DOCSLIB.ORG

At the Level of Gene Function: CHROMOSOME MUTATION

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
At the Level of Gene Function: CHROMOSOME MUTATION EFFECT OF MUTATIONS ON PROTEIN FUNCTION GENE MUTATION = POINT MUTATION (scales of mutation is small and is localized to a specific region, a single nucleotide or a few adjacent base pairs) ↓ at the DNA level: Ë single base pair substitutions: transitions & transversions Ë single (or a few) base pair addition or deletion: indels Ë gene mutation by transposon insertion at the level of at the protein gene expression: level: promoter mutations nonsense splicing mutations missense CHROMOSOME MUTATION regulatory mutations [neutral] • involves segments of chromosomes or silent whole chromosomes or whole genomes frameshift • alterations in chromosome structure and number • deletion, duplications, translocations and inversions at the level of gene function: • CNVs: copy number variations loss-of-function gain-of-function [neutral] 1 Finding your way around a eukaryotic gene ç upstream = 5’ of…. downstream = 3’ of… è 2 Conventions for displaying gene sequences: • Only the mRNA-like strand is displayed (complementary strand not shown) • Sequence reads 5’ to 3’ • A cDNA sequence will reflect the sequence of the spliced mRNA and will therefore not include intron sequence • A genomic sequence will include introns and exons and adjacent regulatory regions – sometimes the introns will be indicated in lower case and the EXONS in uppercase (see pg 8 of this lecture) 3 Genomic DNA sequence display LOCUS NG_011751 7897 bp DNA linear PRI 05-FEB-2012 DEFINITION Homo sapiens sex determining region Y (SRY), RefSeqGene on chromosome Y. TGACCTTCATTTTATGGAGAGAAACAAGCTATAACATGTAGTATCTAAGCTGATTAGAAGAACTAAAAAG AGAAGCTCATACTTGTGCATCAGAAGGTAAATGAAAGAGTGAAGTTACCTCTTTGTTTTAAGGAAGAAAG GAAAATTGTGGATGTCATCTGTTTTCTGTTTACATATTTCAGGCATGGATAGCCACAATGTGATTTTAAG ACGGTTAGTTACAACTGATTTGAAAAAAAAAAAAAATGCTTCACTCTATGAGAAATTTCTTCCCAAGTAT GAAACCTTGTTTTTACAGGCAATTTCCTATACTTTGAAAAAATCAAAATAATAAAGTAAAAGAAAAATAA TTCAGGTGAAGTTAGAGAAAAAAACAGGCAGCATTATTTTAAAGTTGTAAACTATTTTGTTTACTTATAG TTTAATTTACATGTAGTAGATATGCATTTGTAAGGTTCTTCGGCTCAGGTAGGAGATCATTCTATTTCCC ACTGCACCCTACTTCATCCTCCCACTGGCAAATAATTAGATTATCCCTGGGAAAAAAAGATGCCAGTAAA ATTGATCATGTTTAAATGCATCAGTTGCTAGGTGATTTATCTGATTAAGTCTTGAAACAGTAGAACCTAG CAATTAAAGTGAGCATTAACTTCTACCTACCAAATCAGAAGACTATTCTAACTTTTTGAGAATTAGATGT TGAAAATATGGCCCATGAATTTAGCATGGTTAAAATAAAAAACATGCAAACAAAACAAACCCAACATCTT GAAAGGACATTTGACTCTAAAGTCCCAAAAATAATCACAAGTCTAAAAATCCTAAGTTTAGTGTTACTCT ATTACACCTTTTTATTTGTAAGTGTCCTTTCACAAAAGTTTTAAATTTTGCTCTTGTGCATTTTATTTAC CTTTTCTTTTGTTGTTTGTGTCTTTGGTGACCTGCCAACCATTAGACTTCAAAAAACAGCCTATAGCCAA GCTGCAGGATAAATGAACACATAAGTTGACTTAGAATAGTCAACTCTGTCTAGTATACAATTTATGGGGG ATGGTTTATGACCACATATATTTCTACTTTGATGGGAATATCTTGAGATAAAATTAGAGAGAATGAGTGG AGTAATATTCACAACATTTTTGCTGCATTCATCCCTGAATTTGAAGAAATACCAAAGTACATCTTGTGAG GAGAAAAAATAAATAAATTCATATAAAATGTTGTGGGTTTTATTCTTTATGCAGTGGTAAACTGTGTTTG CATACACCATAGCAATTAAATTAGGGCTACAAAGGGTATTTAACTAATGAGCATAAAATACCTTAATGTA CCTCAAATGCAATTAATTGCATTGGACCAATCTAAGTTACTATTCTTCAGTTTTCATTTTTATTTCATTA TTCATTTCATTTTTATTCTGATATAAAAATGAACCAGGATCTGTGTGAAATTATTTGAATCTAATGTCTT TGAACATTTTTCTTACCATACCTTAAGATTAAAAAAACAAAAAAAAATCCCTTAGTTTGGCAACTTTTGC TGTTGGTTAAGCCCGTTTGGATTTAACATTGACAGGACCAGCTAACTTCCTACCAGTTAACATTGCTTGT …………… etc 4 cDNA/mRNA sequence display LOCUS NM_003140 897 bp mRNA linear PRI 17-DEC-2011 >gi|4507224|ref| Homo sapiens sex determining region Y (SRY), mRNA GTTGAGGGGGTGTTGAGGGCGGAGAAATGCAAGTTTCATTACAAAAGTTAACGTAACAAAGAATCTGGTA GAAGTGAGTTTTGGATAGTAAAATAAGTTTCGAACTCTGGCACCTTTCAATTTTGTCGCACTCTCCTTGT TTTTGACAATGCAATCATATGCTTCTGCTATGTTAAGCGTATTCAACAGCGATGATTACAGTCCAGCTGT GCAAGAGAATATTCCCGCTCTCCGGAGAAGCTCTTCCTTCCTTTGCACTGAAAGCTGTAACTCTAAGTAT CAGTGTGAAACGGGAGAAAACAGTAAAGGCAACGTCCAGGATAGAGTGAAGCGACCCATGAACGCATTCA TCGTGTGGTCTCGCGATCAGAGGCGCAAGATGGCTCTAGAGAATCCCAGAATGCGAAACTCAGAGATCAG CAAGCAGCTGGGATACCAGTGGAAAATGCTTACTGAAGCCGAAAAATGGCCATTCTTCCAGGAGGCACAG AAATTACAGGCCATGCACAGAGAGAAATACCCGAATTATAAGTATCGACCTCGTCGGAAGGCGAAGATGC TGCCGAAGAATTGCAGTTTGCTTCCCGCAGATCCCGCTTCGGTACTCTGCAGCGAAGTGCAACTGGACAA CAGGTTGTACAGGGATGACTGTACGAAAGCCACACACTCAAGAATGGAGCACCAGCTAGGCCACTTACCG CCCATCAACGCAGCCAGCTCACCGCAGCAACGGGACCGCTACAGCCACTGGACAAAGCTGTAGGACAATC GGGTAACATTGGCTACAAAGACCTACCTAGATGCTCCTTTTTACGATAACTTACAGCCCTCACTTTCTTA TGTTTAGTTTCAATATTGTTTTCTTTTCTCTGGCTAATAAAGGCCTTATTCATTTCA A sequence logo showing the most conserved bases around the initiation codon from all human mRNAs. The larger the LETTER at a given location, the greater the importance of a the specific base 5 LOCUS NP_003131 204 aa linear PRI 17-DEC-2011 >gi|4507225|ref| sex-determining region Y protein [Homo sapiens] MQSYASAMLSVFNSDDYSPAVQENIPALRRSSSFLCTESCNSKYQCETGENSKGNVQDRVKRPMNAFIVW SRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPK NCSLLPADPASVLCSEVQLDNRLYRDDCTKATHSRMEHQLGHLPPINAASSPQQRDRYSHWTKL Amino acid sequence reads from the N (amino) to the C (carboxyl) terminus 6 Woe to that child which when kissed on the forehead tastes salty. He is bewitched and soon must die. This adage, from northern European folklore, is an early reference to the common genetic disease recognized today as cystic fibrosis. As the saying implies, the disorder once routinely killed children in infancy and is often identifiable by excessive salt in sweat.. (Scientific American Dec. 1995) Cystic fibrosis: most common severe recessive monogenic disorder affecting people of European descent Info about cystic fibrosis http://www.nlm.nih.gov/medlineplus/cysticfibrosis.html http://ghr.nlm.nih.gov/condition=cysticfibrosis http://www.ygyh.org/ 7 the “cystic fibrosis” gene codes for the CFTR protein which is a transmembrane protein involved in chloride transport (note gene is named for its mutant phenotype and not for the protein that it specifies) CFTR= cystic fibrosis transmembrane conductance regulator 8 http://www.genet.sickkids.on.ca/cftr/GenomicDnaSequencePage.html 9 http://www.genet.sickkids.on.ca/cftr/MRnaPolypeptideSequencePage.html 10 The first questions a researcher interested in exploring the molecular genetics of a disease state addresses generally are 1. Does everyone affected with the disease have a mutation in the same gene – in other words, is the disease genetically heterogeneous? 2. For a given gene, what is the mutational spectrum for individuals with this disease—does every affected person have the same mutation or are there lots of different mutations? 3. How are the mutations distributed in the gene and how do they affect gene function? Cystic fibrosis is not genetically heterogeneous but it shows extensive allelic heterogeneity • Only mutations in the CF gene (see next page) cause CF, BUT over 1900 different mutant alleles of the CF gene have been discovered world-wide • In contrast All individuals with sickle cell anemia have the same missense mutation in the B globin gene. 11 http://www.genet.sickkids.on.ca/cftr/StatisticsPage.html 12 CF mutations are distributed throughout the gene http://www.genet.sickkids.on.ca/cftr/PicturePage.html 13 Retrieval of Genetic Information: Central to any information storage system is the ability to access and retrieve the information and to convert it to a usable form. In addition to the sequence information that will be translated into protein via the triplet code, a gene also contains sequence information that specifies 1. where transcription starts and stops on a given stretch of DNA and which strand of DNA is transcribed 2. where splicing occurs (exon/intron boundaries) 3. where, when and at what level the transcript will be produced 14 NOTE: code is always in DNA TCA 5' 3' RNAspeak AGT transcription TCA 5' 3' 5' 3' 3' UCA 5' AGT splicing and processing serine codon in eukaryotes on mRNA mRNA UCA AGU serine anticodon 3' 5' on tRNA 5' serine serine attached to tRNA ser at 3' end Chemical conversion of TCA into serine. Accuracy of translation depends on precise matching: (1) of an amino acid with its cognate tRNA (2) of the anitcodon of a charged tRNA with its corresponding codon on the mRNA http://en.wikipedia.org/wiki/Genetic_code 15 http://en.wikipedia.org/wiki/File:GeneticCode21-version-2.svg 16 What is a missense mutation? 17 Missense mutation: a mutation that alters a codon so that a different amino acid is specified How will any given missense mutation affect the functioning of a protein? 18 Hard to say a priori without additional information on: • the nature of the amino acid substitution • the site of the mutation in the protein • whether the change is in a highly conserved amino acid A missense mutation may 1. have virtually no affect on protein function – especially if a chemically similar amino acid is substituted 2. partially or completely inactivate the protein if • the amino acid substitution is in the active site or another site critical for function • the mutation affects the folding or stability of the protein • the mutation affects the processing of the protein or interferes with its transit to the appropriate cellular compartment. See interesting example: In Sex Reversal, Protein Deterred by Nuclear Barrier http://fire.biol.wwu.edu/trent/trent/sexreversal.pdf 3. result in a gain-of-function (see cancer genetics lecture) 19 A protein called human factor VIII has a critical role in blood clotting (Nature November 25, 1999) • Factor VIII is a glycoprotein that has a critical role in blood coagulation • This protein circulates as a complex with other proteins • Gene coding for clotting factor VIII is mutated in the X-linked disease state hemophila A 21 different amino acid residues in factor VIII are known to be sites of deleterious mutations in patients with hemophila • A number of these are in the hydrophobic
Load more

Recommended publications
  • Structural Effects of Point Mutations in Proteins Suvethigaa Shanthirabalan, Jacques Chomilier, Mathilde Carpentier
    Structural effects of point mutations in proteins Suvethigaa Shanthirabalan, Jacques Chomilier, Mathilde Carpentier To cite this version: Suvethigaa Shanthirabalan, Jacques Chomilier, Mathilde Carpentier. Structural effects of point muta- tions in proteins. Proteins - Structure, Function and Bioinformatics, Wiley, 2018, 86 (8), pp.853-867. 10.1002/prot.25499. hal-01909365 HAL Id: hal-01909365 https://hal.sorbonne-universite.fr/hal-01909365 Submitted on 31 Oct 2018 HAL is a multi-disciplinary open access L’archive ouverte pluridisciplinaire HAL, est archive for the deposit and dissemination of sci- destinée au dépôt et à la diffusion de documents entific research documents, whether they are pub- scientifiques de niveau recherche, publiés ou non, lished or not. The documents may come from émanant des établissements d’enseignement et de teaching and research institutions in France or recherche français ou étrangers, des laboratoires abroad, or from public or private research centers. publics ou privés. Structural effects of point mutations in proteins Suvethigaa Shanthirabalan1, Jacques Chomilier2, Mathilde Carpentier1,2 1. Institut Systématique Evolution Biodiversité (ISYEB), Sorbonne Université, MNHN, CNRS, EPHE, Paris, France. 2. Sorbonne Université, CNRS, MNHN, IRD, IMPMC, BiBiP, Paris, France Corresponding author: [email protected] Mail: [email protected]; [email protected]; [email protected] Abstract A structural database of eleven families of chains differing by a single amino acid substitution has been built. Another structural dataset of 5 families with identical sequences has been used for comparison. The RMSD computed after a global superimposition of the mutated protein on each native one is smaller than the RMSD calculated among proteins of identical sequences.
    [Show full text]
  • Large Accumulation of Mrna and DNA Point Modi¢Cations in a Plant
    FEBS Letters 472 (2000) 14^16 FEBS 23560 View metadata, citation and similar papers at core.ac.uk brought to you by CORE Large accumulation of mRNA and DNA point modi¢cationsprovided in by a Elsevier plant - Publisher Connector senescent tissue Maria Plaa;*, Anna Jofre¨a, Maria Martellb, Marisa Molinasa, Jordi Go¨mezb aLaboratori del Suro, Universitat de Girona, Campus Montilivi sn, E-17071 Girona, Spain bLiver Unit, Department of Medicine, Universitat Auto©noma de Barcelona, Hospital General Universitari Vall d'Hebron, E-08035 Barcelona, Spain Received 26 January 2000 Edited by Takashi Gojobori We investigated the frequency of cDNA modi¢cation in Abstract Although nucleic acids are the paradigm of genetic information conservation, they are inherently unstable molecules cork (phellem) compared to a normally growing young tissue that suffer intrinsic and environmental damage. Oxidative stress (root tip) using cork-oak (Quercus suber) as a model system. has been related to senescence and aging and, recently, it has For this purpose, we analyzed a population of Qs_hsp17 been shown that mutations accumulate at high frequency in mRNA sequences (reverse transcription PCR products form mitochondrial DNA with age. We investigated RNA and DNA position 32^401, AC AJ000691) in cork and in root tip tissue modifications in cork, a senescent plant tissue under high [6]. Cork (phellem) is an external layer of protective tissue, endogenous oxidative stress conditions. When compared to consisting of several layers of cells that deposit large amounts normally growing young tissue, cork revealed an unexpected of suberin and undergo programmed cell death. Due to phen- high frequency of point modifications in both cDNA (Pn = oxy radicals generated during suberin synthesis [7,8], cork 1/1784) and nuclear DNA (Pn = 1/1520).
    [Show full text]
  • Point Mutations Underlying NF1 and NF2 and Increased Risk of Malignancy
    Central Annals of Otolaryngology and Rhinology Mini Review *Corresponding author Andrea L.O. Hebb, MSc, PhD, RN, Maritime Lateral Skull Base Clinic, Otolaryngology, Neurosurgery and the Point Mutations Underlying NF1 Stereotactic Radiotherapy Group QEII Health Science Centre, Halifax, Canada; Email: [email protected] and NF2 and Increased Risk of Submitted: 12 February 2020 Accepted: 25 February 2020 Published: 27 February 2020 Malignancy ISSN: 2379-948X Copyright 1 2 3,4 3,4 Myles Davidson , Haupt TS , Morris DP , Shoman NM , © 2020 Davidson M, et al. 2,4 1,2,4 Walling SA , and Hebb ALO * OPEN ACCESS 1Department of Psychology, Saint Mary’s University, Canada 2Division of Neurosurgery, Dalhousie University, Canada Keywords 3 Division of Otolaryngology, Dalhousie University, Canada • Neurofibromatosis 4 Maritime Lateral Skull Base Clinic, Otolaryngology, Neurosurgery and the Stereotactic • Missense mutation Radiotherapy Group QEII Health Science Centre, Canada • Frameshift mutation • Nonsense mutation Abstract • KRAS gene • Colorectal cancer Neurofibromatosis Type-1 and Neurofibromatosis Type-2 are autosomal dominant • Acoustic neuroma tumor suppressor disorders that result from inherited or spontaneous mutations in • Vestibular schwannoma their respective genes. Neurofibromatosis Type-1 has been attributed to a non-sense • Meningioma mutation in chromosome 17 and Neurofibromatosis Type-2 a point mutation in its gene on chromosome 22. The following discussion briefly reviews point and frameshift mutations and explores the relationship between point mutations and development of malignancies in patients with Neurofibromatosis Type-1 and Neurofibromatosis Type-2. INTRODUCTION producing phenylalanine hydroxylase, the majority of which are missense mutations [4]. A point mutation is the change of one base for another in the DNA sequence.
    [Show full text]
  • Methods for Detection of Point Mutations: Performance and Quality
    Clinical Chemistry 43:7 1114–1128 (1997) Review Methods for detection of point mutations: performance and quality assessment Downloaded from https://academic.oup.com/clinchem/article/43/7/1114/5640834 by guest on 29 September 2021 Peter Nollau and Christoph Wagener*, on behalf of the IFCC Scientific Division, Committee on Molecular Biology Techniques We give an overview of current methods for the detec- 10) What kind of quality assessment can be achieved? tion of point mutations as well as small insertions and Here, different methods for the detection of point muta- deletions in clinical diagnostics. For each method, the tions and small deletions or insertions will be discussed following characteristics are specified: (a) principle, (b) on the basis of the above criteria (for simplification, we major modifications, (c) maximum fragment size that shall refer to point mutations only in the text, though in can be analyzed, (d) ratio and type of mutations that can general, small deletions or insertions are detected equally be detected, (e) minimum ratio of mutant to wild-type well by the methods described). In general, PCR is either alleles at which mutations can be detected, and (f) used for the generation of DNA fragments, or is part of detection methods. Special attention is paid to the the detection method. Screening methods for unknown possibilities of quality assessment and the potential for mutations as well as methods for the detection of known standardization and automation. mutations are included. Though DNA sequencing tech- niques will not be covered, we stress that DNA sequenc- INDEXING TERMS: alleles • electrophoresis • gene insertions ing is considered the gold standard and remains the • gene deletions • polymerase chain reaction definitive procedure for the detection of mutations so far.
    [Show full text]
  • Teacher Materials (PDF)
    The Making of the Fittest: LESSON The Birth and Death of Genes TEACHER MATERIALS THE MOLECULAR EVOLUTION OF GENE BIRTH AND DEATH OVERVIEW This advanced lesson describes how mutation is a key element in both the birth and death of genes. Students proceed through a series of presentation slides that include background information, examples, and embedded video, and animation links. Questions challenge students to synthesize information and apply what they learn regarding how genes are gained and lost through evolutionary time. KEY CONCEPTS AND LEARNING OBJECTIVES • Mutations are changes in an organism’s DNA. They occur at random. • Whether or not a mutation has an effect on an organism’s traits depends on the type of mutation and its location. • Mutations can result in both the appearance of new genes and the loss of existing genes. • One way that a new gene can arise is when a gene is duplicated and one copy (or both copies) of the gene accumulates mutations, which change the function of the gene. • One way that a gene can be lost is when one or more mutations accumulate that destroy its function. Students will be able to • analyze gene sequences and transcribe DNA into messenger RNA (mRNA); • translate mRNA into a sequence of amino acids by using a genetic code chart; and • compare wild-type and mutated DNA sequences to determine the type of mutation present. CURRICULUM CONNECTIONS Curriculum Standards NGSS (April 2013) HS-LS1-1, HS-LS3-1, HS-LS3-2, HS-LS4-2, HS-LS4-4, HS-LS4-5 HS.LS1.A, HS.LS3.A, HS.LS3.B, HS.LS4.B, HS.LS4.C Common Core
    [Show full text]
  • Genetics of Sma
    CURE SMA CARE SERIES BOOKLET A SOURCE OF INFORMATION AND SUPPORT FOR INDIVIDUALS LIVING WITH SPINAL MUSCULAR ATROPHY AND THEIR FAMILIES. GENETICS OF SMA 1 SMA AND GENETICS Spinal muscular atrophy (SMA) is often referred to by several terms, including “genetic disease,” ‘’autosomal recessive genetic disorder,” “motor-neuron disease,” or ‘’neuromuscular disease.” SMA is a genetic disease. “Genetic” means it is relating to the genes and is inherited. Genes are responsible for our traits and unique characteristics. In SMA, there is a mutation in a gene responsible for the survival motor neuron (SMN) protein, a protein that is critical to the function of the nerves that control normal muscle movements. SMA is an autosomal recessive genetic disorder. “Autosomal recessive” refers to how the disease is inherited, or passed down, from the parents to the child. In SMA, the individual who is affected by SMA inherits two copies of a non-working gene—one copy from each parent. SMA is a motor-neuron disease. “Motor-neuron” refers to the type of nerve cell that sends messages to and from muscles responsible for movement and control of the head, neck, chest, abdomen, legs, and limbs. In SMA, the motor-neurons in the spinal cord do not have enough SMN protein. As a result, these motor-neurons do not function normally and may die, resulting in muscle weakness and atrophy (shrinkage). SMA is a neuromuscular disease. A “neuromuscular disease” affects the neuromuscular system. This can include problems with the nerves that control muscles, the muscles, and the communication between the nerves and the muscles.
    [Show full text]
  • Understanding the Introduction of Genetic Variations by Random
    Understanding the Introduction of Genetic Variations by Random Mutation Lesson Overview The focus of this lesson is on mutations as a source of genetic variability and what it means to say that mutations occur randomly at a particular rate. Students will make predictions about and observe the random mutations in the genomes of Avidians. Big Ideas The basic components of the Darwinian evolutionary mechanism are variation, inheritance, natural selection and time (aka VIST). Genetic variation is produced by mutations—changes in an organism’s genome caused by random replication errors. These errors occur at a relatively constant rate within broad groups of organisms and may be expressed probabilistically in various ways (e.g. mutation rate per base pair or per genome per replication).1 Because each site in the genome is equally susceptible to replication errors, the actual number of mutations occurring during a given replication event is variable, with higher mutation rates increasing the likelihood that mutations will occur. Random mutations produce the raw materials that are shaped by non-random selection into complex adaptive features. Objectives for Student Learning Through engagement in this lesson, students will: • Learn that mutations may occur at random in a genome at various rates • Observe how random mutations introduce genotypic variability in a population • Explain what mutation rates imply about the distribution of genotypic changes • Test hypotheses via a cycle of Hypothesis, Prediction, Testing, and Evaluation. Students’ Prior Knowledge Students should have a basic understanding of probability. However, they may struggle with what is meant by a particular mutation rate. Students may think, for instance, that a 10% mutation rate means that that there will always be a 10% difference between the ancestor and offspring, instead of recognizing that each site in the genome independently has a 10% chance of changing during replication.
    [Show full text]
  • Code Cracking Mutation Practice
    Name: ___________________________________________ Date: __________________ Period: _____ Code Cracking Mutation Practice Review: Three of the most common types of mutations are: 1. POINT MUTATION (one base is substituted for another) If a point mutation changes the amino acid, it’s called a MISSENSE mutation. If a point mutation does not change the amino acid, it’s called a SILENT mutation. If a point mutation changes the amino acid to a “stop,” it’s called a NONSENSE mutation. 2. INSERTION (an extra base, or bases, is inserted) 3. DELETION (a base, or bases, is lost) Deletion and insertion may cause what’s called a FRAMESHIFT, meaning the reading frame changes. These are typically one of the most serious types of mutations. Directions: 1. Following the same procedure you followed during the decoding activity (DNA to mRNA to Amino Acid), decode the original and mutated sequences and identify them as one of the three types of mutations listed above. If it is a point mutations, include whether it is a missense, silent, or nonsense mutations. The original DNA sequence is: DNA: TGC GTG CTT AAG CGG TGT ACA CGT TGC mRNA: Amino acid: Symbol: Now decode the following mutated sequences: 2. TGC GTG CTT AAG CGA TGT ACA CGT TGC What kind of mutation is this? Do you think it will affect the protein’s function? Why? 3. TGC GTG CTT AAG CGG TGT GCA CGT TGC What kind of mutation is this? Do you think it will affect the protein’s function? Why? 4. TGC GTG CTT AAG TAG TGT ACA CGT TGC What kind of mutation is this? Do you think it will affect the protein’s function? Why? 5.
    [Show full text]
  • A Point Mutation Within Exon 5 of the WT1 Gene of a Sporadic Unilateral Wilms' Tumor Alters Gene Function1
    (CANCER RESEARCH 58. 4180-4184. September 15. 1998] A Point Mutation within Exon 5 of the WT1 Gene of a Sporadic Unilateral Wilms' Tumor Alters Gene Function1 Li-Shuang Guan, Jia-jia Liu, Yong-Hua Xu, and Zhao-Yi Wang2 Department of Medicine, Division of Growth Regulation, Beth Israel Deaconess Medical Center, Harvard Medical School, Boston, Massachusetts 02215 ¡L-S.C., Z-Y. W.¡.and Shanghai Institute of Cell Biology, Shanghai, People's Republic of China [J-j. L, Y-H. X.¡ ABSTRACT The insertion of three amino acids (+KTS) disrupts the distance between zinc fingers 3 and 4 and thus alters its DNA-binding speci The Wilms' tumor suppressor gene, nil, encodes a zinc-finger tran ficity (6, 7). The NH2 terminus of WT1 contains a proline- and scription factor, WT1, that represses transcription of a number of growth- glutamine-rich domain that exhibited transcription-regulating activity promoting genes and inhibits cell growth. The transcripts of wit undergo in transient cotransfection assays (7, 8) two alternative splicing events, giving rise to four isoforms of mRNA in constant ratios. The first alternative splice introduces an extra exon 5, Consistent with the view that WT1 functions as a tumor suppressor, which encodes 17 amino acid residues inserted between the transcription experimental evidence has demonstrated that WT1 represses tran regulatory domain and the DNA binding domain of WT1. Previously, we scription of a number of growth-related genes. These include, PDGF demonstrated that the 17-amino acid domain functioned as a transcription A-chain, insulin-like growth factor II, epidermal growth factor recep repressor when it was fused with the DNA binding domain of WT1.
    [Show full text]
  • DNA Mutation Worksheetkey
    Name: ________________________ BIO300/CMPSC300 Mutation - Spring 2016 As you know from lecture, there are several types of mutation: DELETION (a base is lost) INSERTION (an extra base is inserted) Deletion and insertion may cause what’s called a FRAMESHIFT, meaning the reading “frame” changes, changing the amino acid sequence. POINT MUTATION (one base is substituted for another) If a point mutation changes the amino acid, it’s called a MISSENSE mutation. If a point mutation does not change the amino acid, it’s called a SILENT mutation. If a point mutation changes the amino acid to a “stop,” it’s called a NONSENSE mutation. Complete the boxes below. Classify each as either Deletion, Insertion, or Substitution AND as either frameshift, missense, silent or nonsense (hint: deletion or insertion will always be frameshift). Original DNA Sequence: T A C A C C T T G G C G A C G A C T mRNA Sequence: A U G U G G A A C C G C U G C U G A Amino Acid Sequence: MET -TRP- ASN - ARG- CYS - (STOP) Mutated DNA Sequence #1: T A C A T C T T G G C G A C G A C T What’s the mRNA sequence? A U G U A G A A C C G C U G C U G A What will be the amino acid sequence? MET -(STOP) Will there likely be effects? YES What kind of mutation is this? POINT MUTATION- NONSENSE Mutated DNA Sequence #2: T A C G A C C T T G G C G A C G A C T What’s the mRNA sequence? A U G C U G G A A C C G C U G C U G A What will be the amino acid sequence? MET - LEU -GLU– PRO-LEU-LEU Will there likely be effects? YES What kind of mutation is this? INSERTION - FRAME SHIFT Mutated DNA Sequence
    [Show full text]
  • Point Mutation Specific Antibodies in B-Cell and T-Cell Lymphomas And
    diagnostics Review Point Mutation Specific Antibodies in B-Cell and T-Cell Lymphomas and Leukemias: Targeting IDH2, KRAS, BRAF and Other Biomarkers RHOA, IRF8, MYD88, ID3, NRAS, SF3B1 and EZH2 Kunwar Singh 1,*,† , Sumanth Gollapudi 2,† , Sasha Mittal 2, Corinn Small 2, Jyoti Kumar 1 and Robert S. Ohgami 2,* 1 Department of Pathology, Stanford University, Stanford, CA 94063, USA; [email protected] 2 Department of Pathology, University of California, San Francisco, CA 94143, USA; [email protected] (S.G.); [email protected] (S.M.); [email protected] (C.S.) * Correspondence: [email protected] (K.S.); [email protected] (R.S.O.); Tel.: +1-347-856-7047 (K.S.); +1-415-514-8179 (R.S.O.) † These authors contributed equally. Abstract: B-cell and T-cell lymphomas and leukemias often have distinct genetic mutations that are diagnostically defining or prognostically significant. A subset of these mutations consists of specific point mutations, which can be evaluated using genetic sequencing approaches or point mutation Citation: Singh, K.; Gollapudi, S.; specific antibodies. Here, we describe genes harboring point mutations relevant to B-cell and T-cell Mittal, S.; Small, C.; Kumar, J.; malignancies and discuss the current availability of these targeted point mutation specific antibodies. Ohgami, R.S. Point Mutation Specific We also evaluate the possibility of generating novel antibodies against known point mutations Antibodies in B-Cell and T-Cell by computationally assessing for chemical and structural features as well as epitope antigenicity Lymphomas and Leukemias: of these targets. Our results not only summarize several genetic mutations and identify existing Targeting IDH2, KRAS, BRAF and point mutation specific antibodies relevant to hematologic malignancies, but also reveal potential Other Biomarkers RHOA, IRF8, underdeveloped targets which merit further study.
    [Show full text]
  • The Origin of Point Mutations in Human Tumor Cells1 Bernard S
    [CANCER RESEARCH 52. 249-253, January 15. 1992] Perspectivesin CancerResearch The Origin of Point Mutations in Human Tumor Cells1 Bernard S. Strauss2 ICRF Clare Hall Laboratories and Department of Molecular Genetics and Cell Biology, The university of Chicago, Chicago, Illinois 6063 7 The idea that point mutation is central to carcinogenesis is zling since one of the major hypotheses of the 1970s was the an old one (e.g. Ref. l). Until recently, however, specific genetic proposal that carcinogens acted to produce point mutations; changes had not been observed in tumors and a keystone of the that all, or at least the overwhelming majority, of carcinogens belief that genetic change is central to carcinogenesis was what were mutagenic; and that the production of mutations was the appeared to be a close correlation between mutagenicity and mechanism by which carcinogens acted (13). The discovery of carcinogenicity (2). The situation is almost completely reversed transforming oncogenes (14), and particularly the observation today. The class of nonmutagenic carcinogens has been shown by Barbacid et al. (15) that methylnitrosourea-induced breast to be considerable (3). On the other hand, so many genetic tumors in rats were invariably associated with G—»Atransitions changes have been observed in individual cancers that the in the ras oncogene of the tumor, appeared to fulfill one of measured mutation rates in somatic cells seem unable to ac Koch's postulates, that an etiological agent should be invariably count for their appearance. For example, single tumors may associated with the development of disease. Identity of the type contain both ras and p53 point mutations along with chromo of mutation produced in experimental tumors by methylnitro- somal changes (4).
    [Show full text]