varietycombineGasping of Garbage.their cases. detective Dutton and Children's, scientific 2000. investigation (I+) PoemsDoTucker, Pirate about Kathy. Take different Baths? aspectsWhitman, of pirate1994. life.(P & I) ProgrammingWadham,1999. (L) Tim. with Latino Children's Materials. Neal-Schuman, Tudor,CalebThe GreatTasha. Corgi, Corgiville dog detective, Kidnapping. investigates Little Brown,a gang of1999. unruly (P &raccoons. I) ContainsGhostWallace,A wealth Poems. Daisy.17of ideaspoems Holiday for about Hispanic House, ghosts, 1990. library including (L) programs. the "Teeny Tiny Ghost" TheAeroTurner, true and Kris. story Officer of aMike police Police dog atPartners. work. Boyd Mills, 2001. (I) byTheWarner, Lillian Copycat Moore. Gertrude Mystery. Chandler. Albert Whitman, 2001. (I+) whiteMysteriesReadersVan drawings. Allsburg, of are Harris invited Chris. Burdick. to tell Houghtonthe stories Mifflin, of fourteen 1984. enticing (I) black and housework.A series makes of thepractical Aldens jokes wonder at a ifrestored the ghost nineteenth-century of its builder is at farm- TheSecretVaughan, story to Freedom. of Marcia.how quilts Lee and contained Low, 2001. a secret (I) code for locating the Learn2001.Games,Warner, to (Y)Sign Puzzles,Penny. the Fun and Way: Activities Let Your in American Fingers Do Sign the Language. Talking with Prima, Reader'sTeatro!Vigil,underground Angel. Hispanic theater railroad. presentationsPlays for Young for People.teens. Teacher Idea, 1996. (L) Simple"CutWan-en,Provides and cut Jean.funTell" and activities Scissor tell stories Storiesto learn for forpreschoolers. American Fall. Warren, Sign Language. 1984. (L) Slam.andRantsVon AlloyBooks, muchZiegesar, of the more. beat Cecily. 2000.poets, (Y) verses of Shakespeare, rhymes of hip-hop, faceAStartingWatt, simplepainting Fiona. Face face and Painting.painting disguises. bookUsborne, featuring 1997. how-to (I & L) ideas for all kinds of 263 Weatherly,Women Pirates: Myra. Eight Stories of Adventure. Morgan Reynolds, 1998. WhoWilder, Am Alice. I? A Book to Touch and Feel. Simon Spotlight, 2000. (T) Bonny,True(I-Y) life Cheng stories I ofSao, women Rachel pirates, Wall, includingand Fanny Grace Campbell. O'Malley, Anne IInteractive WentWilliams, Walking. Blues Sue Red Clues Wagon, book. 1996. (T) GoodTheWeiner, 101 introductory Stephen.Best Graphic reference Novels. book NBM, for 2001. librarians. (Y+) Wilson-Max,animalsA young in girl this Ken.takes simple a walk board around book. the farmyard and spies many ThehisDavidAfterWerlin, Killer's last being Yaffe yearNancy. Cousin. put ofleaves high on Laureleaf, trial townschool. for to the liveA 2000. suspensefulaccidental with (Y) his aunt death ending and of uncleandhis girlfriend,colorful and finish shuttleThisBigWinter, Silver creative, to preschoolers.Jeanette.Space interactive Shuttle. Cartwheel,mini board 2000. book (Tintroduces & P) the space AuntFreedom'sWesley,characters Marshall Valerie Gifts:make tells Wilson. Athis Juneteenth the a great story book ofStory. the for firstSimon discussion. Juneteenth Schuster, and 1997. the (P gift -I). of cassette.guideWeavesFollow them the history Drinkingon the and underground songGourd. to Knopf,describe railroad. 1992. how Available (Pslaves & I) used with the audio- stars to freedom.OwenWeston, Foote,Foote Martha. thinksSuper Spy.that spyingHoughton is the Mifflin, coolest 2001. thing (I) in the world. AnotherPlays,ForPlaysWinther, Young From 1998. bookBarbara. People, Hispanic (L) with Fromtales Tales readyHispanic : One-Act, to perform Stories Royalty-Free Andas plays Folktales. or Dramatizations as reader'sBoston: DetectiveDetective(I+)Whatley, Donut Bruce. Donut and and the his Wild partner Goose Mouse Chase. set HarperCollins, out to find Professor 1997. PatrickCompleteWolff,theater. Patrick. Wolff, Idiot's a GuideU.S. Chess To Chess. Champion Alpha andBooks, International 2001. (Y+) Grandmas- disappeared.Drake, the world-famous archaeologist who has mysteriously 264 basics.ter, teaches readers quick and easy strategies for learning chess A guide to hosting summer reading clubs and library programs for LittleElWood, Child'sratoncito, Mouse, Don. Play, la the 1984.1996.fresa Red roja (P-I)Ripe y Strawberrymadura y el and gran the oso Big hambriento. Hungry Bear. Zeibel,teens.Where Peter. Am I? Learning Riddles. Scholastic, 1999. (T & P) DescribesCriminalWoodford,A little mouse Investigation. variousChris. fears techniques that Raintree bear willand Steck-Vaughn, eatdevices his red used ripe to 2001. strawberry. investigate (I+) and PhotographicATheZhang, Chinese Ballad Song girlpictureof Nan. Mulan. disguises riddles Pan herself forAsian, the as 1998.very a boy young. (I) and goes into battle. Wright,solve crimes. Kristine. LiftWhereZiefert, the is flapHarriet. My board Baby? book. Handprint , 2002. (T) A Yee,CollectionTeen BrendaWriter's of Shannon. poetryDream, written Poetically by American Correct. Be-Mused, teenagers. 2001. (Y) LiftZiefert,Who the SaidflapHarriet. board"Moo"? book. Handprint, 2002. (T) CommanderYolenAHide mouse and Jane. Seek.and Toad a Orchard,maid and play the 2001. hideIntergalactic (T)and seek. Spy. Putnam, 1997. (P+) RecountsEspionageZiff, John. the and stories Treason. of some Chelsea of the House, world's 2000. most (I+) famous spies and cousinTheYoung, Star 007 Warts Ed. is on a dangerous mission to find Commander Toad's _. (P+) Zion,andtraitors Kim Gene. Philby. including Benedict Arnold, Aldrich Ames, the Rosenbergs, SevenYoungblood,Indian Blind fable Mice. beautifully Lisa Puffin, 2002.illustrated (T & by P) Ed Young. untilHarryHarry he the hasis Dirty unrecognizable a bath. Dog. HarperCollins, when he returns 1956. from(P & aI) day of exploration TexasNo Limits State Read: Library Young and ArchivesAdult Reading Commission, Club and 2002. Program (L) Manual. 265 Zoehfeld,CanWho's you Hiding?: Kathleen help Pooh With Weidner. find Big his Flaps friends for Little in this Hands. board Disney,book? 2001. (T) Amelia,Cicada..nagaztv-es 329 E. St., Bakersfield, CA 93304. GoodnightBlue'sAudio Clues. Blue.Reconijngo Rhino, 1999. (CD) (T) E.Mad.PresentsEmail: C. Publications, [email protected] oriental poetry Inc., 1700forms Broadway, and related New fiction York, and NY articles. 10019. DisneyChooBuckwheat Soundtrack.Choo Zydeco.Boogaloo. Music For Little People, 1994. (CD) (P+) LampoonsSatirizeswww.modmag.com all popular social andfilms political and television aspects programs.of contemporary life. Mission:Elfman,Peter Pan. Danny.Impossible Disney 2001. (CD) (P+) Music from the Original Motion Picture Score. creativeOffershttp://teenink.comYoungTeen Ink: teenagersAuthors work Written on Foundation, bythe the Teens. opportunity issues POthat Box affectto publish 30, their Newton, their liveseverything opinionsMA 02461 and from Harris,FilmPolygram, Music Kim 1996. byand Maurice (CD)Reggie. (I-Y) Jarre. Music Club,1996. (CD) (I+) 35209.SouthernWizardlove and familyProgress to teenCorp., smoking 2100 Lakeshore and community Drive, service. Birmingham, AL CadaHinojosa,(CD)Steal (P+)Away:nifio Tish. /Every Music Child. of the Rounder, Underground 1996. Railroad. (CD) (T-I) Appleseed, 1998. WizardMagazinewww.wizardworld.com Anime for comics, Invasion animation, movies, toys, and more. 2000.BlueHowe, Avenger (cass) Norma. (Y) Cracks the Code. Random House/Listening Library, Magazine35209Southern Progress for anime Corp., and manga. 2100 Lakeshore Drive, Birmingham, AL (cass)SpidersHolt, David.(Y) in the Hairdo: Modern Urban Legends. August House, 1997. Stormbreaker.(Y)Horowitz, Anthony. Random House Audio/Listening Library, 2001. (cass) DeOrozco,TheOriginal colores Unsinkable Jose-Luis.Broadwayand Other Molly Latin-AmericanCast, Brown. 1960. Angel, Folk 1993. Songs (CD) for (I Children.& Y) AfricanJenkins,1995. American Ella. (CD/cass) Folksongs (T & P) and Rhythms. Smithsonian/Folkways, LtricaOrozco,Arcoiris, infantil Jose-Luis. 1996. con (CD/cass) Jose-Luis (T-I) Orozco, Volumen 2. Arcoiris, 1995. Jenkins,Folkways,Counting Ella. Games 1967. (CD/cass)and Rhythms (T &for P) the Little Ones. Smithsonian/ LtricaOrozco,(CD/cass) infantil Jose-Luis. (T-I) con Jose-Luis Orozco, Volumen 3. Arcoiris, 1995. HeyEarlyLouchard, Ludwig: Childhood R.Classical Songs. Piano Smithsonian/Folkways, Solos for Playful Times. 1990. Rounder,(CD) (T & P) Ltricamovimiento.Orozco,(CD/cass) infantil Jose-Luis. (T-I) con Arcoiris, Jose-Luis 1995. Orozco, (CD/cass) Volumen (T-I) 4. Animales y InfantilesLiscano,1992. (CD) por Hugo. (T-P)Hugo Ltscano y Javier Caine, Vol. 1. Anes, 1995. Uticacolores.Orozco, Infanta Arcoiris,Jose-Luis. con Jose-Luis 1995. (CD/cass) Orozco, Volumen(T-I) 5. Letras, mimeros y InfantilesLiscano,www.liscanogalue.com(cass) (T-I) Hugo. por Hugo Liscano y Javier Galue, Vol. 2. Anes, 1996. FollowRabbit Ears.the Drinking Gourd. Madacy, 2000. (CD) (I) Moyers,www.liscanogalue.com(cass) (T-I) Bill D. Raffi.Baby Beluga. Rounder, 1996. (CD) (T & P) Audio,The Language 1995. (CD) of (Y)Life: A Festival of Poets. Bantam Doubleday Dell 267 Raffi's Christmas Album. Rounder, 1996. (CD) (T & P) Various Artists. SingableRaffi. Songs Collection. Rounder, 1997. (CD) (T & P) Various(CD)Mission (P+) Artists.Accomplished: Themes for Spies and Cops. Hip-0, 1996. SingableRecords:TheShakur, Rose Songs Tupac. DistributedThat for Grew the Very Fromin the Young. Concrete: U.S. by Kimbo, Universal Volume 1976. 1. Music (CD)Amaru/Interscope (T-P)and Video SingVariousMusical America. Artists.Adventures Warner of Brothers,Peter Pan. 1999. Varese, (CD) 1996. (T+) (CD) (P+) SingSharon,Distribution, Around Lois the 2000.and Campfire. Bram. (CD) Drive,(Y) 1995. (CD/cass) (T & P) VariousSpy Kids Artists. Soundtrack. Chapter III Records, 2001 (CD) (P+) VariousBigTrout Trouble. Fishing Artists. Trout, in America. 1994. (CD) (T & P) (CD)SpyYour Kids (P-I) Introduction Motion Picture to Morse Soundtrack. Code; Morse Chapter Code III Practice. Records, American 2001. VariousPicture.Austin Powers: WarnerArtists. Spy Brothers, Who Shagged 1999. (CD) Me: (I+)Music from the Motion Radio Relay League, 1989. (cass) (Y) Blue'sVariousBig(T+) Blues: Big Artists. Treasure.Blues Music Rhino, for Kids.1999. Music(CD) (T) for Little People, 1996. (CD) videosNote:VideoTecolictirlys Librarians shown in programsmust have at publicand the library. DVDperformance rights for all (T+)AVarious Child's Artists. Celebration of Song. Music for Little People, 1992. (CD) AntarcticemperorA humorous Antics. penguins. collection Weston Woods,of poems 2000. that (5pay minutes) tribute (T-P)to Antarctic Antitrust.conspiracyA young MGM computer after Home his whiz best Entertainment, getsfriend caught is murdered. up2001. in a (108 web minutes) of deceit (Y)and Autes)The thief Castle (Y+) and ofhis Cagliostro. gang fight Mangato free aEntertainment, princess from 1979.an evil (110 force. min- Arthur'sJoin Arthur MysteryTreasure from Files.Hunt. the MarcRandom Random Brown House, House, series 2001. 1999. in some (18 (60 minutes) minutes)new adventures. (T-P) (T I) butterflyTwoutes)The friends,(T Caterpillar & and P) a frog.caterpillar and The and Polliwog. a polliwog, Weston grow Woods, up and 1988. turn (7into min- a Starmaker,FeaturesThe Best two 1992.of episodes Saturday (93 minutes)from Night PBS Live (Y+) TV 1975-80: show. Classics Vol. 3. Chato,Chato'sChato y a Kitchen.su sly cena. cat from Weston an EastWoods, Los 1999.2000. Angeles (11 barrio,minutes)minutes) invites (P+)(P+) the mice TellsBreakingseasons.Selections the lifethe fromstoryCode. theof Video the television famed Treasures, mathematician comedy 1997. series (90 minutes)andduring computer the (Y+) 1975-1980 BasicChessnext door chessStarts over movesHere! for dinner. Chesswith some Beat, advanced 1996. (60 strategies. minutes) (Y) AlliedduringMachine,science victory.World pioneer an early War Alan computerII whichTuring, many used the primarytobelieve solve wasdesignerthe Germaninstrumental of the Enigma Turing in the code BOOMaInChicka lowercase this animatedChickaBOOM". alphabet Boom version Boom.that of end Lois Scholastic, up Ehlert's in a big 1999. book, heap (6 withthe minutes) 26 a "Chickcharacters (T-P) Chick are TheA dubbedgreaterBug's delightful Life. thanin Spanish. Buena eatinganimated Vista, and story fearing 1999. of an (95local ant minutes) grasshoppers.who searches (P+I) Alsofor a lifeavailable Chrysanthemum.AChicken delightful Soup poetry With Weston rompRice. throughWestonWoods, Woods,1998.the months (12 1978. minutes) of (5the minutes) year. (T-P) (T-P) (I+)The Carol Burnett Show: A Reunion. Fox Video, 1996. (90 minutes) parentssheChrysanthemum goes and to schoola wise is andmusica mouse is teasedteacher who about believesnamed it byDelphinium her her name classmates. is reassureperfect Her until her. BurnettA collection Show. of some of Carol's favorite moments from The Carol 269 WestonThe Day Woods, Jimmy's 1993. Boa (32Ate minutes)the Wash (T-P) and Other Funny Stories. Desctibrelo,Whenand therehis class isVol. havoc visits 1 & atthe2. every Conaculta, farm, turn. Jimmy Available1990. brings (20 minutes)inhis English boa constrictor (P-I) and Spanish. HarrietsimplicityLawrence's the and Spy.paintings power. Paramount, portray Ruby 1996.Dee the spiritnarrates. (102 of minutes) Harriet Tubman(I+) with Descabrelo,Thistics. video contains Vol. 3 & information 4. Conaculta, about 1990. bugs (20 and minutes) their characteris-(P-I) HarrysecretEleven-year-old thenotebook Dirty Dog. ofHarriet what Weston sheloves sees. Woods, to spy on1997. her (19friends minutes) and keeps (P & I)a ADisney'sThis live-action video Treasure describes retelling Island. different of Disney,Robert animals Louis 1950. Stevenson'sand(90 minutes)their characteristics. classic (I-Y) book. HowspotswithHarry Much white in changes this Is A live Million? from action a white Westonclassic dog video.Woods, with black 2000. spots (12 minutes)to a black (P dog & I) likeknownFoolingDepicts(Y+) a professional as with thethe Words "Woodstockaction sports with at the Billevent of Geraldine Poetry".Moyers. as cameras R.ThePBS, Dodge event tracking1999. Poetryis (120covered the minutes)Festival, performing much LifeI,Kellogg'sConcepts Crocodile. is good illustrations.of foraWeston million, a Nile Woods: crocodiletrillion, Scholastic, and until billion Napoleon 2001 presented (10 shows minutes) with up Stevenand (T-P) wants BenjiForpoets the and Love thehis of adoptedspectators' Benji. Mulberryfamily reactions. set Square, out for 2001.a vacation (85 minutes) in Greece (I+) and I Knowmummies,one of What everything obelisks,You Did in Lastandsight yes,Summer. for aa crocodile.Parisian Columbia fountain TriStar, display, 1998. including (101 I)becomeGeorge entangled Washington's in a spyMother. plot. Weston Woods, 2000. (20 minutes) (P- yearmistakeAfterminutes) later, an ofaccident(Y+) thedumping dead on man theira winding returns victim's road,from body fourhis into watery teens the make sea.grave Exactly the and fatal he's one HarrietpresidentA lively and depiction of thethe PromisedUnited of the States. story Land. of Spoken Mary Ball, Arts, the 1998. mother (8 minutes)of the first (P- I StillRemember(100looking Know minutes) for What moreBen (Y+) YouWillis, than Did an the apology.Last man Summer. in the slicker Columbia with TriStar, a hook 1998. in his I) 270 hand ready to exact bloody justice? Well, he's back. It's hard to 111 Lastforget Summer. a man who refuses to die. Sequel to I Know What You Did 2001.MauriceLittle (34 BearSendak's minutes) and hisLittle (T-P) friends Bear: look Little for Sherlock clues, solve Bear. mysteries, Paramount, and IndianaThisIn the backyard Tall, Jones Tall andnature Grass. the tourTemple Spoken is from of Arts, Doom. Denise 1994. Paramount, Fleming's (6 minutes) picture 1984. (T) (118 book. 2000.Montymake new(60 Python's minutes) discoveries Flying (Y+) inCircus: their backyards.Volume 13. A and E Home Video, slavedAnkaraIndianaminutes) by StoneJones, (I+) a mysterious and the todaredevil save cult. hundreds archeologist, of children is out who've to find beenthe famous en- AMurderTwo televisionsatire episodes byabout Death. series, ofmurder comedy Columbia, "Monty mysteries sketches Python's 1976. that from (94 Flyinginvolves minutes) the thirdCircus". five (Y+)season famous of literarythe LaAIf Imagician gallinitaMade A rojateachesMillion. y otros about Weston cuentos money. Woods, populares. 2002. Weston(12 minutes) Woods, (P &1996 I) (37 housedetectivesAnOver endearingin In which theand Meadow. their theyversion sidekicks are Weston ofguests. a classic who Woods, must counting 1988. solve rhyme.(9 a mysteryminutes) at(T the & P) theyTheLaraminutes) Littleare Croft: all Red (T-P)too Tomb busy.Hen asksRaider. her Paramount, friends for 2001.help in (102 baking minutes) bread (I+) but Pete'srate.Pete's a Pizza.parents Scholastic, turn him into2000 a (6pizza minutes) to make (T-P) his bad mood evapo- planetsmustancientWith fighther andartifact father her sun nemeses thatpresumedalign. can in alter orderdead, space toLara restore and must time harmony, race if notto recover destroyed. all before an theShe Adams.includingDirectorPoetry in Ron Motion.Allen Mann Ginsberg, Home has put Vision Leroi together Cinema, Jones, readings Anne 2000. Waldeman,by (90 24 minutes) different and (Y+) poetsHelen watchLeoLeo,Leo's the el him retolioLateparents constantly. Bloomer. tardlo. are concerned Weston Weston Woods, Woods,that Leo 2000. 1999. is a (6late (6 minutes) minutes) bloomer (T-P) (T-P)so they Puppy?ThisThe animated Poky Little classic Puppy. asks Lucerne the question Media, where 1999. is (7 the minutes) Poky Little (T) 271 AnPrincess epic journeyMononoke. in which Miramax, Ashitaka 1999. tries (133 to minutes) find a cure (Y+) for Maestro'sStory of Statue book ofis broughtLiberty. toSpoken life on Arts, film. 1991. (7 minutes) (P-I) smallAfterRainbowTatarigami's aboy rainy of finds My curseday aOwn. ofreal but playing rainbowLive finds Oak imaginaryhimself waiting Media, in for gamesa1987. different him (5with at minutes) home. battle.a rainbow, (T & a P) TopSpytheir Kids.international kids Buena who bringVista, spies the 2001.are family called (88 backminutes)out on together. a (I+)secret mission and it is intoTheRecess: kidsschool School's from to savethe Out. Recess their Buena summer TV Vista, show recess. 2001. become (84 spies minutes) who (I+)need to break Superman.ThetionalThe newly Star-Spangled Anthem. animatedWarner Brothers, versionBanner. of 1978.Weston Peter (144 Spier'sWoods, minutes) depiction 2002. (Y+) (7 ofminutes) the Na- (P-I) Aminutes)Rosie hilarious O'Donnell's (I+) look at Kids children are Punny, and what HBO they Home think Video, is funny. 1998. (30 Sylvester(P)Christopher and the Reeve Magic portrays Pebble. Superman Weston Woods, in this 19781998. classic. (11 minutes) Slamnation.LiveScooby coverage Doo'sDoo Cinema appears Greatest of performances Guild, in Mysteries. four 1998. favorite and(92 Warner, judgingminutes)mysteries. 1998. in (I+) the (109 annual minutes) 1996 (P-I) TheLithgow.AnimatedThis classic Land version American Is Your of Land.the folk classic songWeston performedchildren's Woods, book,by2001. Arlo narrated(11 Guthrie. minutes) by John (P+) TheSpiderman.poetsNational origins from PoetryColumbia,of 27 Spiderman teams Slam 2002.gathered. held and in(121 his Portland, nemesisminutes) Oregon the (Y+) Green at which Goblin over are 120 tale.AnThe animated Three Littleversion Pigs. of JamesWeston Marshall's Woods, 1991. retelling (12 minutes)of this classic (T & P) Spotrevealed(30 and minutes) inHis this Grandparents (T-P) action-packed Go movie.to the Carnival. Buena Vista, 1997. Thomas.A(50Treasure! tour minutes) of jewelsJewels (Y+) ofof thethe BritishBritish royalCrown. family A and by E crown Home jeweler, Video, 2000.David Spot's adventure at the carnival. 272 Hanukkah,Winter Holiday Christmas, Stories. and Scholastic, Kwanzaa 1999. are (27celebrated minutes) in (T-P)these three Uses1998.Where clues(I+) in the about World world is Carmen geography, Sandiego? history Broderbund and culture Software, to help the winter holiday stories. world'sWhereuser track most in Time Carmenfamous is Carmen landmarksSandiego Sandiego? and and her treasures. gangBroderbund as they Software, steal some 1997. of the Blue'sDetectiveFun Treasuregame Barbie.based Hunt. on Mattel Infothe TV Games,Media, special. 2000.1999. (I)(T & P) havearoundCarmen(I+) a timethe and world, machineher V.I.L.E. stealing to use henchmen historical in tracking travel treasures, them through down. but timethe good as well guys as I SpyOriginalHelp Junior: Barbie stories Puppet find come the Playhouse. missing to life withjewels. Scholastic, hand made 2000. puppets, (T) props and userUsesCarmen1995. track clues (I+)Sandiego: Carmen about world JuniorSandiego geography, Detective and her Edition.history gang as and Broderbund they culture steal tosome Software, help of the the andEmbarkIsets. Spy solve Treasure on riddles. an adventureHunt. Scholastic, to smugglers 2001. cove(P) to find hidden treasures world's most famous landmarks and treasures. JoinScooby Scooby Doo: Doo Phantom and the of thegang Knight. in search Learning of suspects. Co., 2000. (I) Interactive,NancyVicteoNancy Drew goes Ganeo 2001. Message to San (I+) Francisco in a Haunted and Mansion.tries to solve Dream a mystery Catcher at her SecretJoinScoobytingling Scooby Agent Doo: mystery. DooShowdownBarbie. and Vivendi the in gang Ghost Universal, on Town. a quest Learning2000. for clues (I) Co., to 2000.solve (I)a spine- friend's new mansion. Track clues around the world and solve this spy adventure. 273 mooto v. 'possible: GLI-P ART b10. c)c) an op IC) CO it qtD dp 60 40 (I° (lb 60 (10 dt3 00 457 go ao cb 40 at; it7 qc, nizotov. Pozonie: 3F9 a. Bo reproducePublicThe Texas Libraries allState clip aLibrary non-exclusive,art in the and Texas Archives non-transferable, Reading Commission Club manual limited grants to rightTexas pro- to Accepta.lie troe of cLLp all to organizationlibrarythe Texas directly State and or Library sales through are and limiteda FriendsArchives to ofTexas. Commission,the Library Direct questions 512- decorations.tomote create their items libraries such and as crafts,the Texas t-shirts, Reading programs, Club. Itand may library be used air Art work may not be changed463 orLibraries -6624.modified may in resizeany way. and reverse the clip art, but may not Certificates,Dooknarks, 1?.eacti11g Borders, buttons, Logs, aiic mr- In accordance with the artist's contract, the clip art by G norel edited,ownedalter it. orbyThe modifiedthe name illustrator of without the libraryand permission. should may notbe added,be touched but the up, art is clipmanual/clipart/clipart.html.Library'sReadingBrian art Karas ontoClub web has theirmanualsite been at web www.tsl.state.tx.us/ld/projects/trc/2003/ insertedand sites. uploaded Libraries intoThey the onto may, printedmay the however, not Texas 2003 upload State Texas link this To 150e Clip liTt carair StartChoose with the your clip text art thatidea. best matches your text. notTexasandtheirTexas limitedon web libraries the State Texaspagesto, Texas Libra'',for State toany Readingthe library-relatedwebLibrary clip site. Clubart web The that Promotional site purpose,art is may workuploaded be including, inmaterials. used the on manualby the but Gerow- PlaceScan orthe copy scanned the clip clip art art and in your reduceit out computer and or enlarge paste document, the it ifclip needed. art or tocut your hardcopy original. sr Public libraries in Texas may usethat the will art be work sold to only create if the items proceeds are returned to the 274 air Add finishing touches, and print or copy your masterpiece! ntootov. Pool lie: spyabook!

Sponsored by your library and the Texas State Library & Archives Commission

Sponsored by your library and the Texas State Library & Archives Commission ntootov Pozon) le: spyabook!

Sponsored by your library and the Texas State Libr4 941 chives Commission A. 0 BoTcCeTO Use these borders and banners to decorate your letters, press releases and flyers

dress getease

OE" c.(9 00 00 GC, °o 0,7 ap CO 0t, Cht, 0C> (20 CO 00 Cc) 40 IC) circ,

cur:=3 op OC7 a7 ap <3c> a:,dc3, Cr,40 CP c7 cc>cic)Co a:, co cc,CO CO Qb ob, ap

290 iAccion, espionaje, aventuras...en to biblioteca! iAccidn, espionaje, aventuras...en la biblioteca! iriecion, espionaje, aventuras...en la bibliotecal jAcciOn, espionaje, aventuras...en fa bihtioteca!

4s;i:140.1:11.4ELJe>, ax,-v ie,xx t ILXWEILP3...41E,KIL 1a c. teem' iACCIoN, IESPIONMIE, AVIENTURAS...IEN IA 131131.10TECA! espionaje, aventuras...en la biblioteca!

IC-11111

Mission Possible: Spy A Book!

Mission Possible: SpyaBook! Mission Possible: Spy a Book!

Mission Possible: SpyaBook! ivaiRowic,xx X`43ffie@iii. 1437- 1151, Books

MISSION POSS1131.IE: SPY A BOOK! Mission Possible: Spy a Book!

291 Texas Reading Club

278 Mootorl ?ozonic: 5F9 Texas Reading Club a Book! for support of the Texas Rea,: Wig GeTtificateAprectation LLIDTaT9 LibrarianGlilicro Nape Date Sponsored by your library and the Texas State Library and Archives Commission 279 njostorlNax2e Pozoilie: TN& Lo9 Spy a Book! Nanentootov. possible: 7'N° Log Spy a book! Last?holeCityAddress Day # to turn in 109 Last?hopeCityAddress Day it to turn ID log aracteAge GTacte50100[Age Write the CWTomotitles of the Reactbig books you read below: 2003 Write the Ckil)Teatitles of 2003the books you read below: Reactirly 4.3.2. 4.3.2. 5. Sponsored Cooperatively by your Library and the Texas State Library and Archives Commission 280 5. Sponsored Cooperatively by your Library and the Texas State Library and Archives Commission Writeon the the6. mouses' total number book: of books you read onWrite the6 the mouses' total number book: of books you read 9.8.7. 98.7. c1coT-) 11. 1210 1211.10. 15.14.13. 1514.13. 18.1716. 18.17.16 20.19. 281 20.19. .ntootov. Poostue: SF9 a Book! ntsztorl Pogue: 5F9 a Book! ?holeCityNate nDe Log PhoneCityNate Tine Log School, School ccIND LagAgeaTa0 Day to Tull). j1 Log LastG,Ta0 Day Turn in Log Sponsored CooperativelyTexas by State your Library LibraryTexas and and Archives the CommissionReacting Clol) 2003 Sponsored CooperativelyTexas State by your LibraryTexas Library and Archivesand the CommissionReading Club 2003 OD 6,0C) 6C) cc> (20 c7 ear, a cc) cc:, ao 6C:7 OC) 6P Qv ar, at:, an Clt7 282 6C7 oo at, CIC:. CC:, CO (7 clt:7, QC) CIO arm QC) 6c) °it, cc, Olt> an eV an youWrite read the each number day Put your of minuteson a book! youWrite read the each number day Put your ofon minutes a book! CC

283 ikactOzi, eoptovaje, ell la 1Di1Ltoteca! ikacti;ri, eoptovale, averitinao... ell La Iptlitotecal Co1itT01 01. MIT cCe Leettilla Not loTeGo 11t1101 cCet. neDpo cue Lectulta NonipTePhoCiudad De CiudadPhone oo G,TactoLowe La Ezatreia.EdadG,Ta40 Edad C1013 cue LectuTa C1013 cue LectuTa Comision dePromocionando Archivos y Biblioteca conjuntamente del Estado por deto BibliotecaTexas y la Texan 2003 Comisi6n dePromocionando Archivos y Biblioteca conjuntamente del Estado por tode Biblioteca Texas y la Texan 2003 CP6040 ce) ct, co dc, 0t7 co cc:, 6C, (to dc7 ao Qb cc> eb, an oc2 284 elD as 4c) at) cc, cc) ar=> ab ODdO 0E7 eic:, OCi at, Qb ap leyendo.calcularColorea losel tiempo libros paraque pasas leyendo.calcularColorea losel tiempo libros paraque pasas Pon el total aqui: ),, Pon el total aqui:

285 ikaatOD, eoptoale, ihactOD, optoale, avotrnao... NonbTe ell La 1311)Lierteca! Li.13T00 LeiCto0 NoT21,Te ev. La IiiNtotecal .13T00 Leictoo CitictactDITeaCtoriTelefoTioLtOta de rreteforioGluda-dDiTeccion CA) Uact etactoEsau*. E.:tactGsacC.0Escuela Anota el tituloTea de lose20031. libros que vayas leyendo: LeCtrna Anota el tituloTexasMob de delose 20031. Lectnalibros que vayas leyendo: 4.3.2. 4.3.2. Promocionando conjuntamente5. por tu Biblioteca y la Comisi6n de Archivos y Biblioteca del Estado de Texas 286 Promocionando conjuntamente5. por tu Biblioteca y la Comisitm de Archivos y Biblioteca del Estado de Texas queAnota sostiene el total los de ratoncitos:libros que leas en el libro queAnota el total de libros que leas en el librosostiene los ratoncitos: / 8.7.6. 8.7.6 911.10. 11.10 14.13.12. 13. 17.16.15. 171615 20.1918. 20.1918. 001."'

41111114141%.

00111111.

4141.1111er

.000° 6n lIt / 1 ? 06Z

10, 0 to

ri\ rn

og

Ctj

Cc;'

0;, (t3. a nq 0%9° Qe o 09 9

9 v0 Dv on

305 Z6Z e57 CZID U qa £6Z

S6z

Texas http://www.tsl.state.tx.us CommissionandState Archives Library U.S. Department of Education Office of Educational Research and Improvement (OERI) E IC National Library of Education (NLE) hbrational Resin= lainstioa Cada Educational Resources Information Center (ERIC)

NOTICE

Reproduction Basis

This document is covered by a signed "Reproduction Release (Blanket)" form (on file within the ERIC system), encompassing all or classes of documents from its source organization and, therefore, does not require a "Specific Document" Release form.

This document is Federally-funded, or carries its own permission to reproduce, or is otherwise in the public domain and, therefore, may be reproduced by ERIC without a signed Reproduction Release form (either "Specific Document" or "Blanket").

EFF-089 (1/2003)