Catalog 2003-2005 > Own Your Future

Price $2.00 Credits: Photos (in alphabetical order): Dan Cleary, Dan Small, Scott Turner Art & Production Director: Sally Perkins Academic Calendar UMRJn 3Ags 4 03June21-August12,2004 June23-August14,2003 SUMMER PIGMrh2-ue1,20 March28-June10,2005 March29-June11,2004 January3-March18,2005 January5-March19,2004 SPRING September20-December9,2004 September22-December11,2003 WINTER FALL Please note: notice ofanysuchchanges.Nothing containedhereinshallbeconstruedtocreateanyoffercontractor contractualrigh fees. Whenfeasible,changeswillbe announcedpriortotheireffectivedates,butthecollegeassumesnoresponsibility forgi However, thecollegereservesright tomakeappropriatechangesinprocedures,policies,calendars,requirements, programs, Note: omneetJn 0June9 6 June 13 June 7-10 June 30 May 19 May June10 28 March 14 June 7 June 8-11 June 15 March 21 March 16-18 March 31 May 20 May Grades dueinRecordsoffice 24 February 29 March Commencement 21 February Final examsandgrading Last dayofclass 3 January 15 March Memorial Dayobserved 17 January 16-19 March 22 March Mid-quarter AdvisingDay December3 Day/evening classesbegin December13 26 February December6-9 16 February November24-26 Grades dueinRecordsoffice 5 January Final examsandgrading 19 January 15 November November11 Last dayofclass December5 Mid-quarter AdvisingDay 20 September 8-11 December December15 President's Dayobserved November 26-28 M.L. KingJr.'sBirthdayobserved 11 August August16 Day/evening classesbegin 12 August 17 November July5 November11 21 June Grades dueinRecordsoffice 22 September Final examsandgrading Last dayofclass Thanksgiving holidays 13 August August18 Mid-quarter AdvisingDay 14 August Veteran's Day holiday Day/evening classesbegin July4 23 June Grades dueinRecordsoffice Summer quarterfinalexams Last dayofclass Independence Dayobserved Day/evening classesbegin (no dayclasses;eveningclasseswillbeheld) (no dayclasses;eveningclasseswillbeheld) (no dayclasses;eveningclasseswillbeheld) TacomaCommunityCollegehasmade reasonableeffortstoprovideinthiscataloginformationthatisaccurate atthetimeofpu Datesaresubjecttochange. fiil20-04Official2004-2005 Official 2003-2004 ving anyparticular ts. coursesand blication. Welcome Welcome

President Pamela J. Transue You can own your future with an education from discusses capital Tacoma Community College because we’re here for one reason – You! construction projects Tacoma Community College provides a dynamic learning environment that is recognized for student with students. success, academic excellence and quality instruction. There are many reasons for you to choose to study at TCC. You can start your degree or receive career training at convenient locations during the day, evening, weekend or online, all with affordable tuition. You can choose from more than 50 study areas or train for a career in one of 44 professional/technical programs. In each of these disciplines you’ll enjoy intimate class sizes, diverse classmates and highly qualified instructors. Of our 105 full-time faculty, 97 hold master’s degrees and 22 hold Ph.D.’s. While you study, you’ll meet students from around the area and abroad, and find sports, clubs and activities to enjoy with them. We also offer strong student support services to help ensure your success. Our campus is changing to better serve your needs. We recently opened an art gallery, expanded the Opgaard Student Center, and are in the construction phase of a new classroom/administration building and an Information Technology Center. That means more classrooms, more resources and more study areas for you to enjoy. This catalog introduces you to the College, its programs and activities. You’ll also meet some of our students, faculty and staff who have reached their goals and owned their future through their involvement with TCC. See Contents, page 2 1 2 Welcome Instructional Programs Student Programand ...... Special ServicesforStudents Enrollment Services Welcome Academic Calendar Contents Continuing Education Basic Skills Professional/Technical CertificatesandDegrees College Transfer Educational Options TCC AtAGlance services, seepage 21. for yourpersonalenrichment. study EnglishasaSecondLanguage. careers thatareinhighdemand. studies inaparticulararea. bachelor's degreewhilediscoveringyourinterestsorpursuing degrees offeranidealwaytoearnthefirsttwoyearsofa studying toowntheirfuture.Youcanchoose: For acompletedescriptionofTCC's academicprogramsand Improve yourjobskillsandenrich lifewithcoursesdesigned Learn basicskillsinreading,writingandmath;earnaGED;or TCC offers44professional/technicalprogramstotrainyoufor The AssociateinArtsandSciencesofScience We servemorethan9,300studentseveryquarterwhoare Learning Formats ...... Continuing Education High SchoolCompletion& Adult BasicEducation Professional/Technical Education University LevelEducation Other Services Student Services Instructional Services Registration Financial Assistance Admissions Frequently CalledNumbers Student LearningOutcomes ...... 1 ...... 8 ...... 7 ...... 12 Activities ...... 21 17 ...... 25 ...... 16 ...... 11 ...... 15 ...... 23 ...... 19 ...... 22 E ...... 24 GED ...... 6 ...... 3 ...... 24 ...... 23 ...... 14 Inside FrontCover – – – – – – – – – 28 20 18 17 18 13 13 28 25 – 6 Course Descriptions support toqualified applicants. 2,000 openingswerepostedproviding additionalfinancial program. Duringthe2001-2002 academic year,morethan Job AssistanceCenteroperates an extensiveoff-campusjob $375,000 inscholarshipswasadditionally awarded.TheTCC employment andscholarships)was about$4,950andnearly average award(includinggrants,loans,work-study your educationalgoals.Forthe2001-2002academicyear, *Source: TheCollegeBoard colleges anduniversities. credits youearnatTCCwilltransfertomostfour-year affordable. Andyoudon'thavetosacrificequality.Plus,the and families,tuitionatTacomaCommunityCollegeremains universities escalatesbeyondthereachofmanyindividuals TCC isaSmartInvestment Campus Guideand Information andResources...... Professional/Technical Programs Degrees andGraduation College Policies We offernumerousfinancialaidpackagestohelpyouattain While thecostofattendingfour-yearcollegesand >Tuition ataWashingtoncommunitycollegeaverages$2,082 >Tuition atafour-yearpublicinstitutionaverages$4,081 >Tuition atafour-yearprivateinstitutionaverages$18,273 Program OptionsChart Graduation Honors &Awards Associate inGeneral Associate inTechnical Associate inApplied ...... Associate ofScience Associate inArtsand College Degrees Information Directory Application Form Definitions Index College Faculty 139 ...... Board ofTrustees ...... 145 ...... 29 ...... 51 ...... 148 ...... 79 ......

and ...... 39 ...... 38 ...... 149 ......

...... 50 ...... Administrative StaffDirectory a ...... 152 ...... Map Sciences Studies Sciences ...... 151 ...... rs...... 48 ...... Arts ...... 53 ...... 139 ...... 44 ...... 52 ...... 49 ...... 47 ...... 40 ...... – Inside BackCover ..140 .... – – – – – 150 147 151 138 144 – – – – – – – – – – 78 51 50 49 48 47 43 40 51 37 Welcome 3 Sunrise James, 2003-2004 ASTCC President Sunrise James, 2003-2004 > each The general methods employed by > The unique perspectives and assumptions of each > of each to their areas of study The relationship To recognize, understand and accept ownership for learning by To acquire a substantial body of knowledge related to students' To acquire a substantial body of knowledge related and technological To listen, speak, read, write and use nonverbal organizing, To define tasks and resolve problems by gathering, To recognize when information is needed, to locate, evaluate, To develop an understanding of the uniqueness of self and One of Tacoma Community College's greatest strengths is its strengths greatest College's Tacoma Community One of Tacoma Community College is committed to strengthening “I really enjoyed being involved in “I really enjoyed and activities…[it] student programs many great helped me to meet people…” Responsibility/Leadership demonstrating and evaluating behaviors that support the lifelong learning process. Core of Knowledge Arts and Sciences degree objectives, from a broad-based curriculum. of the students will also understand the following aspects and social sciences: humanities, quantitative skills, natural sciences, Communication means to make connections between self and others. Critical Thinking and Problem Solving analyzing, and evaluating information and ideas. Information and Information Technology and use the needed information, and to use information technology to support learning. Living and Working Cooperatively others, demonstrate openness toward diverse points of view, and draw upon knowledge and experience of others to function as a team member, in a multicultural world. Meet our Students our Meet of student age is 28 and 64% body. The average diverse student of are women. Students 9,300 students per quarter the college's is at TCC. The College also 32% of all students color comprise more than a dozen countries, students from home to international perspective. the campus with a global who enhance Student College-wide Learning Outcomes Learning student learning through six college-wide Student Outcomes that are included in all degree programs. Diversity instructional labs >Children's Center A nationally accredited > A Counseling Center > Center Center and Job Assistance A Career > for students with disabilities Access Services > and Cultural Affairs A Center for Multi-Ethnic > Services TRIO Student Support > International Student Services > math and other Free tutoring services, and writing, > Financial Aid programs Comprehensive the TCC Foundation > Scholarships through Mutual Respect Collegiality IntegrityTrustInnovationResponsibility Leadership Access Excellence Tacoma Community College promotes student success by Bridging Tradition and Innovation: Tacoma Community College Tacoma Community College shall provide quality educational Tacoma Community College shall provide quality At TCC, we believe that development of the entire person is At TCC, we believe that development of the entire For detailed information on these services, please see For detailed information on these services, please At Tacoma Community College, we offer strong student support strong student we offer College, Community At Tacoma embracing these core values: Values will anticipate emerging community educational needs with innovative, flexible programs and services while maintaining academic excellence. Vision programs in a dynamic learning environment. The College shall be programs in a dynamic learning environment. The address the accessible, comprehensive, and flexible, and shall personal, professional, and social needs of its diverse community. Mission, Vision and Values Mission central to a successful college education. The friendships and social central to a successful college education. The important bonds students form in college are one of the most why as a TCC factors in determining academic success. That's involved in student you will find many opportunities to become and college life, including clubs, trips, concerts, women's government and multicultural programs, intramural sports, student have to end when more. At TCC, your college experience doesn't you leave the classroom - in fact it's just beginning. Student Life pages 15-18. For Financial Aid information see page 11. pages 15-18. For Financial Aid information see services to help ensure your success. services to help Student Support Services Support Student 4 Welcome has anannualoperating budgetof$26million. munity andtechnicalcollegesinastatewide system.Thecollege the TacomaandPeninsulaschooldistricts. TCCisoneof34com- and thePierceCountyportionof OlympicPeninsulaandserves County area.TheCollege'sservice district includesallofTacoma school servingmorethan720,000 residents oftheTacoma-Pierce Main Campus The College Note: Theaccreditationslistedabovearecurrentatthetimeofpublication. the U.S.DepartmentofEducationincludefollowing: recognized bytheCouncilforHigherEducationAccreditationand/or 100, Redmond,WA98052.Specializedcurriculumaccreditation and ofCollegesUniversities,8060165thAvenueNE,Suite Colleges andUniversitiesoftheNorthwestAssociationSchools Accreditation Tacoma CommunityCollegeisacomprehensivestate-supported Tacoma CommunityCollegeisaccreditedbytheCommissionon ThePharmacyTechnicianprogramisaccreditedbythe > TheRadiologicSciencesprogramisaccredited bytheJoint > TheEMT-ParamedicprogramisaccreditedbytheCommittee > TheRespiratoryTherapyprogramisaccreditedbythe > TheHealthInformationTechnologyprogramisaccredited > TheAssociateDegreeNursingprogramisaccreditedby > US DepartmentofEducation. Council forHigherEducationAccreditationand/orthe a specializedaccreditingboardrecognizedbythe American SocietyofHealth-SystemPharmacists(ASHP), US DepartmentofEducation. the CouncilforHigherEducationAccreditationand/or (JRCERT), aspecializedaccreditingboardrecognizedby Review CommitteeonEducationinRadiologicTechnology Department ofEducation. Council forHigherEducationAccreditationand/ortheUS Health EducationPrograms(CAAHEP)andrecognizedbythe collaboration withtheCommissiononAccreditationofAllied Professions (CoAEMSP),aspecializedaccreditingboard,in on AccreditationofEducationalProgramsfortheEMS of Education. Higher EducationAccreditationand/ortheUSDepartment Programs (CAAHEP)andrecognizedbytheCouncilfor Commission onAccreditationofAlliedHealthEducation a specializedaccreditingboard,incollaborationwiththe Committee onAccreditationforRespiratoryCare(CoARC), Council onAccreditation. American HealthInformationManagementAssociation's Education Programs(CAAHEP)incooperationwiththe by theCommissiononAccreditationofAlliedHealth Accreditation and/ortheUSDepartmentofEducation. Commission recognizedbytheCouncilforHigherEducation State DepartmentofHealthNursingCareQualityAssurance the NationalLeagueforNursing(NLN)andWashington materials andaccesstheInternetthroughcenter'scomputerlabs. dents alsocanusethecenter'sonlinelibrarytoordermaincampus sessment, advising,careerexploration,cashieringandbooksales.Stu- Students atthecentercanaccessservicesincludingregistration,as- other programs.Classesareavailabledays,eveningsandweekends. tion, personalenrichmentclasses,customizedbusinesstraining,and sional/technical andWorkerRetrainingprograms,AdultBasicEduca- activities andcommonsarea. laboratories openingintoacentralmallthatalsoservesasstudent Designed aroundamallconcept,thecenterfeaturesclass-roomsand Peninsula. Itislocatedina13,000-square-footfacilitybuilt1995. vices toresidentsandorganizationsinGigHarborthroughoutthe 3993 HuntStreet,GigHarbor Gig HarborPeninsulaCenter Off-Campus Centers city ofSeattleislocated35milesnorthTacoma. and visitorsawealthofculturalrecreationalopportunities.The way totheCascadeandOlympicmountainranges,offersresidents auditorium andbookstore.TheTacoma-PierceCountyarea,gate- center, artgallery,gymnasium,studentchildren's houses 25buildingsincludingacomputercenter,learningresource paced business-learning center,abusinessresourcelibrary andtwo 11,400-square-foot spaceincludessix classrooms,anindividually State HistoricalMuseumandothergroups. TCCDowntownCenter's in thatrevitalizationalongsideUWT, UnionStation,theWashington ness andculturaldestination,TCCDowntown isproudtobeapartner on PacificAvenue.Withdowntown Tacoma's emergenceasabusi- Building, fourblockswestoftheUniversityWashington,Tacoma, 1501 PacificAvenue,Tacoma TCC Downtown hosts numerouscommunityeventsthroughouttheyear. classes areco-sponsoredwithlocalorganizations.Thecenteralso ware applicationsareavailableinthecenter'scomputerlabs.Many grams. Coursesincomputerliteracyandavarietyofpopularsoft- and specialinterestclassestogardeningseminarsseniorpro- credit personalenrichmentclasses.Theserangefromart,fitness, Non-Credit Programs fessional andMedicalOfficeAssistant. Computer Specialist,MedicalTranscriptionist,OfficePro- sional/Technical andWorkerRetrainingprogramsincludeOffice Tech-nology Laboffercreditclassesinaself-pacedformat.Profes- morning andeveningschedule.BusinessLab,MathLabHealth an AssociateinArtsandSciencesdegreeareavailableduringa demic andprofessional/technicalprograms.Allclassesneededfor Credit Curriculum The centerofferscreditcoursesforanassociatedegree,profes- The GigHarborPeninsulaCenterextendsTCC'seducationalser- Located ona150-acresiteinwestTacoma,theTCCcampus TCC DowntownislocatedinthehistoricBetyeMartinBaker Every quarter,theGigHarborPeninsulaCenteroffersmanynon- The GigHarborPeninsulaCenteroffersawidevarietyofaca- ...... 253.851.2424 253.396.9128 Welcome 5 253.475.2426 253.680.3022 ...... TCC and The Evergreen State College-Tacoma (TESC) jointly This evening degree program is intended to provide the first two The Bridge Program is taught at the TESC-Tacoma campus, TCC Downtown offers customized training on topics ranging on topics training customized offers TCC Downtown start-ups, career trends, marketing Information on business in 2000 to Tacoma Community College established the ITCC square foot Housing two computer labs, the ITCC is a 2,300 Bridge Program at The Evergreen State College-Tacoma offer the Bridge Program, a course for study designed especially for adults interested in pursuing a bachelor's degree at The Evergreen State College. years of the four-year degree program at TESC-Tacoma and is based on an interdisciplinary curriculum. It is intended for students who have less than 90 credits. Credits earned in Interdisciplinary Courses (IDS) apply only to the Evergreen State College-Tacoma/ Olympia campuses. Students entering the program can fulfill requirements designed for an Option B associate's degree. 1210 South Sixth Avenue. Students may be able to apply their financial aid awards and veterans benefits to this program. For more information, call TESC-Tacoma at 253.680.3000 or TCC's Bridge Program at 253.680.3022 or 253.680.3023. Customized Services Customized tech- to computer start-up and entrepreneurship from small-business and and industry training On-site business nology and management. and work with companies are encouraged. Instructors consultation best suited to their needs. to develop the training organizations and management, computer basic skills, supervision Whether it's or interpersonal skills, TCC training, business plan development Downtown can assist you. and Assistance Business Information be accessed through TCC Downtown's forecasts and more can Computers programmed with business Business Information Center. industry information, and word processing plan software, labor and The Center also offers expert con- software can be used anytime. for those who need special guidance. sultation and referral services to the public. These services are free Center (ITCC) Information Technology Certification Tacoma Mall Campus certification. The provide computer-based high tech training and Focus priorities Center evolved in response to the College's Future hardware and and is supported by a growing need for computer to prepare area software certified expertise. Programs are designed and provide a employees and TCC students for certification exams competencies. means of verifying computer hardware and software 510, at the facility located at 4502 South Steele Street, Suite offering Tacoma Mall. Access to training is enhanced by classes. Industry industry-approved daytime, evening, and weekend instructors. approved classes are conducted by industry certified at the ITCC call To find out more about specific programs offered 253.475.2426 or our Downtown Center at 253.396.9128. ued emphasis on business and Tacoma Community College's Continuing Professional Education TCC Downtown Center's curriculum includes academic classes, TCC Downtown Center's curriculum includes academic program is headquartered at TCC Downtown. Continuing Profes- sional Education offers credit classes, certification programs, continu- ing education units and clock hour credits to assist professionals in attaining training to meet state licensing require-ments and promote professional excellence. Courses include classroom instruction, online classes and self-instructional videos. Instructors are licensed profes- sionals who are experts in their field. Courses are held daytime, evening and weekends at the main campus and downtown center. Continuing Professional Education computer applications in business, small business development, su- computer applications in business, small business and Continuing Pro- pervision and management, office skills training include current com- fessional Education courses. Computer classes software for micro- puter applications in accounting and the use of the distribution re- computers. The academic courses are linked to institutions quirements necessary for matriculation to baccalaureate in the area of business. Course examples include English, philoso- phy, foreign language and business communication. TCC Downtown also offers a wide variety of practical, career-oriented, supervision and management evening courses. The individually paced business learning center includes accounting, typing, business machines, data processing and other office-related courses. Credit Curriculum computer labs. In addition to its contin industry training, the center offers a variety of credit classes for industry training, the center offers a variety of students interested in university-level transfer. 6 Welcome Financial Aid,Bldg. Downtown Center Counseling Center,Bldg. Children's Center,Bldg. Cashier, Bldg.11 Career Center,Bldg. Bookstore, Bldg.11 Athletics, Bldg.9 Assessment, Bldg.18 Allied Health,Bldg. Advising, Bldg.18 Adult BasicEducation Admissions, Bldg.18 Campus Operator Frequently CalledNumbers college oruniversity. prior totransferringafour-year first twoyearsoftheireducation quarter arestudyingtoearnthe Nearly halfofallTCCstudentsevery Did YouKnow? ...... 9...... 19 8...... 18 ...... 8...... 18 ...... 3...... 23 8...... 18 253.396.9128 253.566.5122 253.566.5180 253.566.5040 253.566.5093 253.566.5163 253.566.5120 253.566.5001 253.566.5080 253.566.5011 253.566.5027 253.566.5097 253.566.5144 253.566.5000 Parking Services,Bldg. 253.566.5025 ... Multi-Ethnic andCulturalAffairs(MECA),Bldg.11 Job AssistanceCenter,Bld Information TechnologyCertification Gig HarborCenter GED PreparationClasses,Bldg.7, TRIO StudentSupportServices,Bldg. Testing InformationLine Student Newspaper,Bldg.8 Student ProgramsandActivities, Running Start,Bldg. Records/Registration, Bldg.18 Veteran's Office,Bldg. E etn rga,Bd.1 ...... GED TestingProgram,Bldg.18 Fresh StartProgram,Bldg...... 8...... 18 8...... 18 1...... 11 (24-hours) g. 18 A...... 2A The Challenge ...... Bldg. 11 room 13 ...... etr...... Center 7, room7 ...... 253.566.5093 ... 253.475.2426 253.566.5146 253.851.2424 253.566.5144 253.566.5042 253.566.5173 253.566.5158 253.566.5118 253.566.6061 253.566.5325 253.566.5153 253.566.5081 253.566.5086 Own Your Future Enrollment Services

We Did TCC Alumni clockwise “ I didn’t know anything about college when I left high school … I was working from top: at a warehouse … and I just knew that wasn’t my future … so I decided to James Curtis, 2000 look into Tacoma Community College.” James Curtis, 1st year law school student at the Univeristy of Washington Victoria Matteson, 2003 Reuth Kao, 2000 Bill Hagen, 2002 “ You’re never too old to start again.” Victoria Matteson, attended TCC through the Worker Retraining program. Currently employed in Information Technology at Dynea Overlays

“ [Receiving the First Generation Scholarship] allowed me to get involved … and, in effect, become a better person.” Reuth Kao earned a sociology degree at the University of Washington and is currently TCC’s First Generation Retention Specialist

“ TCC does a great job of keeping up with changes in a rapidly growing field. It was a big benefit and helped prepare me for the business world.” Ret. SFC Bill Hagen studied at TCC’s Information Technology Certification Center and is currently employed at Harborstone Credit Union

7 8 Enrollment Services making applicationmustprovidetheCollegewith: application andrelateddocuments.Eachinternationalstudent the quarterforwhichtheydesireadmissionprocessingoftheir in compliancewithimmigrationregulations. accept andenrollforeign,non-immigrantstudentsprovidedtheyare Department ofJustice,ImmigrationandNaturalizationServiceto Student AdvisorinBldg.11.TCCisauthorizedbytheUnitedStates regulations undertheguidanceofCollege’sInternational International StudentAdmissions the “Professional/Technical”sectionofcatalog. information contacttheprogramchairlistedwitheachin 253.566.5116 toapplytheCollege).Forprogram-specific a collegeapplicationandprogramifrequired(call of spaceinthedesiredprogram.NewTCCstudentsmustcomplete is dependentuponanindividual’squalificationsandtheavailability Professional/Technical Program additional admissioninformation. international students,theRunningStart,FreshStartorWorkerRetrainingprogramsandstudentsnotseekingadegreeshouldc one ormorequartersmustreapplytotheCollege.Toreapply,call253.566.5116applyonlineatwww.tacomacommunitycollege.c 253.566.5325. and GraduationsectionofthecatalogorcontactcredentialevaluatorinRegistrationRecordsofficelocatedBld been evaluated.Tolearnmoreabouttransferabilityofcreditsearnedfromotherinstitutionssee“CreditsTransferredtoTCC” for evaluation.Thesecreditscannotbeusedtoassignpriorityregistrationorsatisfycourseprerequisiterequirementsat admission information,call253.566.5001. selection. ApplicationformsareavailableattheAdmissionscounterinBldg.18andareahighschoolguidanceoffices.For Application mustbemadeatleastthreeworkingdaysbeforethequarterbegins,butearlierapplicationisrecommendedforbest is deniedadmissiontotheCollegebecauseofrace,creed,color,nationalorigin,sexualorientationorhandicap. case-by-case basis. 18 mustobtainawrittenreleasefromtheprincipalofhighschooltheylastattended;admissiontheseapplicantswillb graduated fromhighschoolmaybeeligibletoenterTCCthrougheithertheRunningStartorFreshprograms.Otherapplica College isavailabletoindividualswhoarehighschoolgraduatesoratleast18yearsofage.Applicantsunderage College hasan“OpenDoor”admissionpolicy,whichreflectsitscommitmenttoaccesshighereducation.AdmissionTacomaC Getting Started Applicants shouldallowseveralweekspriortothebeginningof International studentsareadmittedtoTCCaccordingfederal Admission intoaparticularTCCprofessional/technicalprogram Students whoplantoenteraspecificprogramsuchasProfessional/Technicalprogram,theEnglish-as-a-Second-Languageprogra Students whopreviouslyattendedTacomaCommunityCollege(includinganyoftheoff-campuscenters)andwhoseenrollmenthasla Students withtransferworkfromothercollegesoruniversitiesshouldhaveofficialtranscriptssenttotheRegistrationandR Application toTCCmaybemadeovertheinternetatwww.tacomacommunitycollege.comorbysubmittingawrittenapplication. Consistent withitsopendooradmissionspolicy,TacomaCommunityCollegepracticesequalopportunityineducationalprogra Admission toTacomaCommunityCollegeisasimpleprocess.However,duringtimesofhighenrollmentit’simportantapplyear evidenceoffinancialresponsibilitybysubmitting documents > evidenceofacademicpreparationbysubmittingofficial > for financialaid.) at leastone(1)year.(Studentson F-1 visasarenoteligible resources fortuition,feesandliving expensesforaperiodof which verifythattheapplicanthas sufficientfinancial transcripts providingproofofhigh school graduation. Student InformationSheet. with immigrationregulationslistedontheCollegeInternational issued I-20formsbyTacomaCommunityCollegemustcomply International studentswithF-1(foreignstudent)visaswhoare information oneligibility andapplicationprocedures. for NeedyFamilies(TANF)shouldcontact theWorkFirstofficefor WorkFirst ProgramAdmissions and benefits. should contacttheWorkerRetrainingAdvisortodetermineeligibility Worker RetrainingAdmissions order toprepareforemploymentshouldcalltheFreshStartoffice. dropped outofhighschoolandwanttoresumetheireducationin Fresh StartAdmissions Start office. interested intheRunningStartprogramshouldcallTCC Running StartAdmissions All documentsmustbeoriginalsorcertifiedcopies. Students whoarelowincomeorreceiving TemporaryAssistance Students whowishtoenrollinTCCWorkerRetrainingprograms Young adultsbetweentheagesof16and21yearswhohave High schooljuniorsandseniorswithcollege-levelacademicskills evidenceofstudentstatus(fornewtransferstudentsonly) > previous school. by submittingalettertoTCCconcerningtheirstatusat ...... TCC untiltheyhave e consideredona g. 18orcall whohavenot 253.566.5086 253.566.6061 253.565.9610 253.566.5188 in theDegrees nts age16to heck belowfor general ecords Center ommunity course ms. Noone om. ly! The m for psed for Enrollment Services 9 The Advising Center in Bldg. 18 coordinates campus-wide To encourage student success, entering students attend a student success, entering To encourage (6) or more credits, or taking math or New students taking six advisors Students should plan to meet with their permanent Special testing accommodations for students with disabilities for students testing accommodations Special Advising Center student advising services, provides advising referral services, and assigns permanent faculty advisors to students. Educational planners are available by appointment, or on a drop-in basis, prior to quarterly registration periods and they advise all new and readmitting students. They assist students with long term planning, provide information on transfer requirements for students intending to pursue degrees at Washington four-year colleges and universities, and assist students in developing educational and career goals. New Student Orientation New Student the orientation session, Orientation session. At New Student to programs and services of the college, students are introduced regarding the enrollment process. and receive valuable information for students who register for six or more This orientation is required are encouraged to participate. credits; however, all students in New Student Orientation Online at Students may participate instead of attending the ww.tacomacommunitycollege.com orientation on campus. Advising educational planner English courses, are expected to meet with an assist new prior to registering for classes. Educational planners schedules students with planning and completion of class and objectives. consistent with the students’ educational goals full-time faculty At the advising sessions, students are assigned may also be members as permanent advisors. Part-time students assigned advisors on request. choose classes on the designated advising day each quarter to discuss for the following quarter. Advisors and students expectations educational objectives, course requirements, faculty their educational and other topics which help students identify will be given a goals and select appropriate classes. Students The PIN allows students to Number (PIN). Personal Identi-fication registration time. register for classes online at their designated Registration times are assigned based on the student’s accumulated college credits. may be requested by contacting the Access Services Specialist in Services the Access by contacting requested may be Bldg. 18, 253.566.5328. 253.566.5001 ......

which you have not met; program.

> in 6 or more credits; > for English or math; > reading or English prerequisite in a course with a math, > program; in a degree, certificate or transfer > in the Running Start, Fresh Start, or High School Completion Transfer students who have completed college-level math and In an effort to provide effective educational services for In an effort to provide effective educational services The College’s educational planning program includes Tacoma Community College is committed to helping each Tacoma Community College is committed to helping Students with advanced degrees or students wanting to take wanting or students degrees with advanced Students

TCC serves approximately 19,000 TCC serves approximately the highest students annually; the college’s history. enrollment in To enroll visit www.tacomacommunitycollege.com Did You Know? Did You English coursework with a grade of “C” or higher may substitute a transcript review for the assessment process. Unofficial transcripts may be used for this step, but students are also encouraged to request an official transcript be sent to the Registrar. Unofficial transcripts cannot be used to award transfer credit. students, Tacoma Community College’s entry skills assessment students, Tacoma Community College’s entry skills and weaknesses in program helps identify each student’s strengths may include reading, writing, and math. The assessment process The results are used basic skills testing or college transcript review. for academic advising, course placement, and program placement. Assessment is required for any student who plans to register: Assessment computerized basic skills assessment, new student orientation, and computerized basic skills assessment, new student services are academic advising. These programs and other college in selecting and designed to give you the best possible assistance educational goals. enrolling in classes that match your abilities and student achieve his or her educational goals. To accomplish this, an student achieve his or her educational goals. To continues throughout educational planning program is offered which your career at TCC. Your Academic Future course work for their own interest who do not plan to pursue a who do not plan to pursue for their own interest course work status for Non-Degree Seeking may be eligible degree or certificate Students with Non-Degree registration process. and an abbreviated to 5 credits or less each are generally limited Seeking Status for additional information. the Admissions office quarter. Contact Non-Degree Seeking Status Seeking Non-Degree 10 Enrollment Services result inadditional tuitionandfees. Registration andRecordsCenter.Changes inclassschedulemay Start andInternationalprograms. enrolled incontract(non-statesupported) programssuchasRunning enrollment. Concurrentenrollmentis notanoptionforstudents determine ifacourseorprogramiseligibleforconcurrent colleges. CheckwiththeRegistrationandRecordsCenterto enrollment opportunitiesthrougharticulationagreementswitharea Concurrent Enrollment requirements forstudentswithnon-citizenshipstatus. Admissions officeformoreinformationregardingresidency refugee differentialrateof125%residenttuition.Contactthe military orderstotheAdmissionsofficeinBldg.18. student mustbringinhis/hermilitaryID,andacopyof resident tuitionrate.Toreceivetherate, members, theirspouses,anddependentsareeligibleforthe nonresident andresidenttuitionwillbeprocessed. status hasbeensubstantiated,arefundforthedifferencebetween be reviewedbytheResidencyOfficer.Ifachangetoresident would apply.Theapplicationandallsupportingdocumentationwill up tothe30thcalendardayofquarterinwhichchange Bldg. 18.Applicationstochangeresidencystatuswillbeaccepted establishing residencyareavailableintheAdmissionsoffice questionnaire formsandfurtherinformationaboutrequirementsfor Admissions office. about awaiverofthenon-residenttuitiondifferentialat immigrants whoholdpermanentresidentalienstatusshouldinquire prior tothefirstinstructionaldayofquarter.U.S.citizensand purposes. Onceestablished,theresidencymustexistforoneyear must resideinthestateofWashingtonforotherthaneducational student ortheparent(s)legalguardian(s)ofadependent Residency using thecollegewebsite. Bldgs. 2and18.Paymentbycreditcardmayalsobemade boxes forcheckormoneyorderpaymentsarelocatedoutside (253.566.5011) orattheCashierofficeinBldg.11.Paymentdrop Payments maybemadebyphonewithaVisaorMasterCard Late paymentsmayresultincancellationofregistration. quarterly scheduleorwithintwobusinessdaysofregistration. class schedule. Current quarterlytuitionandfeeratesarepublishedinthe Tuition andFees Students mustcompleteaconcurrent enrollmentformatthe Tacoma CommunityCollegeoffersasmallnumberofconcurrent Persons residinginthecountryasrefugeesareeligiblefora Active dutymilitarypersonnelandWashingtonNationalGuard A numberoffactorsareusedtodetermineresidency.Residency To beconsideredaresidentfortuitionpurposes,anindependent Tuition andfeesareduebythedefermentdatepublishedin Tuition ratesaresetbytheWashingtonStateLegislature. Registration andRecordsCenterforinformation. on aspace-availablebasisandinclude: certain studentsenrolledinstate-fundedclasses.Thesewaiversare Space-Available TuitionWaivers fees arepublishedinthequarterlyclassschedule. for individualizedinstructionandotherincidentals.Thesespecial College chargesfacilitiesuseandsafetyfees.Studentsarecharged Health courses,andmostlaboratorycourses.Additionally,the enrolling inscienceandartcourses,physicalactivityAllied Special Fees the Registrationand RecordsCenterfortheserates. regular collegecalendarwillhavepro-rated refundperiods.Contact through the20thcalendarday. after thecoursebeginsanda40percent refundfromthe6th will beallowedan80percentrefund forfive(5)instructionaldays register atanytimeafterthebeginningofquarter,astudent following schedule: scheduled holidays.Refundswillbemadeaccordingtothe days schoolisinsession,notincludingweekendsand is noteligibleforarefund.Instructionaldaysaredefinedas A studentdismissedfromtheCollegefordisciplinaryreasons complete theofficialwithdrawalproceduretoreceivearefund. students areconsistentwithstatestatutes.Astudentmust Credit Classes Refund Policy Other tuitionwaiversareavailable.Pleasecontactthe Tacoma CommunityCollegeoffersreducedorwaivedtuitionfor The Collegechargesspecialfeesatregistrationtostudents Summer quartercoursesand whichdonotfollowthe For continuousenrollmentcourseswhichpermitastudentto College proceduresfortherefundoftuitionandfeesto StateEmployeesandNationalGuard-enrollthirddayof > Senior Citizens(persons60yearsofageorolder)-enroll > SPRUCE(Theunemployedorunderemployed)-enrollsecond > Withdrawalafterthe20thcalendardayof > Withdrawalfromthe6ththrough the20thcalendardayof > Withdrawalduring thefirstfive(5)instructionaldaysof > Withdrawalpriortothe firstinstructionaldayof > Withdrawalresultingfromclassesbeingcancelledby > quarter (employerverificationrequired). third dayofquarter. day ofquarter. quarter the quarter the quarter the quarter the College ...... 0% ...... 40% ...... 80% ...... 100% ...... 100% Enrollment Services 11 degree objective and will be paid only for those classes degree objective and will be paid only for those study. that apply toward the VA approved program of “WI”, “S”, “U”, “R”, or “W” will result in overpayment; the benefits this means you will have to repay some or all you received. 18 when changing classes, withdrawing from the College or when deciding to stop attending classes. “Tacoma Community College’s academic programs of study are approved by the Higher Education Coordinating Board’s State Approving Agency (HECB/SAA) for enrollment of persons eligible to receive educational benefits under Title 38 and Title 10, U.S. Code.” 1. study or Veterans using benefits must declare a program of 2. work paid for. Grades of “N”, “V”, Complete the course 3. Veterans must notify the Veteran’s Service office in Bldg. An information board listing scholarships is maintained in An information board listing education and Tacoma Community College is approved for the Veterans Veterans attending TCC who expect to receive Benefits will be terminated for unsatisfactory progress or Failure to successfully complete the classes may cause financial complete the Failure to successfully applicants should note that previous All potential financial aid Scholarships www.tacomacommunitycollege.com. Bldg. 18 and online at summarizes the scholarship criteria The posted information Application packets for individual and application process. at the Financial Aid office counter. scholarships are available Reservist Veterans, Active Duty Military and Services of deceased or training of veterans, the children and spouses of the selected 100% disabled veterans, and eligible members should contact the reserves. Veterans, reservists and dependents apply for benefits Veterans Services office for an appointment to at 253.566.5081. standard Administration benefits must meet three minimum the college: requirements, in addition to those required by conduct. Those benefits may be reinstated by a certifying official upon establishing a reasonable likelihood that satisfactory progress and/or conduct will be sustained in the future. This can occur only after all other admission requirements have been met. receive financial aid. Students planning to drop after financial aid drop after planning to Students financial aid. receive aid with a financial changes should discuss disbursed has been advisor first. of the repayment of a portion and may result in aid to be cancelled A complete policy and all or a portion of tuition. aid received office in the Financial Aid standards is available regarding these to all aid recipients. upon request and is mailed will be reviewed prior to granting funds. academic performance ...... 100% of withdrawal* ...... 0% begins class ...... 0% ...... 100% ...... 0%

the College require a two week notification require a two week notification meeting

> Withdrawal prior to the first class session or event .....100% > Withdrawal resulting from classes being cancelled by > training and certification programs ALL high technology > Withdrawal less than two weeks prior to class > Withdrawal after class > in No appearance Students are expected to successfully complete the credits for All financial aid awards are based on full-time enrollment (12 or To be eligible to receive financial aid funds, students must be in Financial aid is designed to provide assistance when income is Applying for financial aid takes time. Contact the Financial Aid Applying for financial aid takes time. Contact the After the first class session, refunds will be granted only in After the first class session, refunds will be granted Refunds are made according to the following schedule: Enrollment in High Technology & Certification programs requires High Technology & Certification Enrollment in which they enroll with a grade point average (GPA) of at least 2.0. In doing so, students remain in good standing and can continue to more credits). However, aid may be available for less than twelve credits upon notification by the student. an eligible degree program (or a certificate program that leads to a degree and is 24 credits or more in length), have completed a high school diploma or GED and must have received a financial aid award. Students advised into Adult Basic Education (ABE) will be eligible to receive aid after completing ABE and being advised into an eligible college certificate or degree program. insufficient to meet the cost of going to college. Aid programs include grants, work study, loans and scholarships. office in Bldg. 18 to pick up the required application materials. It is office in Bldg. 18 to pick up the required application or February for advisable to begin the application process in January priority funding is the upcoming academic year. The deadline for quarter. Specific typically mid to late March for the upcoming fall Financial Aid office deadlines for each quarter are available from the and online at www.tacomacommunitycollege.com. Financial Aid cases of student illness or other special circumstances. Financial Assistance All Other Non-Credit Classes All Other Non-Credit * Note: $200 of High Tech Training & Certificate tuition is non-refundable. * Note: $200 of High Tech instructor permission. Tuition and fees are due in full at the time of are due in full at the Tuition and fees instructor permission. will deposit. Refunds and include a $200 non-refundable registration schedule: to the following be made according High Technology Training and Certification Training Technology High Schedule Refund Program 12 Enrollment Services form canbe: form foundinthequarterlyclassschedule.Thecompleted Non-Credit CourseEnrollment are alsoprovidedinthequarterlyclassschedule. receive registrationinformationbymail.Step-by-stepinstructions appointment. Newstudentsregisteringforfivecreditsorlesswill advisor andwillreceiveregistrationassistanceduringtheiradvising registering formorethanfivecreditsareexpectedtomeetwithan Credit Courses New andReadmittingStudentsEnrollingin class schedule. important datesanddeadlines,arepublishedinthequarterly Detailed informationandproceduresforregistration,aswell Registration Students mayregisterbycompletingthemail-inregistration Students registerusingthecollegewebsite. Registration istheprocessofenrollinginclasseseachquarter. Forcreditcardpaymentsonly,thestudentmayenrollin > droppedoffattheContinuingEducationofficeinBldg.24. > mailedwithcheckorcreditcardpaymenttotheContinuing > and chargingtheircoursefeestoVisaorMasterCard. Continuing Educationcoursesbyphoning253.566.5020 (Cash paymentsmustbemadetothecashierinBldg.11). Education officeatTCC;or students studyatTCCeveryquarter. An averageof250international Did YouKnow? Registration andRecordsCenter. of thetransactionisdatecompletedformreceivedat the RegistrationandRecordsCenterinBldg.18.Theeffectivedate after thisdatemustbemadeonanAdd/Dropformandsubmittedto through the3rdinstructionaldayofquarter.Changesmade Schedule Changes third instructionaldayofthequarter. but notyetenrolledinanycourseworkareacceptedthroughthe Late Registration class schedule. quarter. Specificinstructionsforthesefunctionsareinthequarterly aid award,tuitionandfeesowed,finalgradesattheendofa new students. courses maycontinuetousetheregistrationoptionsavailable the quarterlyclassschedule.Studentstakingonlynon-credit using thecollegewebsite.Detailedinstructionsareprintedin Currently enrolledstudents Students mayaddordropacourseusingthecollegewebsite Late registrationsforstudentswhohaveappliedtothecollege Students mayalsousethewebtocheckstatusofafinancial Students increditcoursesregisterfortheirnextquarter Enrollment Services 13 Some classes have automated waitlists. When students attempt Some classes have automated waitlists. When Medical or military withdrawals may be granted in cases where Medical or military withdrawals are initiated by the College to Administrative withdrawals to register for these full classes they are offered the opportunity to to register for these full classes they are offered the waitlist on a be placed on a waitlist. Students are placed on add themselves to a first come, first served basis. Students cannot of the same waitlist if they are already enrolled in another section while on a waitlist. course, but they may enroll in another section at a time. Once Students can be on a total of two different waitlists activity for a class has an active waitlist, all regular registration classes, waitlisted that class stops. As other students drop these from the students are registered into available class openings are frozen one waitlist in the order they were received. Waitlists have not been week prior to the start of a quarter. Students who near the top of a registered into a class by this point, and who are of class to see waitlist, are encouraged to attend the first day See the quarterly whether the instructor will permit an overload. class schedule for more detailed information. Withdrawals serious illness or medical emergency or is a student experiences a military service. Petition forms are called up for active-duty and Records Center in Bldg. 18. available at the Registration must be provided at the time the petition Written documentation is submitted. disciplinary reasons, failure to meet withdraw a student for other exceptional causes. Students who are academic standards, or for disciplinary reasons or failure to administratively withdrawn refund of tuition. meet academic standards are not eligible for a Audit options.) (See Grade Policies for Course Repeat and Course Waitlists any special obligations the student may have relating to financial relating may have the student obligations any special and Naturalization or Immigration benefits veteran aid awards, advised to review possible status. Students are Services (INS) or all withdrawal from a class before proceeding with consequences 10). also refund policy on page classes (see quarter can be done on the college web site. There will be quarter can be done on the college web site. There no entry regarding this class on the transcript. signature through the 10th day of the quarter (instructor’s Submit form is not required for a drop during this period.) before the to the Registration and Records Center on or be no 10th instructional day of the quarter. There will entry regarding this class on the transcript. drops with instructor’s signature is required to complete calendar from the 11th instructional day through the 50th day of the quarter. Submit the form to the Registration and Records Center. A grade of “W” will appear on the transcript indicating official withdrawal from the course. longer have the option to withdraw from a course. An instructor may grant a grade of “WI” or any other letter grade appropriate. quarter can be done on the college web site. Follow be done on the college quarter can the quarterly class schedule. directions in with the first students they are filled daily openings occur one week before classes All wait lists close on these lists. notice of placement in a begin. If you have not received of the quarter we recommend that class prior to the start of class to check for openings. you attend the first day should check for schedule changes Students on wait lists frequently. the quarter. The instructor’s through the 10th day of into class is required. Submit signature approving entry and Records Center no Add/Drop form to the Registration Adds later than the 10th instructional day of the quarter. day of the will not be accepted after the 10th instructional or quarter with the exception of continuous enrollment late-starting classes. > Drop transactions completed through the 3rd day of the > An Add/Drop form is required for transactions from the 4th > While faculty permission is not required, an Add/Drop form > of the quarter, students no After the 50th calendar day >the 3rd day of before the on or completed Add transactions > class wait lists. When Some classes have automated > the 4th Add/Drop form is required for transactions from An Students who register for a quarter and then do not attend must Students who are physically unable to come to campus to complete an official withdrawal. Failure to complete fee payment may not result in a cancellation of registration or tuition and fees. A failing grade may be assigned and be posted to the student’s permanent record. The consequences of dropping a course vary depending upon both the time frame in which the drop occurs and complete an Add/Drop form must notify the Registrar in writing of their intent to officially withdraw. The letter must be postmarked by the 50th calendar day of the quarter. To Drop a Class: To Add a Class: To Add 14 Special Services for Students TCC’s Children’sCenter. with sonSteven,Jr.at Steve Cordinglyplays Business student AttendingTacomaCommunityCollegewasperhapsthegreatestdecisionI’ve “ with me.Mycareergoalistobesuccessfulinowning myownrestaurants.” educational needsandIfeelrelaxedknowingmychild ispresentoncampus ever made…Thechildcarecenterhashelpedmegreatlyinfulfillingmy are featuredanddetailedinothersectionsofthiscatalog. support andassistyouinachievingyoureducationalgoals.Manyof theCollege’sstudentserviceprograms Tacoma CommunityCollegeoffersavarietyofinstructionalandstudent servicesprogramsdesignedto Steve Cordingly Special Services for Students 15 253.566.6032 253.566.5184 ...... The Tutoring Center, located upstairs in Bldg. 11, assists The Tutoring Center, located upstairs in Bldg. The Writing Center is designed to provide individual It is best for students to make an appointment first in order Student technology fees have supplied the Writing Center Librarians are available to help students choose and refine choose and students to help are available Librarians in-house video department provides The Media Services Lab is used for class and individual The Listening Language been Financial support of the library collection has Tutoring Center who wish to be students in a variety of subject areas. Students Tutoring Center. tutored or to serve as tutors should contact the Writing Center in copies of their assistance with writing. Students may bring they need assignments, notes, drafts - anything with which help. The Center is staffed by competent instructional with all aspects of assistants who are trained to help students their writing, including develop-ment, research, coherence, organization, and documentation. The Writing Center is also available online at www.tacoma.ctc.edu/home/hurschel/. Email your paper to [email protected] for a complete review and suggestions for improvement. to guarantee a tutorial time. Appointments can be made by calling the Writing Center or by stopping by Bldg. 7, room 4. with new computers to provide additional services such as online tutoring, computer-assisted tutorials, and tutoring in online research. research topics, create research strategies and locate and use a and use and locate strategies research topics, create research teach Faculty librarians of information resources. wide variety skills credit information competency/information one and two in many classes appear as “guest lecturers” courses and the quarter. throughout production workstations, as well viewing stations and multimedia for classroom use, including compact as a variety of equipment players, portable public address systems, disc, cassette, and video wall and tripod projection screens, opaque and LCD projectors, video classroom enables and camcorders. An interactive sites through the K-20 network. connections to distant drills, listening skills development language practice, vocabulary Audiotapes for courses are available and and music appreciation. tapes provided by students when the lab staff will duplicate licensing permits. College supplemented by the Friends of the Tacoma Community the Library, a non-profit organization with open membership, Associated Richard Bangs Collier Pleneurethics Society, the Foundation, the Students of TCC, the Tacoma Community College Kraft Company. Boeing Charitable Trust and Simpson Tacoma 253.566.5087 253.566.5369 253.566.5144 ......

The library provides a Kurzweil reader, CCTV, TDD, and Over 35 computer workstations in the Library and Media The Library and Media Services collections include books, The Library and Media Services collections include The Library, Media Services and the Listening Language Lab The Library, Media Services and the Listening Students generally participate with their classes during weekly Students generally participate with their classes With an increase in the demand for CD ROM and web based With an increase in the demand for CD ROM and Located in the Bldg. 7 Learning Resource Center, the CAL Lab Located in the Bldg. 7 The Adult Learning Center offers instruction for adults Center offers The Adult Learning computer workstation with adaptive software to assist students with disabilities. Services areas provide access to the library’s online catalog and electronic databases, as well as Internet access. Selected workstations can be used for word processing and multimedia production. journals, videos, compact discs and electronic databases and journals, videos, compact discs and electronic journal collections. Students can access many electronic library resources anytime/anywhere over the Internet. The library subscribes to over 1,000 journals in print and electronic formats. Ethnic and Northwest history materials are well represented. There is a special collection of high-interest, low-reading-level materials for develop-mental and ESL students. A reserve collection supports class assignments. Inter-library loan services are provided. are located in Bldg. 7. Open hours vary from quarter to quarter. are located in Bldg. 7. Open hours vary from quarter online at Current hours and other information are available www.tacoma.ctc.edu/library or by calling 253.566.5087. Library, Listening Language Lab & Media Services reserved times, although students may drop in and use computers reserved times, although students may drop in basis. Students may that are available on a first come, first serve learning and also be referred by their instructors for individualized study assignments. instruction, as well as online courses, the lab also offers computer instruction, as well as online courses, the lab instruction. workstations for our college level program of provides a specialized computer assisted learning facility for provides a specialized computer courses in reading, develop-mental (pre-college) level basic skills English, ESL, GED prep and math. Computer Assisted Learning Computer Assisted (CAL) Lab wishing to improve basic reading, writing, math and English-as- improve basic reading, wishing to also offers GED skills. The Center a-Second-Language are These classes and high school completion. preparation years of age or older. All classes are free designed for adults 18 of sites around Pierce County. For and are offered at a variety placement testing, class location and more information about the Adult Learning Center at registration, please call the center in Bldg. 7, room 13. 253.566.5144 or visit Adult Learning Center Adult Learning Instructional Services Instructional 16 Special Services for Students services offeredbyMECAinclude: of whatitistoliveinamulticulturalpluralisticsociety.Programsand in anenvironmentthatfostersrespect,dignity,andunderstanding that allstudentshaveanopportunitytoachievetheiracademicgoals the College’sdiversestudentcommunity.MECAalsostrivestoensure variety ofcampus-widesupportservicestailoredtomeettheneeds (MECA) The CenterforMulti-Ethnic/CulturalAffairs offers anumberofvaluableresourcesincluding: students inmakingcareerandeducationaldecisions.TheCenter Career Center disability/start.shtm. to makeanappointmentorvisitwww.tacoma.ctc.edu/stuonline/ located intheAssessmentCenterBldg.18,orcall253.566.5122 options andopportunities,pleasevisittheAccessServiceoffice, official documentationtothedisabilityspecialist.Tolearnabout To receiveacademicaccommodations,studentsmustprovide all studentswithdisabilitiesreceiveappropriateaccommodations. fostering studentindependence.TCCiscommittedtomakingsure Access Services’staffischargedwithcoordinatingservicesand equal accesstoprogramsandactivitiesofferedatthecollege. Serving PersonswithDisabilities Access Services: Student Services necessary andallresourcesarefree. The CenterforMulti-EthnicandCulturalAffairs(MECA)providesa The TCCCareerCenteroffersextensiveresourcestoassist Access Servicesensuresthatstudentswithdisabilitieshave The CareerCenterisopenMonday-Friday.Noappointment TheEmergency Short-termBookLoan > Specialevents, includingculturalandstudentsuccess > Leadershipdevelopmentthroughworkstudyandvolunteer > Scholarshipsearchservices > Academicadvising > Computer-AssistedExplorationPrograms > CollegecatalogsforWashingtoncollegesanduniversities. > Labormarketinformation. > Acareer-jobsearchlibrary. > Careerinformationfilesonhundredsofoccupations. > Computerprogramsdesignedtohelpyouinvestigateyour > WashingtonOccupationalInformationServices(WOIS),a > programs. programming andpeermediationpositions. positions withMECA’speerassociate program,event learning style,personalityandtemperament. Washington State. occupational andeducationalinformationspecificto system providingaccesstoaccurate,up-to-date ...... 253.566.5025 253.566.5027 253.566.5122 coming toBldg.23. assessment, andbreakfasts,hotlunchesafternoonsnacks. such asfamilyresourceandreferrals,developmentalscreening of parenteducationcourses.Inaddition,theCenteroffersservices 7:30 a.m.-4:30p.m.,MondaythroughFriday. sliding feescale,basedonparents’income.Centerhoursare develop-mental levelofthechildren.Tuitionisdeterminedbya and providesacomprehensiveprogramofactivitiessuitedtothe staff beingservedonaspace-availablebasis. priority forenrollmentintheCenter,withchildrenoffacultyand dren ofTCCstudentsthataretaking10creditsormoregiven housed inaspeciallydesignedbuildingoncampus(Bldg.23).Chil- hours offreepreschoolperday. can enrollinthepreschoolECEAPprogramwhichprovides2-1/2 safe, nurturingenvironmentfortheirchildren.Eligible4-year-olds designed toenableparentspursuetheireducationbyprovidinga Children’s Center call 253.566.5025. encouraged tocontactMECAonthesecondfloorofBldg.11,or TCC chapterofthePhiThetaKappaInternationalHonorSociety. call 253.566.5216. currently enrolledinaProfessional/Technical program.Please A counselorisalsoavailableinBldg. 19forstudentswhoare stop bytheCounselingCenterinBldg. 18orcall253.566.5122. fees) toallenrolledandprospective students.Foranappointment, vices availabletostudentsinclude: students inanatmosphereofmutualtrustandconfidentiality.Ser- Counseling Center Students canplacetheirchildren’snamesonthewaitinglistby Students usingtheCenterarerequiredtoparticipateinaseries The Centeracceptschildrenfrom18monthsto5yearsofage The Children’sCenterisastate-certified,non-profitcenter, The Collegeoffersahighquality,affordablechildcareprogram All studentsofcolorandreturningadultare The Centeralsosupportsseveralstudentclubsandhoststhe Counseling Centerservicesarefree (with theexceptionoftest The CounselingCenterstaffoffersawidevarietyofservicesto Referraltoawidevarietyofcommunityresourceswhen > Informationonpreventionandrecoveryfromsubstance > Special-interestworkshops/classpresentations. > Classes inhumandevelopment,careerandlifeplanning. > Current informationoneducationalandcareer opportunities. > Careerinteresttesting. > Counselingtoassist inchoiceofacademicmajor,program > Counselingtoaddress personalconcernswhicharehindering > Counselingtoassistineducationalplanning andresolving > additional servicesareneeded. abuse. or career. academic success. problems relatingtostudies...... 253.566.5180 253.566.5122 Special Services for Students 17 253.566.5122 253.566.6085 253.566.5153 ...... 8 a.m. - 6 p.m., Monday-Thursday 8 a.m. - 5 p.m. Friday Summer hours vary. A variety of workshops, support groups and activities are A variety of workshops, support groups and activities New and used textbooks for all courses at Tacoma Community Student Support Services is committed to providing to is committed Support Services Student planning and advising, advocacy Our services include academic Services is federally funded through a TRIO Student Support TRIO Educational Talent Search (ETS) is a federal funded Women’s Programs women’s planned on campus throughout the year to support a class offered spring interests. Life Choices for Women (HD 116) is may call Multi-Ethnic/ quarter to assist women in transition. Women questions about Cultural Affairs or the Counseling Center with women’s programs. The Children’s Center and Continuing Education offices have information regarding classes of interest to parents. Other Services College Bookstore College may be purchased in the Bookstore, Bldg. 11. Art and classroom supplies, nursing uniforms, postage stamps, and monthly bus passes are also available. Special orders for books may be placed by anyone. Regular business hours are: TRIO Programs TRIO to and support services educational enhancement comprehensive and students with low-income students, first-generation, and excellence. Program promoting access, diversity disabilities; increase participants’ designed to significantly activities are to four-year institutions. retention and transfer academic success, career exploration services, college within the college system, needs assessments, coordination skills workshops, comprehensive with disabilities, financial aid advising, of services for students advising, scholarship search mentoring, personal development and transfer services including assistance, tutoring resources, tours. Please visit us in Bldg. 7 or transfer advising and college call 253.566.5153. $1,274,524 from the U.S. Department five-year grant totaling of Education. Tacoma Public program designed to assist 600 youth within oppor-School District to better understand their educational including tunities and options. ETS provides outreach services, career and tutoring, academic advising, personal counseling, middle school and college preparation and mentoring to Jason Lee by a strong Stadium and Foss high schools. Our work is driven and excellence, and commitment to educational access, diversity of our educa- the belief that each student is a valuable member to join us in tional community. ETS welcomes TCC students Please visit us in making a difference for our community youth. Bldg. 7 or call 253.571.3963. 253.566.5122 253.566.5190 253.566.5190 253.566.5191 253.566.5146 ...... If you want to live and learn in a foreign country you can Men are encouraged to stop by the Counseling Center in Bldg. Men are encouraged to stop by the Counseling Individuals seeking full or part-time employment may contact Individuals seeking full or part-time employment Through the College’s International Student Services office, Through the College’s International Tacoma Community College provides a quality learning Tacoma Community College Employment Security Services are available in Bldg. 18 by the in Bldg. are available Services Security Employment partici-pate in quarter-long study abroad programs as a TCC student. You can earn credits applicable to the AAS degree while experiencing a foreign culture and developing global competencies. Information on these programs is available in the International Student Services office located in Bldg. 11. Study Abroad 18 or call 253.566.5122 to inquire about resources available addressing men’s issues or concerns. A men’s support group is offered when interest is expressed and a 3 credit Human Development course Life Choices for Men (HD 116) is offered spring quarter. The Children’s Center and Continuing Education offices have information regarding classes of interest to parents. Men’s Services the Job Assistance Center in Bldg. 18. Opportunities for the Job Assistance Center in Bldg. 18. Opportunities available full-time, assistance in finding jobs include postings of and assistance in part-time, temporary and seasonal employment, Web and other exploring employment opportunities through the provides assistance Internet services. The Job Assistance Center and interviewing with job search skills, including resume’‚ critique TCC’s techniques. The Job Assistance Center also sponsors annual Job Fair. Job Assistance Center students receive support in a variety of areas including detailed students receive support and registration, academic advising, and assistance in admissions and community. In addition the office orientation to the campus regulations from the U.S. Immigration and provides information on students also Naturalization Service. Services for international request help with include housing and activities. Students who for homestays or accommodations are matched with local families Student placed in nearby apartments. The International plans many events Organization, a large and active student club, students. each quarter that are of special interest to international environment in which international students can pursue their environment in which international The College is committed to international educational objectives. promote cultural, political, and social education as a means to awareness and understanding. International Student Services International employment security representative. This representative can This representative security representative. employment readiness skills, job referrals search assistance, job provide job information. and unemployment Employment Security Services Security Employment 18 Special Services for Students Counseling CenterinBldg.18,formoreinformation. students whoareseekingroommatesand/orhousing.Contactthe off-campus housingforstudentsandhasinformationabout Housing Information buildings oncampus. quarter. WeareclosedduringProfessionalDevelopmentDays. and freshsconesarebakedeverymorning.Operatinghoursare: provides bothbreakfastandlunchitemsthatareavailableallday chicken, Asianfood,andespressostand.Inaddition,thegrill Subway sandwichshop,smoothiebar,pizzacounter,bagels,fried Bldg. 11.Avarietyoffoodandbeveragesareavailableincludinga Food Court beauty aids,newspapersandgreetingcards.Operatinghoursare: cold drinks.Wealsohavevarioussupplies:scantrons,healthand Bookstore. Wehavesoup,chili,hot-dogs,nachos,coffee,candyand Convenience Store Tacoma CommunityCollegemaintainsalistingofavailable Additionally, foodandbeveragemachinesarelocatedinmany Hours varyduringAdvisingDay,holidays,finalsweekandsummer The TCCFoodCourtislocatedintheOpgaardStudentCenter, The ConvenienceStoreislocatedatthenorthendof 7:00 a.m.-1:00p.m.onFriday. 7:00 a.m.-2:00p.m.Monday-Thursday Holiday andsummerhoursvary. Saturday, 9a.m.-1p.m. Friday, 7a.m.-5p.m. Monday-Thursday, 7a.m.-8p.m...... 253.566.6023 253.566.6076 by calling253.566.5111. are encouragedtoreportanyunusualcampusincidentstheoffice department andhandleemergencysituations.Studentsstaff vehicle usage,investigateaccidents,maintainalostandfound Members ofthiscampusunitmaintainparkingcontrols,monitor prevention program,andtheprotectionofpeopleproperty. and employees,theinitiationmaintenanceofanaccident safe andhealthyeducationalworkingenvironmentforstudents Safety andSecurityOffice employment. ParkingpermitscanbeobtainedinBldg.11. registration andtoeachemployeeatthetimeofhisorher may resultinfinesorotherpenalties. a permitortoadhereparkingandtrafficrulesregulations administrative orfaculty/staffdesignatedspaces.Failuretoobtain parking permitwhichauthorizestheirvehiclestoparkinthe Administrators, faculty,andstaffarerequiredtohaveavalid in thedesignatedstudentareas(redorunmarkedspaces). Parking onCampus Computer Lab,MathandFitnessCenter. Student Center.TheIDcardisusedforaccesstotheLibrary, Student Programs,Bldg.11.TheIDOfficeisintheOpgaard ID Cards education inTacoma andPierceCounty. individuals whoarededicatedtoproviding accesstotop-quality receives grantfundingfromareacorporations, foundations,and faculty andstaffdevelopment, capitalprojects.TheFoundation subsidies toTCC’sChildren’sCenter, emergencystudentloans, wide rangeofcollegiategoalsincluding scholarships,childcare education forourcitizensinTacoma-PierceCounty. mission ofTacomaCommunityCollegebyendowingqualityhigher non-profit corporation,formedtoactivelyandvisiblysupportthe Foundation Tacoma CommunityCollege start.shtm. accessible onlineatwww.tacoma.ctc.edu/stuonline/handbook/ of StudentProgramsandmanyothercampuslocations.Itisalso students mayneedtoknowthroughouttheschoolyear. programs, studentrightsandresponsibilities,otherinformation handbook includesinformationaboutcampusevents,student students. PublishedbytheAssociatedStudentsofTCC, Student Handbook The OfficeofSafetyandSecurityisresponsibleforprovidinga Security andparkinginformationisgiventoeachstudentduring Students arerequiredtodisplayaparkingpermitwhen Photo identificationcardsareavailablethroughtheOfficeof Through giftsandbequests,theFoundationisabletosupporta The TacomaCommunityCollegeFoundationisaphilanthropic, The HandbookisavailableattheTCCStudentCenter,Office The StudentHandbookprovidesimportantinformationtoTCC ...... 253.566.5111 253.566.5323 253.566.5173 253.566.5003 Student Programs and Activities 19 Stephanie McDuff Students’ learning and development occurs not only in the classroom, but in other areas of the College Students’ learning and development occurs not only in the classroom, but in other areas Through the Student Programs office, the Associated Students strive to enhance the student’s organizations, Specific programs available to students include student government (ASTCC), clubs and series ASTCC sponsors a variety of activities throughout the year, including an artist and lecture join Students are encouraged to serve on committees, become involved in student government, as well. Tacoma Community College seeks to provide an opportunity for students to explore their as well. Tacoma Community College seeks to provide an opportunity for students to explore potential for growth as individuals. athletic, overall educational experience by offering participation in educational, cultural, intellectual, recreational, social and leadership programs. The intercollegiate athletics, intramural sports, the campus newspaper, music and drama programs. services, student Student Programs office also supports services including the Children’s Center, tutorial Bldg. 11. identification cards, the Student Handbook and the Information Center in the Student Center, events and field trips. In addition, outdoor activities, panel discussions, educational films and wellness are offered. with the volunteer projects, or simply participate in campus activities. That’s what can connect you or campus community! Students interested in student programs and activities should call 253.566.5118 stop by the Student Programs office. great experience.” “ TCC has been a Being involved on a winning girls team for basketball here at First year women’s basketball coach Jessica Schutt was voted Western Region Coach of the Year by the Northwest Athletic Association of Community Colleges Western Region Coaches for winning the division. 20 Student Programs and Activities Student Programsoffice,Bldg.11, orcall253.566.5118. or change.Interestedstudentsare encouragedtocontactthe starting newclubsandorganizationsasstudentinterestsdevelop Kappa arejustafewoftheactiveclubs.Opportunitiesexistfor Engineering Club,StudentNursingOrganizationandPhiTheta International StudentOrganization,BlackUnion, interests, ethnicawarenessandrecreationalinterests.The opportunities. Currentcampusclubscenteraroundacademic provide newandimaginativerecreationaleducational appreciation ofvariedculturalandartisticbackgrounds, organizational andleadershipskills. opportunities; personalgrowth;andthedevelopmentofsocial, in theCollege’sclubsandorganizationsencourageseducational interests thatcompriseTacomaCommunityCollege.Participation Clubs andOrganizations student programsatTCC. participating instudentgovernment,haveamajorimpacton by theirinvolvementinplanningevents,leadershiptraining,and are membersoftheASTCCstudentgovernment.STAGEstudents, attend atwo-creditmanagementcoursethroughouttheyearand multicultural events. recreation, entertainment,publicity,clubs,communitylifeand coordinator positionsinSTAGEincludeintramural,outdoor into paidmanagementpositionsoncampus.Someofthe is aleadershiptrainingprogramwhichinvolvesplacingstudents Earning Student AccesstoGrowthand executive officershouldcontacttheStudentProgramsoffice. interests. AnystudentinterestedinbecominganASTCCsenatoror by theASTCCSenateonbasisoftheirqualificationsand become aSenator,encouragingmaximumstudentparticipation. and procedureswhichaffectstudentlife.AnyTCCmay invites directrepresentationofstudentsinestablishingthepolicies decision makingprocessoftheCollege. leadership skillsandprovidesasystemforinvolvingstudentsinthe students. Itoffersavaluableeducationalexperienceindeveloping selecting, developing,andfundingservicesactivitiesfor interest andviewpointsincollegegovernance.Itisameansfor Student Government Tacoma CommunityCollegeclubsandorganizationsfosteran Clubs andorganizationsreflectthemanydiversestudent In additiontothepaid-managerpositions,STAGEstudents The StudentAccesstoGrowthandEarningProgram(STAGE) Executive officers,ratherthanstandingforelection,areselected The TacomaCommunityCollegestudentgovernmentmodel Student governmentprovidesasystemforinputofstudent Athletic Departmentat253.566.5097. Athletic Director. of athletes.Requestsforthisinformationshouldbemadetothe revenue generatedthroughathletics;graduationandtransferrates athletically relatedstudentaid;expensestoathletics; October. Thisreportprovidesasummaryofparticipationrates; Disclosure ActreportasfiledbytheAthleticDepartmenteach use ofOakbrookCountryClubashomecourseforthegolfteams. an all-weather400-metertrack,asoccerfield,tenniscourtsandthe and golf. golf. Varsitysportsforwomenincludevolleyball,basketball,soccer athletic pursuits. athletes transfertouniversitiescontinuetheiracademicand Association ofCommunityColleges(NWAACC).Eachyearmany have astrongrecordincompetitiontheNorthwestAthletic academic andathleticsuccessforitsstudentathletes.TheTitans intercollegiate sports.Theathleticprogramemphasizesboth Athletics experience innewspaperpublication. about activitiesoncampusandletsstudentsgainhands-on students duringtheregularschoolyear.Ithelpsinform newspaper. TheChallengeispublishedbi-monthlybyandfor editing andpublishingareavailablewiththeTCCstudent Student Newspaper from theStudentProgramsoffice, Bldg. 11,orcall253.566.5118. as bowling.Moreinformationonintramural sportsmaybeobtained volleyball, flagfootball,foosballand pingpongtournaments,aswell according tostudentinterest.Activities includebasketball, Intramural Activities For informationonathleticscholarshipopportunities,callthe Students mayrequestacopyoftheEquityinAthletics To beeligibleforathleticcompetition,astudentmust: Athletic facilitiesincludetheTCCgym,MinnittiBaseballField, Men’s varsitysportsincludesoccer,basketball,baseballand Both maleandfemaleathletesparticipateinTCC’seight Opportunities todevelopskillsinjournalism,professionalwriting, A widevarietyofintramuralactivitiesareplannedeachyear HaveanoverallG.P.A.ofatleast2.0. > Havecompleted36credit hoursfromtheirfirstquarterof > To competeinasecondseasonofanysport,studentmust: Mustpass12credithours toremaineligibleinsportswhich > Mustbeenrolledinatleast12credithoursduringthe > Havepassed12credithourstheirpreviousquarterof > participation. overlap intoasecondquarter. quarter ofparticipation. attendance atanypost-secondaryinstitution. Instructional Programs 21 Tacoma Community College offers a selection of courses of study designed to meet your educational Tacoma Community College offers a selection goals. If you choose to conclude your education with an associate’s degree, you’ll find that the course of goals. If you choose to conclude your education with an associate’s degree, you’ll find that in your study provides you with the training base you need to help you succeed in the workplace and and personal life. The College offers individual classes and complete programs in university-level education, professional/technical education. In addition, TCC offers quality programs in developmental and a variety of special continuing education programs. Clockwise from top: Radiologic Sciences students compare notes, students conduct experiments in chemistry lab, Running Start student Leah Morgan challenges herself with advanced art classes at TCC, Engineering student Chris Corkum rides the award winning human powered paper vehicle, and Human Services student Kiara Alexander reviews a case history file. 22 Instructional Programs associate degree: training foratTCCwhilecompletingrequirementsatwo-year University Programs the individualstudent. meeting allacademicandgraduationrequirementsrestswithyou; advisors andcounselors;however,thefinalresponsibilityfor required curriculaforgraduationthroughitsdedicatedstaffof department requirements. institution towhichtheyplantransferforthespecificmajor Students areadvisedtoconsultthecurrentcatalogoffour-year leading tothebachelor’sdegreeatafour-yearcollegeoruniversity. and sophomore-levelcourseworkinawidevarietyofdisciplines transfer opportunity. year institutionsinWashington,TCCoffersanexcellent,affordable which managestransferarticulationbetweenthetwo-andfour- member oftheInterCollegeRelationsCouncil(ICRC),acouncil through TCC’scomprehensiveuniversityparallelprograms.Asa work isrequiredcancompletethefirsttwoyearsofcourse Education (Transfer) University-Level Below aresomeoftheuniversitylevelareasyoumaybegin The Collegeprovidesassistanceindeterminingcompletionofthe Tacoma CommunityCollegeprovidesthemajorityoffreshman Students interestedinpursuingfieldswhereuniversity-level hsclEuainPhysicalTherapy Physical Education Nursing/BSN NaturopathicMedicine Pharmacy Paper Science& Oceanography Pacific RimStudies Molecular Biology Occupational Therapy Medicine Mathematics Law Medicine Music Microbiology History Medical Technology Genetics Liberal Arts EnvironmentalScience Japanese Journalism Engineering International Business Geology Economics Forestry Dentistry English Education Communications Justice Criminal Earth Science Botany Biochemistry Dental Hygiene Computer Science Chemistry Chiropractic American Ethnic&GenderStudies Business Administration Biology Art Anthropology Accounting niern Philosophy Engineering Architecture TESC-T at253.680.3000orTCC’sBridgeProgram. and veteransbenefitstothisprogram.Formoreinformation,call South SixthAvenue.Studentsmayapplytheirfinancialaidawards requirements designedforanOptionBassociate’sdegree. Olympia campuses.Studentsenteringtheprogramcanfulfill courses (IDS)applyonlytotheEvergreenStateCollege-Tacoma/ who havelessthan90credits.CreditsearnedinInterdisciplinary based onaninterdisciplinarycurriculum.Itisintendedforstudents years ofthefour-yeardegreeprogramatTESC-Tacoma,andis State College. adults interestedinpursuingabachelor’sdegreeatTheEvergreen offer theBridgeProgram,acourseofstudydesignedespeciallyfor State College-Tacoma Bridge ProgramatTheEvergreen and work-studypositions areavailableforqualifiedstudents. in basicskillsaswellcustomized jobtraining.Financialsupport prepare themtoentertheworkforce inwageprogressionpositions. receive assessmentandcareerplanning priortobeginningtraining Assistance forNeedyFamily(TANF) recipients.Eligiblestudentswill WorkFirst Program professional/technical certificateanddegreeprograms. strategies; highschoolcompletion;andenrollmentinTCC’s clarification; traininginlifeskills,studyandjobsearch employment. TheFreshStartProgramoffersassistancewithgoal and wanttoresumetheireducationinorderpreparefor the agesof16and21yearswhohavedroppedouthighschool Fresh Start the TCCRunningStartProgram. interested studentsshouldcontacttheirhighschoolcounseloror must havecollege-levelreadingandEnglishskills.Toapply, high schoolgraduationandsatisfycollegerequirements.Students no cost.ThecreditsearnedthroughRunningStartapplytoward eligible highschooljuniorsandseniorsmayenrollinTCCcoursesat system andpublicschooldistrictsinWashington,throughwhich Running Start The BridgeProgramistaughtattheTESC-Tacomacampus,1210 This eveningdegreeprogramisintendedtoprovidethefirsttwo TCC andtheEvergreenStateCollege-Tacoma(TESC-T)jointly WorkFirst offersscreeningforlearning disabilities,andtraining The WorkFirstProgramserveslowincomeandTemporary Fresh Startisatuition-freeprogramforyoungadultsbetween Running Startisapartnershipbetweenthecommunitycollege idieBooyZoology Speech Veterinary Medicine SocialWork Wildlife Biology PoliticalScience Urban Planning Spanish Sociology Public Administration Physics ...... Psychology 253.680.3022 253.566.5086 253.565.9610 253.566.6061 Instructional Programs 23 253.566.5188 253.566.5144 ...... The objective of the ABE-ESL program is to provide non- The objective of the ABE-ESL program is to Before entering the program students must take the required The Adult Basic Education program at TCC offers instruction for General Office Assistant General Specialist Computer User Office Professional Receptionist/Clerk Word Processing Justice Administration of Law & Human Services Human Services Case Aide Emphasis Paraeducator, Early Childhood Paralegal Reserve Police Officer insurance in Washington If you have collected unemployment Adult Basic Education- English as a Second Language an opportunity native speaking immigrants and refugees with pronun- to develop English literacy skills in conversation, computer literacy. ciation, reading, writing, grammar and basic on survival The ABE-ESL program has a strong emphasis workers, and English related to participants’ roles as parents, members of the community. placement test. All courses are designed so that a student may begin at his or her current level. The rate of advancement is determined by each individual student’s particpation and progress each quarter. Call 253.566.5144 for placement testing schedule. Adult Basic Education adults wishing to improve basic reading, writing, math, and English- as-a-Second Language skills. These classes are designed for adults 18 years of age or older. All classes are free and offered at the main TCC campus (Adult Learning Center), Madison School, Sacred Heart Church, James Center (Workfirst), Pierce County Jail and other community sites. For more information about placement testing, class location and registration, please call the Adult Learning Center at 253.566.5144. Office Careers: Office Public Service Careers: Program Worker Retraining homemaker, or State within the last 24 months, are a displaced for TCC’s Worker have been self-employed, you may be eligible career fields Retraining Program! Train in one of many challenging listed above. offered in the professional/technical programs who qualify. For Financial assistance may be available for those Retraining Program more information, please contact the Worker at 253.566.5188. A+ Certification Computer Application Developer Electronics/Wireless Engineering and Security MCSE Certification Network Administrator Network Hardware Support Web Developer Web Graphics Computed Tomography Diagnositic Medical Sonography Emergency Medical & Health Services Emergency Medical Technician (EMT) Health Information Technology Health Information Coding Magnetic Resonance Imaging Medical Billing Specialist Medical Secretary Medical Transcriptionist Nursing, Associate Degree Paramedic Pharmacy Technician Radiologic Technologist Respiratory Therapy Automated Accounting Applications Accounting Office Associate Assistant Bookkeeping Clerk Bookkeeping Systems Business Administration and Management Business Management and Organizational Leadership Entrepreneurs Succeed Program (ESP) Global Business Museum/Gallery Operations Besides admission to Tacoma Community College, each Besides admission to Tacoma Career programs at TCC lead to two-year associate’s degrees or associate’s degrees at TCC lead to two-year Career programs Tacoma Community College offers more than 44 career training College offers Tacoma Community Information Technology Careers: Health Careers: Business Careers: professional/technical program may have specific application and professional/technical program students should contact the admission procedures. Interested or division office for details. For individual program coordinator and names of program coordinators, see programs of study outlines programs section of this catalog. TCC can the professional/technical retraining in the following areas: provide career training or shorter-term program certificates. Many of the programs and program certificates. Many shorter-term career advancement, updating skills or courses are available for retraining opportunities. programs designed to prepare you to enter the workforce. to prepare you to programs designed Professional/Technical Education 24 Instructional Programs testing feefortakingthetest. For GEDtesting,call253.566.5093(AssessmentCenter).Thereisa skills andjobreadinessskills.Call253.566.5144forGEDclasses. reading, writing,math,basiccomputerliteracy,lifeskills,parenting Basic Educationoffersafulldayandeveningprogramofclassesin school completionprogram,jobtrainingorcollegeprogram.Adult complete aGED(GeneralEducationDevelopment),orenterthehigh student’s skillleveluptoGrade9orabovesothatheshemay GED PreparationClasses or call253.566.5144. Learning Centeronemonthpriortothestartofquarter. into thisspecialprogrammustbecompletedthroughtheAdult grade on)willberequiredforevaluation.Applicationandacceptance level andabove)maybetakenappliedtodegreerequirement. determined byplacementtesting,thencollegelevelcourses(100 student hascollegelevelreadingandwritingskills,whichare state. Inaddition,awidevarietyofelectivesareavailable.If students areresponsibleforfeesandbooks. of Washington.Non-residentstudentsmustpayfulltuition.All tuition, astudentmustbe19yearsoldandresidentofthestate must havegraduated;howeverinordertoqualifyforreduced Program candidatesmustbeatleast18yearsofageandtheirclass who wanttoearnaWashingtonState(TCC)highschooldiploma...... High SchoolCompletion simultaneously. school creditandcollege that allowsstudentstoearnhigh quarter inthedualcreditprogram 700 areahighschoolstudentsevery districts, TCCservesapproximately Careers Consortiumandlocalschool In partnershipwithPierceCounty Did YouKnow? The objectiveoftheAdultBasicEducationclassesistobring For moreinformation,contacttheAdultLearningCenter,Bldg.7 All highschool,collegeandotherofficialtranscripts(fromninth Courses offeredincludethoserequiredforadiplomabythe The HighSchoolCompletionprogramisdesignedforstudents ...... 253.566.5144 253.566.5144 skills tomeetstaterequirements. changes intoday’smedicalandcounselingfieldsbuildnew packages forgroups. seminars andconferences,aswellcustom-designededucational licensing. Thisnon-degreeprogramoffersclasses,workshops, educational classesforhealthprofessionalcertificationand program whichprovideshighquality,reasonably-priced and HumanServicesProfessionalContinuingEducation(HPCE) Center, 1501PacificAve.,Room126. Continuing ProfessionalEducationislocatedattheDowntown formats, orduringregularquarter-lengthscheduling.TheOfficeof licensing. Specialcoursesareofferedinworkshopandseminar education units(C.E.U.)necessaryforspecificcertificationor skills; orobtaincollegecredits,clockhours,continuing organizations andassociationstorefreshupgradeexisting Industry andHomeInspection. Public Accounting,HealthCare,PayrollProfessional,Building Therapy, RealEstate,MortgageLendingPractices,Certified needs ofprofessionalsinmanyfieldsincludingFlagging,Massage variety ofcoursesmeetingtheongoingnon-degreeeducational Continuing ProfessionalEducation skills andabilities. assists withpreparingemployeesinlearninganddevelopingnew business/industry. Providingprofessionaldevelopmenttraining hiring andretentionofemployeesarecriticalconcernsfor providing performance-basedservicestoitscustomers.Effective industry community.Itisdedicatedtotheconceptandpracticeof the specialneedsofTacoma-PierceCounty’sbusinessand Professional Development The CenterforBusinessand Continuing Education training needsof employees andmanagers. special requirementsfortimeand content, TCCcanmeetthe and workshopstoon-sitetraining programs customizedtofit industry trainingandretrainingneeds. Fromnon-degreeseminars and ProfessionalDevelopmentstrives tomeetlocalbusinessand Downtown BusinessTraining Peninsula Center. Certification CenterattheTacomaMallandGigHarbor technology classesareofferedattheInformationTechnology the TacomaMall Computer Training/ITCertification ITCC at Small BusinessDevelopmentCenter Gig HarborPeninsulaCenter The programseekstohelpprofessionalsanticipatethe Continuing ProfessionalEducationalsohasasignificantHealth Courses canbedevelopedincooperationwithprofessional The OfficeofContinuingProfessionalEducationoffersa The CenterforBusinessandProfessionalDevelopmentserves Tacoma CommunityCollege’sDowntown CenterforBusiness Non-credit andcreditoptioncomputerinformation ...... 253.272.8996 253.396.9128 253.475.2426 253.396.9128 253.851.2424 Instructional Programs 25 253.566.5020 ...... and at home > Satisfy your intellectual curiosity > on the job Acquire new skills to enhance your proficiency > venues and experiences Explore new >unlocking hidden potential Add dimension to your life by > backgrounds Meet interesting people from various Tacoma Community College offers a wide range of learning Tacoma Community College offers a wide range Coordinated Studies brings together two or more academic Students transferring to The Evergreen State College or Committed to fostering lifelong learning, Tacoma Community fostering lifelong learning, Committed to are offered on and off campus each A wide variety of classes business and Program areas include: fine and performing arts, financed All non-credit classes are self-supporting, and Choices in Learning Formats These options opportunities to meet different students’ needs. cover the same material as courses taught traditionally. Coordinated Studies/Learning Communities disciplines into a cooperative teaching and learning environment. Coordinated Studies is an umbrella for several approaches to linking courses and course work together around a common theme that allows students and teachers to experience greater depths of teaching and co-learning in an active manner. University of Washington-Tacoma are advised to take at least one learning community (coordinated studies or linked course) as part of their degree. Students are advised to take at least one learning community (coordinated studies or linked course) and a writing intensive course (other than composition) as part of their degree electives. Coordinated Studies and linked classes are regularly offered. See quarterly schedules. Center for Personal Enrichment Personal for Center Enrichment for Personal Center of comprehensive curriculum a diverse, dynamic and College offers special events that workshops, and non-credit classes, the Discover how quickly many areas of interest. encompasses can add up as you: your education benefits of continuing courses are flexible and ever-changing to quarter. The non-credit civic, economic and career related accommodate the cultural, offered weekdays, educational needs of the community. Courses are evenings and Saturdays. language, personal skills, language and cultural studies, sign and wellness, international studies, photography, recreation The Center for physical fitness, and personal skills and enrichment. The Kids on Creative Retirement offers classes for older adults. Campus program features classes just for kids. in the courses. completely with fees paid by students participating These courses are not supported by state tax funds. 253.566.5374 253.566.5010 ...... This program is designed to train participants to be Job skill assessment/task analysis, performance consulting, Job skill assessment/task analysis, performance The Center for Business and Professional Development, acting The Center for Business and Professional Development, Through an agreement with the U.S. Small Business Through an agreement Acting as a continuous resource and training partner, continuous resource Acting as a Seminar and training leaders are top professionals in their are top professionals leaders and training Seminar successfully employed in a variety of educational settings. Enrollment is open to currently employed paraeducators and individuals who wish to prepare for employment in the field. Students may earn a Certificate or a two-year Associate in Applied Sciences degree. Core classes are offered in the evenings. ParaEducator, Early Childhood Emphasis ParaEducator organizational development, strategic planning and many other organizational development, strategic planning services are also offered on a contract basis. as a training partner, provides customized non-degree education as a training partner, provides customized non-degree meet a company’s and training services designed specifically to have been needs and future goals. A variety of workshops Resolution, developed including but not limited to: Conflict Team Management/Supervision, Communication Skills/Coaching, Sexual Building, Customer Service/Customer Relations, Preventing Harassment Training, Diversity Training, Wellness, occupational- Violence in the Workplace, Managing Change, seminars and specific Spanish, computer workshops, online and STARS workshops as well as first aid, CPR, flagger training childcare provider training. Contract/Customized Training Contract/Customized Training Administration and Washington State University, Tacoma Administration and Washington operates a Small Business Community College Downtown on site. The Center’s focus is Development Center (SBDC) non-degree education programs to on the development of business and pre-business owners meet the needs of small are selected from the business and operators. Instructors practical application of business community to ensure environment. principles in a small business TCC Down-town provides training that gives local business provides training TCC Down-town and industry an edge. fields, specializing in upbeat, practical instruction. Workshops instruction. practical in upbeat, specializing fields, and offer a relaxed are held at TCC Downtown and seminars the completely away from and a chance to get atmosphere work setting. 26 Instructional Programs TCC faculty: time ofpublicationthefollowingFullOnlinecoursesareofferedby using email,discussionboardpostingsandchatrooms.Atthe students mayinteractwiththeirinstructorsandother courses allofinstructiontakesplaceinavirtualclassroomwhere instructional contentavailablethroughtheInternet.InFullOnline by TCCfacultyandatotherstatecolleges: State CommunityandTechnicalCollegesystem,whicharetaught Washington Online(WAOL),acooperativeeffortbythe courses arealsooffered. independent onlinecoursesandtelecourses.Non-credit courses includefullonlinecourses,hybrid distance learningatTacomaCommunityCollege.Distance Arts degreeandtakesomeprofessional/technicalcoursesthrough Distance Learning In addition,TCCoffersfullonlinecoursesdevelopedthrough ONLINE Students canearncollegecredits,completetheirAssociatein OS 3 PoliticsandFilm AmericanNationalGovernment&Politics IntroductiontoInformationTechnology POLSC 231 ExcelII POLSC 202 ExcelI IT 235 CU 203 Design 2-Dimensional CU 103 PrinciplesofPhysicalAnthropology ART 102 ANTHR 201 SPCH 101 Public Speaking Public Problems Social SPCH 101 SurveyofSociology SOC 270 DevelopmentalPsychology:Lifespan SOC 110 Psychology General Contemporary Health&Wellness PSYCH 206 PSYCH 100 Appreciation Music PE 191 MathforNon-ScienceMajors Learningforthe21stCentury MUS 107 AdvancedMedicalTerminology MATH 117 ComprehensiveMedicalTerminology LS 105 HT 138 Diversity Understanding HT 137 Technical&ReportWriting HSP 261 Composition ENGR 231 ChildCareProviderTraining ENGL 101 Appreciationofthe VisualArts EDP 103 IntroductiontoAnthropology ART 100 ANTHR 100 coursesareclassesthathaveallorsomeofthe quarter non-refundableaccountfee charged. All oftheFullOnlineandHybridcourseshaveaonetimeper assessment tohelpdecidewhetheronlinelearningisrightforyou. requirements, answerstofrequentlyaskedquestions,andaself distancelearning/ providesanupdatedcourselist,computer courses areofferedbyTCCfaculty: online. AtthetimeofpublicationfollowingHybridOnline reduced numberofon-campusclassmeetingsaswellwork traditional classroominstruction.Studentsarerequiredtoattenda The TCCwebsitehttp://www.tacoma.ctc.edu/inst_dept/ HYBRID ONLINE SPCH 130 Interpersonal Communication Interpersonal Speaking Public SPCH 130 FundamentalsofSpeechCommunication SPCH 101 CollegeTextbookMastery A&P Cardiopulmonary SPCH 100 READ 093 Relations International RC 160 AmericanNationalGovernment&Politics POLSC 203 IntroductiontoGovernment&Politics Fitness Total POLSC 202 POLSC 101 PE 100 CaringforClientwith NURS 212 CaringforClientwith NursingFocusIII:PharmacologyII NURS 211 Pre-CalculusI:CollegeAlgebra ResearchMethods:PacificRim NURS 143 Coding CPT MATH 115 MedicalTranscriptionManagementSeminar LS 102 HT 216 AmericanLiterature:1910-1960 HT 143 AmericanLiterature:1860-1910 ENGL 269 ArgumentandPersuasion ENGL 268 Composition ENGL 103 Composition ENGL 102 IntroductiontoChemistry ENGL 101 Analysis Statistical CHEM 100 Crime&JusticeinAmerica BUS 256 IntroductiontoCivilLaw ADJ 205 FundamentalsofParalegalism ADJ 152 Law Criminal ADJ 150 AccountingPrinciples:Managerial ADJ 101 ACCNT 230 coursescombineonlinelearningwith Acute Problems-Clinical Acute Problems-Theory Instructional Programs 27 Accounting I DTC/GHC Accounting II DTC/GHC Accounting DTC/GHC World Wide Web GHC Accuracy DevelopmentManagement DTC/GHC DTC ART 199ART Gallery Viewing Lab ACCNT 140ACCNT 141 Practical ACCNT 142 Practical Practical Managerial BUS 110CU 091 Business MathCU 092100CU Keyboarding Basics 10-Key BasicsCU 102 Introduction to Windows & DTC/GHC CU 103 DTC/GHC CU 104 Word I105CU DTC/GHC Excel I110CU Power PointCU 130 Word I, Excel I, Power PointCU 202 DTC/GHC Introduction to AccessCU 203 Quick Books DTC/GHC CU 210 Word II GHC DTC/GHC DTC/GHC OFFCE 103 Excel IIOFFCE 106 Access II Typing I DTC/GHC Typing-Speed and 116OFFCE Records and Database GHC GHC GHC DTC/GHC Some courses are offered in an independent learning/tutorial an independent offered in courses are Some its own new building on the main campus The Gallery at TCC has (DTC) and Business Labs are located at the Downtown Center Learning Labs Learning set their own schedules environment where students assistance The lab format is a required orientation. after attending flexibility and are comfortable students who desire designed for and self-discipline required. self-motivation with the additional skills as and study excellent time management Success requires self-motivation. Consistent attendance well as organization and is necessary. Art Gallery the following self-paced course is across from Bldg. 5. Currently visit this and other galleries and offered in which students and attend lectures: museums, view videos, Business Labs 253.396.9128 to Gig Harbor Center (GHC). Students need to call Lab course at schedule an orientation before beginning a Business orientation times the Downtown Center. At the Gig Harbor Center should be are listed in the quarterly class schedule. Books following courses are purchased at one of the centers. Currently the offered at the Business Labs: courses students learn on their own learn on their students courses Windows and WWWcredit 1 weeks 2 are classes with the main instructional content are classes with the main INDEPENDENT ONLINE INDEPENDENT CU 100 Introduction to CU 102CU 103CU CU 104 Word Excel Power Point 2 credits 4 weeks 1 credit 2 credits 2 weeks 4 weeks ENGL 091093READ Composition 110STDSK College Textbook Mastery College Study Skills CU 100CU CU 102CU 103 & World Wide Web Introduction to Windows CU 104 Word I 110CU Excel I Power Point Introduction to Access OCEAN 101SPAN 101 SURVEY OF OCEANOGRAPHY SPAN 102 DESTINOS I SPAN 103 DESTINOS II DESTINOS III These classes are offered in short time blocks that start at Jump Start classes are offered during the month of September Jump Start classes are offered during the month In TELECOURSES courses at For more information about distance learning different times throughout the quarter, enabling students to learn a skill early in the quarter, add the class later if the need arises, or create a two or three class sequence, all in one quarter: Computer User Courses before fall quarter begins. They enable students needing a quick before fall quarter begins. They enable students anticipated fall refresher to meet prerequisite requirements for to meet the demands courses. Students must be seriously motivated to cover these of the intensive in-class time and homework required 5 credit courses in three weeks: Condensed Format Jump Start TCC, contact Andy Duckworth, telephone 253.460.3958 or TCC, contact Andy Duckworth, telephone 253.460.3958 email: [email protected]. using web-based instructional materials after attending a required attending materials after web-based instructional using of publication the following campus. At the time orientation on Online courses are offered: Independent or videotape. Telecourses are broadcast on available over television TV guide. Cost for each course includes CollegeVision. Check your a telecourse fee. tuition, facility fee, plus 28 Instructional Programs Currently thefollowingcoursesareoffered: Writing Center Currently thefollowingcoursesareoffered: Reading Lab Currently thefollowingcoursesareoffered: Math Lab Currently thefollowingcoursesareoffered: Health TechnologyLab The WritingCenterislocatedinBldg.7onthemaincampus. The ReadingLabislocatedinBldg.7onthemaincampus. The MathLabislocatedinBldg.7onthemaincampus. The HealthTechnologyLabislocatedattheGigHarborCenter. NL15WritingCenterTutorPracticumIII WritingCenterTutor PracticumII ENGL 145 WritingCenterTutorPracticumI ENGL 141 Writing CenterTutorials ENGL 140 Writing Paragraph ENGL 96 Review Spelling ENGL 85 Review Punctuation ENGL 84 SentenceStructureReview ENGL 82 Review Grammar ENGL 81 ENGL 80 TestTakingStrategies Management Time STDSK 82 LibraryOrientationWorkshop STDSK 81 Lab Reading STDSK 80 Circle Literature READ 98 LabTutorI READ 95 VocabularyTextbookComprehension READ 89 VocabularyTextbookComprehension READ 82 READ 81 IntermediateAlgebra ElementaryAlgebra Math 99 IntroductiontoElementaryAlgebra Math 90 Review Arithmetic Math 88 Math 86 3 Lab Transcription 2 Lab Transcription HT 162 I Lab Transcription HT 161 III Transcription Medical HT 160 II Transcription Medical HT 142 I Transcription Medical HT 141 II Terminology Medical HT 140 I Terminology Medical HT 131 HT 130 ...... 253.566.5145 main campus,Bldg.18. description sectionofthecatalogandinCounselingCenter, independent studyprojects.Detailsareavailableinthecourse by specialinterest,short-termworkshops,seminarsand decisions, andexploringcollegeresources. selecting acareer,settinggoals,makingcareerandeducational relationships. learn decision-makingskills,andhowtobuildpositive individual potential,improveinterpersonalcommunicationskills, for studentsuccess.Thesecourseshelpstudentsdeveloptheir opportunities providedthroughtraditionalinstructionalprograms Human DevelopmentInstruction Programs Other Educational These coursesareofferedeachquarterandsupplemented Human developmentclassesprovidestudentswithhelpin Human developmentinstructionenhancesandexpandsthe College Policies

We encourage all students to familiarize themselves with the college policies and procedures outlined in the following pages.

29 Credit Hours and Quarters Non-Degree Seeking Student A student attending TCC for purposes other than to obtain a The College measures its course work by credit hour. Courses degree or certificate. Students in this status are restricted to offered each quarter are assigned credit value related to the number registration in 5 credits or less per quarter and are self-advised. of class-hours per week; however some courses require additional laboratory time, and activity courses typically involve additional hours per week. Students should anticipate an additional two hours Transcripts of study time for every hour spent in the classroom when planning A transcript is a complete record of a student’s academic their quarterly course load. achievement at Tacoma Community College. Students may request A student who wishes to enroll for 20 or more credit hours must an official transcript by mail or at the Registration and Records have the permission of the Associate Dean for Student Services and Center in Bldg. 18. Registration or designee. Unofficial transcripts for advising are available on the Web, at The academic year at Tacoma Community College is divided into the Registration and Records Center, and at Student Self-Service four quarters. See academic calendar, inside front cover, for specific Centers located in Bldg. 18. quarter start and end dates. All outstanding fees and/or fines must be paid before transcripts will be released. Picture ID is required to order transcripts for Instructional and mailing or to pick-up transcripts. Transcripts will not be released to a third-party without written permission of the student. Calendar Days For transcript fees and further information about how to request The terms instructional and calendar days are used in various a transcript by mail call 253.566.5035. policies. Instructional days are those days starting with the first day of the quarter in which the campus is open and counting each Transcripts From Other Schools Tacoma Community College does not release or certify day classes are held through the last class day of the quarter. copies of transcripts from other institutions. Transcripts Weekends and holidays when classes are not in session are not reflecting a student’s previous secondary and college included in the calculation of deadlines based on instructional days. education which have been submitted to Tacoma Community Some deadline dates are based upon calendar days, for example, College are part of the official file and will not be returned to the last day to drop a class with a grade of “W” is the 50th the student. Students desiring transcripts of work completed calendar day of the quarter. These deadline calculations include elsewhere must order transcripts directly from the institution weekends and holidays. College Policies where the work was completed. Official transcripts from other schools and colleges must be Student Status received by the Registration and Records Center from the sending Full-time Student institution in a sealed unopened envelope. For more information about transfer credit see “Credits Transferred to TCC.” Tacoma Community College’s degree programs are structured with the expectation that students average 15 college-level credits each quarter, if they intend to complete an associate’s degree in Prior Learning two years. The College considers a student full-time if they are Assessment enrolled in 12 or more credits. Tacoma Community College serves a diverse community of Part-time Student learners, many of whom have acquired a wealth of previous learning A student registered for less than 12 credits. through life experiences including work, training, and independent study. These adults come to the college ready to demonstrate what First-year Student they already know and can do. A student who has earned fewer than 45 college-level credits. Opportunities for Prior Learning Assessment (PLA) vary from program to program and are subject to faculty review. For a current Second-year Student list of programs offering PLA, contact the Assessment office in A student who has earned 45 or more college-level credits. Bldg. 18, or call 253.566.5048. Auditing Student Nationally Recognized Exams A student who registers for a class for no credit and pays the Advanced Placement ...... 253.566.5048 standard tuition and fees for the class (see Course Audit for Tacoma Community College grants credits to entering first-year additional information). students who have earned scores of three (3) or higher on the Educational Testing Service’s (ETS) Advanced Placement Tests.

30 Students who wish to receive advanced placement credits must Articulation Agreements send their ETS test score to the chairperson of the appropriate Tech-Prep/Dual Credit Agreement department. After receiving the student’s test score, the TCC and the Pierce County Careers Consortium have developed department chairperson will notify the Records office, in writing, of an agreement to award college credit to students who successfully the number of credits granted. The number of credits will be noted complete college-level courses. The dual credit agreements are on the student’s transcript, and a grade of “S” recorded for all entered into when common objectives and competencies exist courses where credit is granted. between the college and local school districts. With a review of the Advanced placement credits will fulfill either distributive or course objectives and competencies, students who have passed all elective requirements for an associate degree. Four departments of college competencies are eligible and will be allowed to enroll in the College currently grant advanced placement credits: college-level courses based upon existing specific dual credit English - A student scoring a 3 on the composition and literature agreements between college and high school programs. Students examination will receive credit for English 101. A student must complete dual credit classes with a grade of ‘B’ or higher. scoring 4 will receive credit for English 101 and English 102. They must identify the college at which they intend to register. A student scoring 5 will receive credit for English 101, 102 Interested students should contact their high school instructor for and 258. details regarding enrollment in the program. Mathematics - A student scoring 3 on the calculus AB or BC examination will receive 5 credits for Math 124. A student College in the High School Program scoring 4 or 5 may receive additional credit upon TCC develops articulation agreements with local school districts College Policies consultation with the mathematics department. that permit students enrolled in approved courses to earn college credit for work completed at the high school. Interested students History - A student scoring 3 or higher on either the American or should contact the high school instructor for registration and fee European History examination will receive 5 credits in the information. Registrations must be completed by the first week of area of specialization. the quarter in which credit will be awarded. Biology - A student scoring 3 on the Biology examination will receive 5 credits for Biology 100. A student scoring 4 or 5 Servicemen’s Opportunity may receive additional credit upon consultation with the College (SOC)...... 253.566.5048 biology department. Tacoma Community College has been officially designated as a Advanced placement credits may be granted in other subjects participant in the Service members Opportunity College (SOC) by the upon consultation with appropriate department heads. Contact the Department of Defense, in cooperation with the American Credential Evaluator, Registration and Records Center in Bldg. 18. Association of Community Colleges. The SOC, as implemented at Tacoma Community College, seeks to increase access to higher International Baccalaureate...... 253.566.5048 education for active and retired military personnel: International Baccalaureate (IB) - A student who has tested in IB > by accepting a maximum of forty-five (45) quarter hour may request college credit for IB Higher-level work. TCC will credits from military service schools; evaluate each student’s record individually, on a departmental basis, > by granting fifteen (15) quarter hour military science credits for credit and advanced placement. Contact the Credential to enlisted service members who have completed at least Evaluator, Registration and Records Center in Bldg. 18. one (1) year of active military service; and CLEP/DANTES ...... 253.566.5048 > by granting thirty (30) quarter hour military science credits Tacoma Community College grants up to 30 credits towards the to commissioned officers who have completed at least one Associate in General Studies degree to students for scoring in the (1) year of active military service. 50th percentile or above on the CLEP General Examination. Credit The College will evaluate these credits and apply them toward may be granted for other degrees and for CLEP Subject Examination the requirements and/or electives which lead toward an Associate in if approved by the division or department chairperson. For further General Studies degree. details, students should contact the Credential Evaluator, Eligible military personnel may be awarded the AGS degree by Registration and Records Center in Bldg. 18. earning the balance of the total distribution requirements. Active and retired military personnel may obtain additional information Regents Exam ...... 253.566.5048 about SOC by contacting the Credential Evaluator, Registration and Credit options currently under departmental review. For detailed Records Center in Bldg. 18. information contact the Credential Evaluator, Registration and Records Center in Bldg. 18.

31 Other Options Grades and Academic Departmental Challenge Exam ...... 253.566.5048 Policies A student enrolled for five (5) or more credit hours may earn additional credits in some courses by a challenge examination, Grading Policies provided the department has developed an examination for the Tacoma Community College uses the following system of course to be challenged. All arrangements, including the payment grading and grade point values for reporting and recording academic of fees, must be completed within the first ten (10) instructional achievement. Faculty may or may not choose to use the plus-minus days of a quarter. grading option in a given class. Students who successfully challenge a course will receive an Grade Description Grade Points “S” grade. Course Challenge application forms are available in A ...... Honor ...... 4.0 the Registration and Records Center. Contact the Credential A- ...... 3.7 Evaluator, Registration and Records Center in Bldg. 18. B+ ...... 3.3 B ...... Good ...... 3.0 Portfolio B- ...... 2.7 Portfolio assessment options may be available in some C+ ...... 2.3 departments. These options will vary as each department identifies C ...... Average ...... 2.0 forms of assessment that demonstrate relevant skills and abilities C- ...... 1.7 appropriate for a given program. D+ ...... 1.3 PLA Procedures D ...... Minimum ...... 1.0 PLA credits will be noted on the TCC transcript as the equivalent D- ...... 0.7 TCC course. Credit will not generally be awarded if TCC does not E ...... Failure to complete minimum requirement ...... 0.0 offer an equivalent course. However, if the PLA experience can be W ...... Official withdrawal from course ...... 0.0 shown to have direct application to a student’s technical program Instructor’s signature indicates acknowledgement of the withdrawal. the credit may be posted as elective credit. Instructor permission is not required during this period. (11th through 50th calendar day)* If PLA credit is based on an articulated agreement, a letter grade WI ...... Instructor approved withdrawal ...... 0.0 will be assigned in accordance with the agreement. Other forms of (after 50th calendar day)* PLA credit will be posted with a grade of ‘S’ for satisfactory pass. College Policies V ...... Unofficial withdrawal ...... 0.0 In some cases a student may be granted a waiver of a (did not attend or no data for evaluation) prerequisite, but not credit for prior learning. In this event a notation I ...... Incomplete ...... 0.0 will be made to the TCC transfer-in registration screen that the Granted at the discretion of the instructor, when the student has satisfactory student has satisfied the prerequisite, but no credit will be posted attendance through the 50th calendar day of the quarter. Contract required. to the transcript. S ...... Satisfactory (credit only, no grade point) ...... 0.0 A student must be currently enrolled before prior learning U ...... Unsatisfactory (no credit, no grade point) ...... 0.0 assessment will be undertaken. Credits for PLA will be posted at N ...... Audit ...... 0.0 the end of the quarter in which the PLA requirement is satisfied at R ...... Repeat R beside lowest grade ...... 0.0 the time a transcript is created. PLA credits are not considered enrolled credits and will not be counted in calculating the student’s Grades A, B, C, D and S are considered passing. “S” and “U” enrollment status or calculating financial aid awards. identify courses taken on pass/fail basis and are not counted in computing grade point averages. “S” is given only if the student performed at a grade of “C-” or higher. * Summer quarter courses and courses which do not follow the regular college calendar will have pro-rated withdrawal periods. Contact Registration and Records for these dates.

Grade Grievance Students who believe they have received a final grade that has been awarded improperly or in an arbitrary or capricious manner may grieve or appeal the grade by referring to the “Student Grievance Procedure for Final Course Grades” process. Copies of this policy are available in the Vice President for Instruction and Student Affairs office and the Student Services Administrative office.

32 Incomplete Grade Course Audit The “I” grade is given at the discretion of the instructor when the The course audit option allows a student to participate in a student has completed a sufficient amount of course work but cannot course without having credit or a grade posted to his or her complete course requirements during the quarter due to circumstances transcript. The student must pay regular tuition and fees. Each beyond his or her control. faculty member will decide what participation entails and what The student and instructor must fill out a contract form which attendance requirements must be met for the course. An “N” will contains the specific requirements to be completed, the time allowed be posted on the student’s transcript indicating the course was for completion, and the grade to be assigned if the contract is not audited. If attendance or other requirements are not met, a “W” completed. One copy of the contract will be retained by the instructor, will be posted indicating withdrawal from the course. one given to the student, and one given to the department or division Students may not convert from audit to credit or from credit to chairman. audit after the 30th calendar day of the quarter. To select audit An incomplete grade remains permanently on a student’s transcript status complete an Add/Drop form indicating audit at the if the course work is not made up within one year. Registration and Records Center in Bldg. 18. Failure of students receiving federal financial aid to make up an incomplete grade within a designated time may result in partial loss or Change of Grade termination of benefits. These students should contact the Financial A student requesting a grade change for a course must contact Aid office. the instructor. If the request is approved, the instructor will Veterans are not entitled to benefits for “I”, “W”, “U”, “WI” and/or complete a Grade Change form and forward it to the Registration College Policies “V” grades, unless mitigating circumstances are involved. and Records Center. Grade changes must be made within two quarters (excluding Satisfactory/Unsatisfactory Grade summer) after the quarter in which the student registered for the Some classes, due to their nature and content, are only offered course. No grade changes after two quarters will be allowed, unless “S/U” and will be designated “S/U” based on a departmental deci- it can be documented by the instructor and approved with the sion. In other classes, students have the option for an “S/U” grade. division chair’s signature that the grade was originally an error. The An “S” grade indicates student performance at a grade of “C-” or grade for a specific course may be changed only once. higher. A grade of “U” indicates performance below a “C-.” Neither the “S” or “U” grade is computed in the grade point average. In or- Academic Forgiveness Policy der to exercise the “S/U” option, students: With written approval of an advisor, a student may petition > must choose the “S/U” grade option in writing at the Regis- the Registrar to have Tacoma Community College course work tration and Records Center by the 15th instructional day of set aside. the quarter. > The student must be currently enrolled. > understand that once the choice for the “S/U” grade has been made, it will not be changed to a regular letter grade. > The forgiveness (set aside) date must be at least five years Students should be aware that courses with an “S” grade prior to the current quarter. may not satisfy transfer requirements. At some universities, > All course work taken prior to the forgiveness date will be the “S” grade may not be accepted in courses needed to sat- set aside. The student may not elect to retain individual isfy distribution. Students are urged to check with their ad- courses and set aside other courses. visor and to consult the catalog of their transfer institution. > The Academic Forgiveness option may be exercised Course Repeat only once. A student (except one enrolled in an Allied Health program with Forgiven course work will not be used in the determination of specific course repeat limitations) may repeat a course in which he credits earned at TCC, the cumulative grade point average, or or she has received a grade lower than a “C+”. The course can be the calculation of honors. The course number, title and original repeated no more than two (2) times. grade of all forgiven course work will remain on the transcript. In computing the student’s cumulative grade point average, the Forgiven course work may not be reinstated or used to satisfy higher grade earned for repeated courses will be used if the student submits a Repeated Course form to the Registration and Records prerequisite or degree requirements. Academic forgiveness does Center in Bldg. 18. not apply to the cumulative grade point average used to Students planning to transfer to another college or university calculate financial aid eligibility! should contact that institution to determine how repeat course Students are advised that a decision to set aside course work will be computed in the admission transfer grade point aver- work may or may not be honored by other educational age for applicants into their programs. Some institutions count each institutions, since each institution interprets transcripts time the course is taken in the transfer admission process. according to its own policies.

33 Academic Review Policy and The Associate Vice President of Student Services will notify a Procedures student by mail by the first day of classes of the subsequent Academic review is designed to help students who are having quarter that he or she has been suspended. A student who has academic difficulty improve their academic performance. The already enrolled for classes prior to suspension status being purpose of the policy is to quickly identify students whose grade determined will be administratively withdrawn, and tuition paid will point average falls below 2.00 and provide those students with be refunded. assistance to improve their academic standing. Students will be Following a one-quarter suspension, a student may enroll alerted to their academic problems and provided assistance to following procedures outlined in the College’s “Re-enrollment improve academic performance. The Academic Review Policy Procedures Following Academic Suspension” section (next page). provides for academic suspension in cases where students are A student re-admitted after one quarter of academic suspension unable to achieve satisfactory academic standing. re-enters the College on academic probation. If he or she fails to Individual college programs such as High School Completion, attain a quarterly grade point average of 2.00 or higher at the end certain vocational programs, international students, veterans, and of the first quarter in which he or she is enrolled in 6 or more credits students receiving financial aid may have different and/or additional after the 10th instructional day, the re-admitted student is academic standard requirements and appeal processes. Students in suspended for three (3) consecutive quarters. these programs should contact their program advisor for information Appeal Procedures regarding these requirements. Academic suspension may be appealed to the Associate Vice Academic Deficiency President of Student Services if there are strong and unavoidable A student is placed on academic deficiency at the end of any extenuating circumstances (e.g., a serious illness or accident quarter in which his or her grade point average falls below 2.00, requiring hospitalization). A student will not be suspended during the provided the student is enrolled in 6 or more credits after the 10th course of the appeal process. Any appeal by a student notified of instructional day of that quarter. No later than the second week of academic suspension must meet the following conditions: the subsequent quarter, the Associate Vice President of Student The appeal must be in writing and clearly state factual Services will notify a student by mail that he or she is academically errors or other matters which justify the appeal. deficient. The student will be encouraged to take advantage of The appeal must include: available campus resources to improve his or her academic standing. > Recent academic skills assessment/placement results;

College Policies Academic Probation > A proposed class schedule for the coming quarter and a course list for at least two additional quarters; A student placed on academic deficiency must earn a 2.00 quarterly grade point average the succeeding quarter he or she is > Short-term (one to three quarters) educational goals; enrolled for 6 or more credits after the 10th instructional day of > Plans to improve academic standing. that quarter, or be placed on academic probation. The student must meet with an advisor to review the appeal No later than the second week of the subsequent quarter, the form, including the proposed class schedule, and plans for Associate Vice President of Student Services will notify a student improving academic standing. The advisor must sign the appeal by mail that he or she has been placed on academic probation. The form before the student submits it to the Associate Vice President student is required to meet with his or her advisor and to take steps of Student Services. to immediately improve his or her academic standing. The appeal shall be filed through the office of the Associate Vice President of Student Services. For Fall quarter, the appeal Removal of Academic Probation must be filed no later than one week before the start of classes. A student is removed from academic probation at the end of the For Winter, Spring and Summer quarters, the appeal must be filed quarter in which he or she is enrolled for 6 or more credits after the no later than the 5th instructional day of the quarter for which 10th instructional day of that quarter and earns a quarterly grade the student is suspended. point average of 2.00 or higher. After reviewing the student’s academic records and all information pertinent to the appeal, the Associate Vice President Academic Suspension will take one of the following actions: A student who has been placed on academic probation and fails > Confirm academic suspension; to earn a 2.00 quarterly grade point average or higher the next quarter he or she is enrolled for 6 or more credits after the 10th > Impose conditions instead of suspension; instructional day of that quarter will be suspended for one quarter. > Remove academic suspension; As it applies to the period of academic suspension, Summer quarter > Or request that the student meet with the Associate Vice shall count as part of Fall quarter. President before a final decision on the appeal is made.

34 If a meeting is required, the student will be given notice of the Other College Policies time, date, and place. The meeting will be no later than the 6th Following are several Tacoma Community College policies instructional day of the academic quarter for which the student has regarding student rights, responsibilities, and regulations. These been suspended. The student’s failure to attend the meeting will not policies are in addition to other policies specific to College services preclude the Associate Vice President from making a final decision and programs which are located in other sections of this catalog. regarding the appeal. The student may officially withdraw the appeal, in writing, at AIDS any time. The College is committed to providing a safe and healthy The Associate Vice President shall notify the student of the educational environment and to providing education and information decision no later than the 7th instructional day of the quarter. The about the transmission and prevention of such chronic, decision of the Associate Vice President shall be final. communicable diseases as Acquired Immune Deficiency Syndrome Re-enrollment Procedures Following Academic (AIDS). Consistent with existing law and in the interest of all Suspension concerned, the College takes appropriate measures to ensure a safe environment through educational services. To re-enroll after having been suspended, a student shall present to the Associate Vice President of Student Services, a petition for Buckley Amendment re-enrollment. The petition shall include, but not be limited to, the The Family Educational Rights and Privacy Act requires following: institutions of higher education to establish written policies and College Policies > Recent academic skills assessment/placement results; guidelines governing the review, inspection, release, amendment and > A proposed class schedule for the coming quarter and a maintenance of student educational records. course list for two additional quarters; Tacoma Community College has established policies and > Short-term (one to three quarters) educational goals; guidelines to ensure that the education records of its students are treated responsibly in accordance with the Act and U. S. > Plans to improve academic standing. The student must meet Department of Education regulations. with an advisor to review the petition and to have the TCC directory information is information which can be released advisor sign the petition before it is submitted to the without a student’s permission and it includes student name, Associate Vice President of Student Services. degrees and awards. TCC will also confirm dates of attendance, The petition shall be filed with the Associate Vice President of dates of birth, major field of study, participation in officially Student Services no later than one week before the start of classes recognized sports and activities and the most recent previous for the quarter in which the student is seeking re-admission to the educational institution attended. College. Students should be advised that military recruiters may request After reviewing the student’s academic record and petition, as address and phone listings as well as the above directory well as other pertinent information, the Associate Vice President information without a signed release. shall decide to take one or more of the following actions: A student may request directory information be withheld from > Permit the student to register according to his or her public release by filing an annual request with the Registrar in Bldg. proposed program of studies and class schedule; 18. However, the College may authorize designated persons and > Impose conditions on the student’s enrollment; agencies access to students’ educational records under certain > Require that the student undergo further academic conditions listed in the College policy without the student’s consent. assessment prior to registration; Copies of the College’s student educational records policies and > And/or refer the student for learning assistance and/or procedures may be obtained from the Associate Vice President of counseling during the subsequent quarter. Student Services office in Bldg. 18. Students may file complaints concerning alleged failures by the A student re-enrolling following academic suspension re-enters College to comply with the Act or regulations promulgated there on probation. The academic work of a student who enrolls at under with the United States Department of Education (FERPA), Tacoma Community College following a quarter or more of Office of the Review Board, Washington, D. C. 20202. suspension will be closely monitored. If he or she fails to attain a quarterly grade point average of 2.00 or higher the succeeding quarter he or she is enrolled for 6 or more credits after the 10th instructional day of that quarter, the student re-admitted after > continued, next page suspension will be suspended for three (3) consecutive quarters.

35 Cheating > Associate Vice President for Student Services: Students at Tacoma Community College are expected to be hon- 253.566.5115 est and forthright in their educational endeavors. Cheating, plagia- > Human Resources: 253.566.5356 rism, fabrication or other forms of academic dishonesty corrupt the The College’s policy statement and procedures for filing learning process and threaten the educational environment for all discrimination complaints is available in administrative offices, students. the Associate Vice President of Student Services office, the The consequences of academic dishonesty may vary with the ASTCC President’s office, the Counseling Center, the Library, situation and the individual instructor. All instructors will include in and Human Resources office. the course syllabus a policy on and sanctions for academic dishon- esty. If a student is guilty of or admits to academic dishonesty, an Radiologic Technology Program Pregnancy Policy instructor may impose sanctions up to and including administrative For information on the Radiologic Technology Program withdrawal from the course and/or an “E” grade for the course. Pregnancy Policy contact the Radiologic Sciences Program Chair. It is the official policy of Tacoma Community College that cheat- ing, plagiarism, fabrication, and other forms of academic miscon- Sexual Harassment, Sex Discrimination and duct are grounds for disciplinary action under the Code of Students Discrimination Based Upon Disability Rights and Responsibilities. The student accused of academic dis- It is the policy of Tacoma Community College to provide an honesty may be reported to the Associate Vice President of Student environment in which faculty, staff and students can work and Services for initiation of disciplinary proceedings which could result study free from sexual harassment, sexual intimidation, sexual in disciplinary sanctions ranging from a warning to expulsion from exploitation or discrimination on the basis of disability. the College. The College is committed to protecting the rights and dignity Definitions of academic dishonesty and descriptions of the hear- of each individual in the campus community, and will not tolerate ing and appeal processes are included in the Tacoma Community discrimination of any kind at any level. College Administrative Procedure for Academic Dishonesty, avail- If you feel you are being discriminated against on the basis of able in all administrative offices. Copies of the Code of Student sex or on the basis of disability, you are encouraged to seek help. Rights and Responsibilities are available in the office of the Associ- For more information, please contact one of the following offices: ate Vice President of Student Services in Bldg. 18. > Associate Vice President for Student Services: An Equal Opportunity Employer and Educator 253.566.5115

College Policies The principles of equal employment opportunity, affirmative > Human Resources: 253.566.5356 action and non-discrimination are fundamental to the mission, goals The College’s policy statement on sexual harassment, sex and objectives of Tacoma Community College. The College complies discrimination and discrimination on the basis of disability, and with all applicable federal and state laws designed to promote equal procedures for filing sexual harassment and disability employment opportunity and affirmative action. The College is discrimination complaints is available in administrative offices, working to build a culturally diverse faculty the Associate Vice President of Student Services office, the and staff. ASTCC President’s office, the Counseling Center, the Library, It is the policy of Tacoma Community College, District 22 to and Human Resources office. prohibit discrimination on the basis of and provide equal opportunity and equal access to its programs and services without Student Rights and Responsibilities regard to race, color, religion, national origin, sex, sexual orienta- The College’s Code of Student Rights and Responsibilities is tion, age, marital status, status as a disabled or Vietnam era available in the ASTCC President’s office, the Library, the veteran, or the presence of any sensory, mental, or physical Associate Vice President of Student Services office and the disability. The College will undertake a program of Affirmative Student Services web page. Action as provided for by state and/or federal law. The Student Rights and Responsibilities Code identifies the This policy is applicable to all the college’s educational programs rights that are guaranteed individual students and the and activities; student services and financial aid programs; use of responsibilities of students according to state law and College facilities, purchasing, contracting and facilities’ construction activi- policy. The provisions of the code apply to all students whenever ties, and all areas of employment. they are on campus or engaged in any College-sponsored activity The College is committed to protecting the rights and dignity of or function. The following rights are guaranteed to each student: each individual in the campus community, and will not tolerate dis- > Academic freedom crimination of any kind at any level. > Due process If you feel you are being discriminated against, you are > Distribution and posting of approved materials encouraged to seek help. For more information, please contact one of the following offices: > Opportunity to invite speakers to campus

36 A student who commits any of the following offenses is subject Substance Abuse to disciplinary action: In accordance with provisions of the Drug-Free Schools and Personal offenses (such as assault, disorderly, drunken or Communities Act of 1986 (Public Law 99-570) and its amendments abusive conduct, false complaint or alarm, illegal assembly, of 1989, Tacoma Community College provides substance abuse trespass, sexual harassment, and possession of or use of education, resources, information, and referral focusing on the firearms); prevention and treatment of substance abuse. Property offenses (such as theft, intentional or grossly negligent Information on substance abuse prevention is available in the damage or destruction of College property, and unauthorized Counseling Center, Bldg. 18, 253.566.5122. This information use of College equipment) covers the many health risks associated with the use and abuse of illicit drugs and alcohol, which include liver damage, heart disease, Status offenses (such as cheating, plagiarizing, or tendering; ulcers, brain damage, malnutrition, cancer, and damage to a forgery or alteration; use, possession, selling, or being under developing fetus. These risks may adversely affect the learning the influence of narcotics; being under the influence of environment, work and personal life. alcoholic beverages except wherein official approval has Student use, possession or distribution of alcoholic beverages, been given; use, possession or distribution of alcoholic narcotic drugs, or controlled substances or being under the influence beverages on campus; failure to comply with directions of an of alcohol or illicit drugs on campus or at any college-sponsored authorized College official; smoking in “no smoking” areas; event is prohibited. (Exceptions for use of alcoholic beverages may and unauthorized occupancy of a College facility).

be made with permits and by approval of the College President.) College Policies Requests by students or College employees to initiate Violations of this policy by any student may result in disciplinary disciplinary proceedings should be submitted in writing to the warning, probation, or expulsion. In addition, state and federal laws Associate Vice President of Student Services within 10 instructional make possession or distribution of illicit drugs and alcohol a crime days of the date the petitioner became aware or could have become subject to imprisonment, fine or both. aware of the alleged violation of the code. A student is subject to disciplinary warning, probation, suspension or expulsion for violating any of the above listed Policy Appeals offenses. The Code of Student Rights and Responsibilities identifies The College provides a process for students to appeal operating the due process guaranteed to any student who is charged with policy or procedures. Appeals are typically addressed to the violating provisions of the Code. The Code of Student Rights and manager responsible for administration of the policy or procedure. Responsibilities also identifies the grievance procedures guaranteed Policy and procedure appeals are usually subject to strict time limits to students who believe their rights have been violated. - it is important to act upon a concern as soon as it develops. Some of the rules by which TCC operates are state or federal Student Right to Know law; in most situations, laws may not be appealed. College policies Information published under the Student Right to Know Act is and procedures may be open to appeal. If you have questions about mailed annually to current students and employees. These who to contact regarding your appeal, contact the Associate Vice publications include: President of Student Services office in Bldg. 18. > Campus Safety and Substance Awareness Guide > Student Right to Know Guide New students are provided with this information during the New Student Orientation program. Copies of these publications are also available in the Students Services Administration office in Bldg. 18 and Security office in Bldg. 22. The Equity in Athletics Disclosure Act Report is available in the Athletic Department, Bldg. 9. Did You Know? TCC employed 1,001 full and part-time faculty and staff paying wages of $21.7 million in 2000-2001.

37 38 Degrees and Graduation > > > > > Tacoma CommunityCollegegrantsfivecollegedegrees.Theyare: Associate inGeneral Studies: Associate inTechnicalArts: Associate inAppliedSciences: Associate ofScience: Associate inArtsandSciences: Awarded forcompletion ofatwo-yearacademicprogram designedtomeetaparticular educationalgoal. institution andcompletionofaprogram ofstudiesupontransferringtoTCC. Awarded aftercompletinganapproved occupationalortechnicalprogramatanotherpostsecondary Awarded forcompletionofanapprovedTCCprofessional/technicalprogram. engineering, environmentalscience,orphysics. of universitystudywithaspecializationinbiology,chemistry,computer science,earth Awarded forcompletionofanapprovedsciencetransfercurriculum parallelingthefirsttwoyears optionsavailable,seepages40-43fordescription). (two Awarded forcompletionofatransfercurriculumparallelingthefirst twoyearsofuniversitystudy Degrees and Graduation 39 > continued, next page Bastyr University Central Washington University City University Cornish College of the Arts Eastern Washington University Gonzaga University Heritage College Northwest College Pacific Lutheran University Saint Martin’s College Seattle Pacific University Seattle University The Evergreen State College University of Washington, Seattle University of Washington, Tacoma University of Washington, Bothell Washington State University Western Washington University Whitworth College Students may transfer credits among the community and transfer credits among Students may to from other colleges how to transfer credits Questions about credits among colleges are More opportunities for transferring College Associate in Arts and The Tacoma Community Transfer among Pierce County Pierce among Transfer Colleges Technical and Community or when the educational courses in Pierce County technical colleges determined to be equivalent. programs are in and Records Center directed to the Registration TCC may be call 253.566.5048. Bldg. 18. For information, agreements by the Pierce County Careers being developed through Bates Technical College, Clover Park Consortium, which includes College and Tacoma Community College. Technical College, Pierce from Credits Transferring College Tacoma Community A, and the Associate of Science degree Sciences degree, Option institutions are directly transferable to most major baccalaureate in Arts and in Washington. Students who earn the Associate general education Sciences degree will normally have satisfied the transferring. requirements for the baccalaureate degree before will have Students who earn the Associate of Science degree at all public and most junior standing and priority admission status Students with the private baccalaureate institutions in the state. better prepared for Associate of Science degree will generally be but should admission into a major in their area of specialization, to expect to have additional general education requirements institutions complete at the transfer institution. The following Transfer and subscribe to the state-wide Policy on Inter-College Articulation agreement:

course work completed at Tacoma Community College. course work completed College. at Tacoma Community and transfer college-level coursework. and transfer

> earned least 30 of the last 45 applicable credits must be At > grade point average of 2.00 in A cumulative college-level > of 2.00 in TCC grade point average A combined cumulative Students are encouraged to submit official transcripts from The College subscribes to the statewide Policy on Inter-College The College subscribes to the statewide Policy Tacoma Community College recognizes academic credits that Tacoma Community College recognizes academic Tacoma Community College will accept for transfer a maximum Tacoma Community College will accept for transfer The College provides assistance in determining completion of the The College provides assistance General requirements for all degrees are as follows: for all degrees General requirements previous institutions as soon as they are admitted to the College. Credit evaluations usually take 2-4 weeks to complete. Transfer coursework will not be used to satisfy prerequisites or degree requirements until official transcripts have been evaluated. Transfer and Articulation among Washington Public Colleges and Universities, endorsed by the public colleges and universities of Washington and the State Board for Community and Technical Colleges, and adopted by the Higher Education Coordinating Board. The policy deals with the rights and responsibilities of students and the review and appeal process in transfer credit disputes. For more detailed information, contact the Tacoma Community College Registrar in Bldg. 18. are essentially equivalent in academic level and nature to credit are essentially equivalent in academic level and at other colleges (or courses) offered at TCC and which are earned and Colleges accredited by the Northwest Association of Schools by Tacoma or by another accrediting body duly recognized Community College. of 60 credits that apply to the degree or certificate the student is of 60 credits that apply to the degree or certificate do not satisfy pursuing, to include no more than 15 credits that credits are skills or distribution requirements, unless additional of a required to satisfy prerequisites for or requirements are defined for professional/technical degree. Applicable credits transfer this purpose as courses that, at the time of the satisfied by evaluation, do not duplicate requirements already College or courses previously completed at Tacoma Community previously transferred from other institutions. Credits Transferred to TCC required curricula for graduation through its system of advisors and required curricula for graduation final responsibility for meeting all academic counselors; however, the individual student. and graduation requirements rests with you, the Note: College-level courses are numbered 100 and above at TCC. Course Note: College-level courses are may vary. See the Credential Evaluator for questions numbering at other colleges regarding transfer credit.

Requirements for All Degrees for Requirements policies, see page 32. Note: For grade College Degrees College 40 Degrees and Graduation two degrees. earned inresidenceatTacomaCommunityCollegetobeeligiblefor and 150creditsforathirddegree).Fifty(50)mustbe each additionaldegree.(Example:120creditsforaseconddegree for eachdegree,acandidatemustearnanadditional30credits Community College.Inadditiontomeetingthespecificrequirements Multiple Degrees enrolls atTCC,theCollegewilladheretofollowingpolicy: Changing TCCDegreeRequirements advisors, andfromthebaccalaureateinstitutions. in theAdvisingandCareerCentersBldg.18,fromfaculty Option A.Informationonthetransferabilityofcoursesisavailable are takenaspartoftheAssociateinArtsandSciencesdegree, Some coursesnotnormallytransferablemaybeacceptedifthey are normallyacceptedintransferbythereceivinginstitution. of AssociateinArtsandSciencesdegree,OptionB,page42. which theyintendtoearnthebachelor’sdegree.Seedescription and degreerequirementsofthecollegeoracademicprogramin urged toplantheircourseofstudybyconsultingspecifictransfer intentions totransferaparticularbaccalaureatecollegeare completed forgraduation. programs haveuniquecourserequirementsthatmustbe baccalaureate institutionsandindividualdepartmentsor upon admissiontoanyoftheseinstitutions.However,some degree, OptionA,willnormallybegrantedjuniorstanding University andTheofOregon. directly transferabletoPortlandStateUniversity,EasternOregon A studentmayearnmorethanonedegreefromTacoma In theeventthatdegreerequirementschangeafterastudent College-level coursesofferedbyTacomaCommunityCollege Students whoenterTacomaCommunityCollegewith Students whocompletetheAssociateinArtsandSciences The AssociateinArtsandSciencesdegree,OptionA,isalso in effectwhentheygraduate. requirements withinfiveyearsmustfulfillthe graduation; studentswhodonotcompletethedegree fulfill thedegreerequirementsineffectattimeoftheir Community College.TheCollegeencouragesallstudentsto another accreditingbodydulyrecognizedbyTacoma Northwest AssociationofSchoolsandCollegesorby originally enrolledinanycollegeaccreditedbythe Community Collegedegreeineffectwhenheorshe credits, maygraduateundertheprovisionsofTacoma transfers totheCollegewithaminimumof55applicable who initiallyenrollsatTacomaCommunityCollege,or If thedegreeiscompletedwithinfiveyears,student Records Center,Bldg.18,priortoapplyingforthedegree. all transcriptsfromothercollegesonfileintheRegistrationand Degree Committee.Transferstudentsmusthaveofficialcopiesof reviewed andapprovedquarterlybytheAcademicAssociate requirements havebeensatisfied.ApplicationsforDegreeare College Catalogwiththeiracademicadvisortoensureall advised tocarefullyreviewprogramrequirementsidentifiedinthe allow timeforcreditevaluationbythetransferinstitution. quarter priortotheinwhichtheyplangraduate Sciences degree,OptionB,mustapplybythesecondweekof Students applyingtograduatewithanAssociateinArtsand A $10non-refundableApplicationforDegreefeewillbeassessed. second weekofthequarterinwhichastudentplanstograduate. file attheRegistrationandRecordsCenternolaterthan forms, signedbytheAdvisor/ProgramCoordinator,mustbeon Registration andRecordsCenter,Bldg.18.Completedapplication Application forDegree.formsareavailableinthe Application forDegrees Degree Requirements: (DTA TransferDegree) Sciences Associate InArtsand with ahighschooldiploma. $34,519 or36.6%more thanastudent Associate’s Degreegraduate is The averageearningsofan Did YouKnow? Prior tosubmittinganApplicationforDegree,studentsare Students preparingforgraduationmustcompleteaformal Courserequirements fortheAssociateinArtsandSciences > Amaximumofthreephysicaleducationactivitycreditswill > Acumulativegradepointaverageof2.00inall coursework > Atleast30ofthelast45applicablecreditsmustbeearned > 90quartercredithoursin coursesnumbered100orabove, > either OptionAorB. degree mustbemetbycompletingaprogramasoutlinedin apply towardthedegree. average of2.00inallTCCcollege-levelcourses. applied totheAssociatedegreeandacumulativegradepoint at TacomaCommunityCollege. heading OptionAorfromanapprovedBplan. including thedistributionrequirementslistedbelowunder Degrees and Graduation 41 253.566.5396 Total Credits: 90 Total Credits: > continued, next page ...... English 101 English 102 or 103 Quantitative Skills Philosophy 120 126, 220, Math 107, 108, 111, 112, 115, 116, 117, 124, 125, 224, 238 Business 256 Language Series (choose from Russian, Japanese or Spanish) Russian 101, 102, 103 Japanese 111, 112, 113 Spanish 101, 102, 103 Humanities 110 English 280 - Spring quarter only Pacific Rim Literature. Philosophy 190, 200 Speech 110 This two-year Associate in Arts and Sciences Option A degree This two-year Associate degree in Pacific Rim Studies will equip The Option A Associate A Associate The following curriculum is required for the Option 1. Written Communication (10 credits) 2. Quantitative Skills (5 credits) courses carries Choose from the courses listed below. Each of these a prerequisite of Math 99. 3. Humanities (25 credits) 3. Other College-Level Electives (15 credits) Electives College-Level 3. Other above. 100 or numbered must be in courses credits All elective elective credits. cannot be used as PE Activity credits is on page 46. Course List Approved Distribution Studies - Pacific Rim Option A Contact: Dr. Yi Li provide students a broad foundation in the program is designed to and economics of selected Pacific Rim languages, culture, history countries in Central and South America, as countries. These include and other Pacific Rim Countries. well as Japan, Russia, Mexico international students with broad, entry-level skills useful in the Direct Transfer business or trade. This course of study meets all students to enter Agreement requirements. In addition, it prepares University of the Pacific Rim or Asian Studies programs at the Chinese Studies Washington-Tacoma, and the Global Studies or programs at Pacific Lutheran University. degree in Pacific Rim Studies at TCC. Philosophy 120 125, 126, Math 107, 108, 111, 112, 115, 116, 117, 124, 220, 224, 238 Business 256 English 101, and either English 102, or 103 F. Distribution Electives (7 credits) Distribution electives must be selected from courses listed Basic Requirements, Humanities, Social Sciences, or under Natural Sciences. Students are advised to take at least one learning community (coordinated studies or linked course) and a writing intensive course (other than a written communiction skills course) as part of their degree electives. E. Physical Education (3 credits) Any three activity credits. A maximum of three PE activity credits can apply toward the degree. D. Multicultural (5 credits) Select one course from those shown in the list on page 46. (See NOTE on Distribution List.) C. Natural Sciences (15 credits) shown in the Select one course from three different disciplines list on page 46. Shall include at least one laboratory course. B. Social Sciences (15 credits) shown in the Select one course from three different disciplines list on page 46. Select one course from three different disciplines shown in the Select one course from three different disciplines list on page 46. No more than 5 credits of studio/performance/ skills course(s). A. Humanities (15 credits) Choose from the courses listed below. Each of these courses Choose from the courses listed below. Each of these carries a prerequisite of Math 99 or Math 97. B. Quantitative Skills (5 credits) A. Written Communication Skills (10 credits) A. Written Communication Students transferring to The Evergreen State College or to the Students transferring to At least one course (5 credits) of the 90 credits applied toward course (5 credits) of the At least one This degree option is awarded by Tacoma Community College Community by Tacoma is awarded option This degree 2. Distribution Requirements (60 credits) area. Please note: Credits may be counted in only one distribution 1. Basic Requirements (15 credits) 1. Basic Requirements University of Washington-Tacoma are strongly advised to include at University of Washington-Tacoma (coordinated studies or linked course) least one learning community See the Distribution Electives below. as part of their degree. graduation must be designated as a multicultural course. Approved be designated as a graduation must designated in the Approved Distribution multicultural courses are in the course description section beginning Course List, page 46 and class schedule with a (M) following on page 79 and the quarterly the course title. and is directly transferable to most baccalaureate institutions in baccalaureate institutions transferable to most and is directly Washington. Option A Degrees Option 42 Degrees and Graduation student’s OptionBprogramwillbeaccepted bythetransferinstitution. adequate assurancefromthefour-year collegeoruniversitythatthe choosing topursueanOptionBdegree areresponsibleforsecuring institution. YourOptionBadvisorcanassistwiththeseforms. by anundergraduatedepartmentaladvisorofthefour-year published bythefour-yearinstitutionorawrittenrecommendation application acopyoftherequirementsorrecommendations the TCCwebsite.YoumustalsoincludewithOptionB list ofOptionBadvisorsisavailableintheAdvisingofficeandon Credentials Evaluator,RegistrationandRecordsCenter,Bldg.18.A which mustbesignedbyyourOptionBadvisor,isavailablefromthe and RecordsCenterofBldg.18.TheOptionBapplicationform, and isavailablefromtheCredentialsEvaluatorinRegistration application form,whichmustbesignedbyyourOptionBadvisor, quarters beforeTCCgraduation,youshouldcompleteanOptionB specific subjectarea,preferablybytheendofyourfirstyear.Two TCC facultyadvisordesignatedastheOptionBforyour regarding programrequirements.Youshouldalsobeassignedtoa consult withanadvisorattheintendedtransferinstitution transfer andareinterestedintheOptionBdegree,youshould programs, anAssociateofSciencedegree. and SciencesOptionAdegreeor,ifyouareinterestedinscience advisor. YoumaybebestservedbypursuinganAssociateinArts program/major theywillpursueshoulddiscussthiswiththeir Students whoareuncertainwheretheywilltransferorwhich specific programwithinafour-yearcollegeoruniversity. Option A.Bdegreesaredesignedtotransferonlya college oruniversitydiffersignificantlyfromTCC’srequirementsfor fields ofstudywherethetransferrequirementsafour-year Option BDegrees 7. Electives(17credits) 6. PhysicalEducation(3credits) 5. NaturalSciences(15credits) 4. SocialSciences(20credits) While yourOptionBadvisorwillprovide assistance,students If youknowtowhichprogramandinstitutionwant This degreeoptionisawardedbyTacomaCommunityCollegein Continuance oflanguageseries Global Business230,240,250 Anthropology 202 Recommended electivesare: One coursemustbealaboratoryscience Global Business210,220(requiredelectives) Political Science203 Geography 110 History 120,121,211,230,260 interact withinformationsystemsfortoday’sbusiness. information technologybackgroundtoeffectivelydesignand to buildabasicbusinessfoundationwhiledevelopingthe Information Systems.Thisassociate’sdegreewillenablestudents complete aBachelorofArtsdegreewithconcentrationin Tacoma’s BusinessAdministrationProgramwherethestudentwill Contact: RobertTan Program -OptionB Information Systems about enrollment,contacttheadvisor. courses applyonlytotheEvergreenStateCollege.Forinformation based curriculumoftheTCCBridgeProgram.CreditsearnedinIDS disciplinary learningcommunitiesdesignedaspartofthetheme- are taughtinaCoordinatedStudiesformatandInterdisciplinary. campuses. ConsulttheadvisorregardingOptionBplan.Courses for transfertotheEvergreenStateCollege-TacomaorOlympia Contact: KimWashington Bridge Program-OptionB 5. Statistics(5credits) 4. Accounting(15credits) 3. NaturalSciences(15credits) 2. SocialSciences(20credits) 1. Humanities(10credits) This degreeisdesignedtotransferintoUniversityofWashington Interdisciplinary Studies(IDS)coursesareteamtaught,cross- This AssociateinArtsandSciencesOptionBprogramisdesigned U 5 Statistical Analysis(orMATH108) BUS 256 AccountingPrinciples-Managerial ACCNT 230 AccountingPrinciples-Financial ACCNT 220 AccountingPrinciples-Financial ACCNT 210 Programming Java C++ IT 242 IntroductiontoProgramming IT240 IT 201 following: One programmingcourse(5credits)mustbeselectedfromthe ElementsofCalculus(orequivalent) MATH 112 CollegeAlgebraforBusinessandEconomics MATH 111 Psychology, Sociology,Anthropology One course(5credits)mustbeselectedfromthefollowing: 10 creditsselectedfromtheTCCsocialsciencesdistributionlist. Economics Micro ECON 201 Economics Macro ECON 200 college level. high school levelor10creditsofoneforeignlanguageatthe Foreign Language-Twoyearsofoneforeignlanguageatthe Selected fromtheTCChumanitiesdistributionlist...... 253.566.5313 253.680.3022 Degrees and Graduation 43 English 101 English The AEGS certificate program consists of a series of The AEGS certificate program consists of a series advisor. Program For detailed program information, contact the See also the new professional/technical Global Business new professional/technical See also the Gender Studies Certificate Program The American Ethnic and Certificate requirement in American interdisciplinary courses leading to a certificate on the Ethnic and Gender Studies and a special notation program are transcript. Students enrolled in the certificate in American Ethnic required to complete 15 credits of course work Studies and Gender Studies. All American Ethnic and Gender of the AEGS courses can be used to satisfy the requirements or degree. This certificate in addition to any other certificate wishing to design program provides an opportunity for students their personal and individualized course sequences that support course availability educational goals. See the class schedule for each quarter. flyers are available at kiosks. 6. English Composition (5 credits) Composition 6. English degree. in Applied Sciences 61, to earn an Associate Program, page and Ethnic American Gender Studies Program Certificate College is a multidisciplinary (AEGS) at Tacoma Community activities, and projects to enhance program coordinating courses, of the roles and functions of gender the student’s understanding States. AEGS courses are geared and ethnicity in the United College students who seek to towards all Tacoma Community race, ethnic and class issues, whether understand complex gender, planning to transfer they are in a profesional/technical program or the needs of part- to a 4-year institution. AEGS also aims to meet in the time students and community members with interests topics of ethnicity and gender. 253.566.5257 Total: 90 credits ...... Business 256 (or Math 108) Accounting 210, 220, 230 Math 111 or equivalent & 112 or equivalent Elective: Choose 5 credits of a natural science from the TCC natural sciences distribution list. Lab is not required. Economics 200, 201 Business 200 Global Business 220 Elective: Choose from Psychology, Sociology, or Anthropology Language series 101, 102, 103 (choose from Russian, Japanese, Language series 101, 102, 103 (choose from Russian, Spanish or French.) Speech 110 spring quarter Elective: Humanities 110 or English 280 (to be taken for international emphasis). Suggested courses: 235IT IT 238 Introduction to Information Technology IT 239 Visual Basic Advanced Visual BASIC ENGL 101ENGL Composition College Freshman 103ENGL 102 and Persuasion -or- ENGL Argument BUS 200 Business Law This unique program is designed for transfer into University This unique program is designed for transfer into 5. Statistics (5 credits) 4. Accounting (15 credits) 3. Natural Science (15 credits) 2. Social Science (25 credits) 1. Humanities (25 credits) of Washington Tacoma’s Business Administration Program where of Washington Tacoma’s Business Administration with a the student will complete a Bachelor of Arts degree Associate in Arts concentration in International Business. This to build a and Sciences Option B degree will enable students basic business foundation while focusing on international, which foster multicultural and interdisciplinary perspectives These global understanding and international awareness. 21st century as perspectives are a vital part of success in the face the challenges managers in business and government begin to of the global marketplace. Contact: Jim Wiek International Business International - Option B Program 8. Electives (10 credits) 8. Electives 7. English Composition (10 credits) Composition (10 7. English 6. Law (5 credits) 6. Law 44 Degrees and Graduation trar. Thedetailsofapprovedspecializations aregivenbelow. tion asapprovedbythedepartment,sciencedivisionandRegis- These coursesmustincludeasetofforparticularspecializa- 3. SpecializationCourses(30-60credits) 2. HumanitiesandSocialSciences(15credits) 1. BasicRequirements(15credits) Degree Requirements: year institution. required tocompleteadditionaleducationrequirementsattheirfour transfer withanAssociateofSciencedegreewilltypicallybe programs ofstudy,includingelectivecourses.Studentswho closely withtheirAssociateofScienceadvisortoplan degree areofferedonlyonceortwiceayear.Studentsshouldwork requirements ofthatspecialization.Manyclassesrequiredforthis list andwillbeassignedaTCCadvisorwhounderstandsthe degree arerequiredtoselectaspecializationfieldfromtheapproved programs atabaccalaureateinstitution.Studentspursuingthis designed forstudentswhointendtotransferintocertainscience (Transferable Degree) Degree Associate ofScience This degreeisawardedbyTacomaCommunityCollegeand C. 5additionalcreditsfromeithertheHumanitiesorSocialSciences B. 5creditsfromtheSocialSciencesonApprovedDistribution A. 5creditsfromtheHumanitiesonApprovedDistribution B. QuantitativeSkills(10credits) A. WrittenCommunicationsSkills(5credits) Atleastonecourseappliedtothedegreemustbefrom > Acumulativegradepointaverageof2.00inall coursework > Atleast30ofthelast45applicablecreditsmustbeearned > 90quartercredithoursin coursesnumbered100orabove. > on theApprovedDistributionCourseList. Course List. Course List. Math 124,125(orabovewithapprovalofadvisor) English 101 Quarterly ClassSchedules. course descriptionssectionoftheTCCcatalogandin designated withan(M)followingthecoursetitlein Distribution CourseList,page46.Thesecoursesare list ofapprovedmulticulturalcoursesintheApproved of 2.00inallTCCcollege-levelcourses. applied tothedegreeandacumulativegradepointaverage at TacomaCommunityCollege. Specialization Courses(50credits) biology, botany,genetics,molecularandzoology. appropriate forstudentsstudyingbiologicalsciencesincluding ment insection#3oftheAssociateSciencedegreeandis Biology Specialization Approved DistributionCourseListisonpage46. 4. ElectiveCourses(0-30credits) Specialization Courses(43credits) appropriate forstudentsstudyingcomputerscience. ment insection#3oftheAssociateSciencedegreeandis Computer ScienceSpecialization Specialization Courses(50credits) appropriate forstudentsstudyingchemistry. ment insection#3oftheAssociateSciencedegreeandis Chemistry Specialization Social Sciencecourse oranelective. elective courses.ENGR100ishighly recommended asasection#2 90 credits.MATH108and238 arehighlyrecommendedas The studentmustchoose17creditsin section#4toreachatotalof 90 credits. The studentmustchoose10creditsinsection#4toreachatotalof recommended aselectivecourses. 90 credits.Physics114,115or121,122arestrongly The studentmustchoose10creditsinsection#4toreachatotalof The followingsetofcoursesfulfillsthespecializationrequire- The followingsetofcoursesfulfillsthespecializationrequire- The followingsetofcoursesfulfillsthespecializationrequire- Remaining collegelevelcoursestoreachatotalof90credits. v Sciencecreditapproved byacomputerscienceadvisor(5credits) iv) Math126,220,224(13 credits) iii) Physics121,122,123(15credits) ii) ComputerScience142,143(10credits) i) Physics121,122,123(15credits) iii) Math126(5credits) ii) Chemistry140,150,160,231,232,233(30credits) i) Math126or108(5credits) iii) Chemistry140,150,160,231,232,233(30credits) ii) Biology210,211,212(15credits) i) > Specializationsapprovedatthetimeofprintingaregiven > Amaximumof5creditsinthiscategorycanbefromcourses > PEactivitycoursescannotbeusedaselectivecreditsinthis > Theamountofcreditinthiscategorydependsonthenumber asdegree.shtm forthemostcurrentlistofspecializations. below. Pleaseseewww.tacoma.ctc.edu/inst_dept/science/ list fortheAssociateinArtsandSciencesdegree. that donotappearonanybasicrequirementordistribution category. of creditstakeninthespecializationcourses#3. Degrees and Graduation 45 Total credits in specialization = 50 179 (2 credits) i) One Special Topics Seminar: GEOL 179, OCEAN 179, or ENVSC ii) GEOG/ENVSC 210 (Geographic Information Systems) (5 credits) i) Physics 121, 122, 123 (15 credits) ii) Math 126, 220, 224, 238 (18 credits) iii) 140, 150 (10 credits) Chemistry iv) 142 (5 credits) Engineering i) 201 (5 credits) Micro-economics, ECON ii) (5 credits) Political Sciences, POLSC 201 i) General Chemistry, CHEM 140, 150, 160 (15 credits) ii) College Biology, BIOL 210, 211, 212 (15 credits) iii) Statistics, MATH 108 (5 credits) iv) Physics, PHYS 114 (5 credits) v) Physical Geology, GEOL 101 (5 credits) vi) Technical Writing, ENGR 231/ENGL 105 (5 credits)* This specialization will require the student to choose at least This specialization will require the student to choose require- The following set of courses fulfills the specialization The student must choose 12 credits in section #4 to reach a total of 90 credits. ENGR 100 is highly recommended as a section #2 Social Science course or an elective. This degree is designed to prepare you for any of the environ- any of the you for to prepare is designed This degree must be taken when Social Science courses The following set of courses fulfills the specialization In addition,the following of the Associate of Science degree: requirement in section #3 the *Engineering 231/English 105 are recommended but ENGL 102, following expository writing courses may be substituted: 104, 201. 10 credits in section #4 of the Associate of Science degree in order 10 credits in section #4 of the Associate of Science following courses to reach a total of 90 credits. Selection from the is strongly recommended. Physics Specialization degree and is ment in section #3 of the Associate of Science appropriate for students studying physics. Specialization Courses (48 credits) Environmental Sciences Environmental in the State of Washington. bachelor’s programs mental science institutions. Consult with vary among However, requirements your adivsor. #2, part B and C of the requirements for section fulfilling the Associate of Science degree:

Engineering 124, 143, 170, 210, 215, 220, 230, 231, 260 Engineering 124, 143, 170, 210, 215, 220, 230, Chemistry 160, 231, 232 Biology 210, 211, 212 (Bioengineering only) Math 224 (Required for UW transfers) i) Engineering 142 (5 credits) ii) Physics 121, 122, 123 (15 credits) iii) Math 126, 220, 238 (15 credits) iv) Chemistry 140, 150 (10 credits) total of 90 credits. The following course is recommended: total of 90 credits. The GEOG 210 or ENVS 210. i) Math 126 (5 credits) ii) 140, 150, 160 (15 credits) Chemistry iii) Physics 121,122, 123 (15 credits) iv) credits) Geology 101 (5 This specialization allows no credits in section #4. This specialization allows no credits in section This specialization requires 15 credits from the following list. This specialization requires 15 credits from the following major. These 15 Selection depends upon the intended engineering credits must be approved by an engineering advisor. In addition the following set of courses fulfills the specialization In addition the following set of courses fulfills Engineering 100 (5 credits) is a required course for this Engineering 100 (5 credits) The student must choose 20 credits in section #4 to reach a The student must choose The following set of courses fulfills the specialization require- fulfills the specialization of courses set The following

75% of TCC students stay in the region and contribute to the local economy after they leave the college. Did You Know? * Note: The engineering specialization requires 60 credits. However, in some * Note: The engineering specialization requires 60 credits. engineering cases this will not satisfy entry requirements into a specific wish to take more than department at a baccalaureate institution. Students may for transfer. 60 credits to satisfy these program specific entry requirements Some students may best be served by pursuing an AAS Option B degree. requirement in section #3 of the Associate of Science degree and is requirement in section #3 of the Associate of Science appropriate for students studying engineering. Specialization Courses (60 credits, minimum) specialization and satisfies section #2 Social Science credits. specialization and satisfies Engineering Specialization* Engineering ment in section #3 of the Associate of Science degree and is of Science degree and #3 of the Associate ment in section sciences such as geology: for students studying earth appropriate credits) Courses (40 Specialization Earth Sciences Specialization Sciences Earth 46 Degrees and Graduation B. SocialSciences Humanities distributionrequirement. *No morethan5creditsofPerformanceorSkillcoursesmaybe used forthe A. Humanities Note: *=PerformanceSkillscourses Associate ofSciencedegrees. Course List Approved Distribution Use thislistfortheAssociateinArtsandSciences Sociology 110,240,247,252,262, 270, 271,287 Psychology 100,204,205,206 231, 240,290 Political Science100,101,201,202,203,205,210,220,230, Library Science101,102,103 260, 290 230, 231,241,242,243,244,248249,250,251,254,255, History 111,112,113,120,121,147,211,221,222,223,225, Global Business220 Geography 110 Engineering 100 Education 201 Economics 200,201 Business 200,230 Anthropology 100,201,202,203,205,210,270,280 Speech 100,101,110,111,120,130,201 290 Philosophy 100,119,120,190,200,215,230,260,267,270, 270*, 280*,299 124*, 125*,126*,130*,150,160*,170*,180*,199*,260*, Music 100,101*,102*,103*,106,107,108,112,121*,123*, Languages (Discipline): Journalism 101,103,209 Humanities 100,101,102,103,110,120,130,131,260,285 History 231 267, 268,269,271,276*,277*,278*,279*,280 English 232,234,241,242,250,257,258,259,260,264,265, Drama 101 172*, 199,201,202,203,249*,258*,260* 120*, 121*,122*,126*,127*,131*,146*,150*,156*, Art 100,101*,102*,103*,105*,106*,117*,118*,119*, Anthropology 203 Spanish 101,102,103 Japanese 111,112,113 German 101,102,103 French 101,102,103 American SignLanguage120,121,122,123 D. Multicultural C. NaturalSciences completed. by thesamenumberofcreditstoassureaminimum60Distributionare Note: Ifoneofthesecoursesisselected,DistributionElectivesmustbeincreased Non-distributional MulticulturalCourses Speech 110,111,130 Sociology 110,247,252,262,287 Sign Language120,121,122 Psychology 206 Political Science210,240 Philosophy 190,200 Music 106 Languages: Humanities 100,101,102,103,110,120,130,131,260,285 244, 254,260 History 120,121,147,211,223,225,230,231,241,242,243, 271, 280 English 232,234,241,242,257,258,259,260,267,268,269, Education 201 Drama 101 Global Business220 Art 100,150 Anthropology 100,201,202,203,210 Physics 114,115,116,121,122,123 Physical Science100 Oceanography 101,179 Geology 101,108,125,179 Geography 205,210 Environmental Science106,145,179,210 Chemistry 100,101,102,140,150,160,231,232,233 Botany 101 220, 221,240,241,242 Biology 100,105,107,108,118,140,161,201,210,211,212, Astronomy 105 Anthropology 201,270,280 Human Services261 Human Development110,112,179,250 Global Business210,230,240 Educational Paraeducator130,255 English asaSecondLanguage190 Business 255 Japanese 113 French 103 American SignLanguage120,121,122,123 Degrees and Graduation 47 ENGL 101ENGL College Freshman Composition (5 credits) 100ENGL Business English (5 credits) 100SPCH credits) Fundamentals of Speech Communications (5 101SPCH Public Speaking (5 credits) 110SPCH Communication (5 credits) Multicultural 120SPCH Communication (5 credits) Small Group 130SPCH Interpersonal Communication (5 credits) BUS 11097MATH Business Math 99MATH Intermediate Algebra for the Liberal Arts (5 credits) Or any Math course 100 or above credits) Intermediate Algebra (5 164BUS 167BUS Leadership & Human Relations (5 credits) 230BUS Work Teams and Organizational Dynamics (5 credits) 255BUS Business Ethics and Corporate Responsibility HD 110 Managing Diversity (5 credits) HSP 261 Human Relations 100PSYCH Understanding Diversity General Psychology (5 credits) 264SMG 110SPCH Motivation & Productivity (3 credits) Multicultural Communication (5 credits) A. Written Communications credits in one of the will take a minimum of five The student following: B. Oral Communication credits in one of the following: The student will take five C. Reading level skills as The student will be assessed as possessing college courses to measured by TCC assessment evaluation or complete reach that skill level. 2. Quantitative Skills of the Students will take a minimum of five credits in one following courses: 3. Living and Working Cooperatively be satisfied in Pro- The Living and Working Cooperatively content must the courses listed be- fessional/Technical programs by completing one of may choose low as determined by the program curriculum or programs objectives for these to embed the content within program courses. The courses must clearly identify the content. Related Instruction Requirements Instruction Related 1. Communication satisfied in Professional/Technical content must be The Communication listed below as determined completing one of the courses programs by curriculum. by the program Drama 101 265, 258, 259, 260, 264, 234, 241, 242, 250, 257, English 232, 279, 280 271, 276, 277, 278, 267, 268, 269, 248, 241, 242, 243, 244, 222, 223, 225, 230, 231, History 221, 249, 250 130, 131, 260 Humanities 100, 101, 102, Journalism 101 Political Science 220, 240 Speech 130 The faculty of TCC, along with a program advisory committee, The faculty of TCC, along with a program advisory The Associate in Applied Sciences degree is designed for The Associate in Applied Sciences degree is designed The Associate in Applied Sciences degree is designed for The Associate in Applied determines the curriculum for each professional/technical requirements, program. Each curriculum includes major program Each elective courses, and related instruction requirements. related instruction Applied Sciences degree program contains six and working areas: communication, quantitative skills, living thinking and cooperatively, responsibility/leadership, critical problem solving, and information and information technology. Related instruction content may be embedded (listed in course objectives) within a program course, may be taught as part of a course (e.g., English 101 for Communication), or may be a prerequisite to program admittance. Students also may challenge courses or utilize an assessment/testing process to satisfy some related instruction requirements. Specific program requirements are listed in the Professional/Technical Programs section. students in TCC’s professional/technical programs. To obtain the students in TCC’s professional/technical programs. 90 credits, meet degree, a student must complete a minimum of instruction the specific program requirements, meet the related cumulative requirements described below, and earn a minimum 45 applicable credits grade point average of 2.0. Thirty of the last must be completed at Tacoma Community College. Associate in Applied Sciences Degree Requirements Associate in Applied Sciences Degree those students who complete an approved course of studies in a those students who complete an approved course See the graph, professional, occupational, or technical area. to an Applied page 53, for the programs TCC offers that lead Sciences degree. Associate in Applied Associate Degree Sciences Writing Intensive Writing students. some transfer for Recommended 48 Degrees and Graduation objectives forthesecoursesmustclearlyidentifythecontent. grams maychoosetoembedthecontentwithinprogramcourses.The courses listedbelowasdeterminedbytheprogramcurriculumorpro- be satisfiedinProfessional/Technicalprogramsbycompletingoneofthe The InformationandTechnologycompetencycontentmust 6. InformationandTechnology these coursesmustclearlyidentifythecontent. choose toembedthecontentwithinprogramcourses.Theobjectivesfor below asdeterminedbytheprogramcurriculumorprogramsmay Professional/Technical programsbycompletingoneofthecourseslisted The CriticalThinkingandProblemSolvingcontentmustbesatisfiedin 5. CriticalThinkingandProblemSolving *Courses alsomeetLivingandWorkingCooperativelyRequirement must clearlyidentifythecontent. the contentwithinprogramcourses.Theobjectivesforthesecourses termined bytheprogramcurriculumorprogramsmaychoosetoembed Technical programsbycompletingoneofthecourseslistedbelowasde- The Responsibility/LeadershipcontentmustbesatisfiedinProfessional/ 4. Responsibility/Leadership LS 102 Research Methods Research IntroductiontoInformationTechnology LS 102 WordI,ExcelPowerPoint(5credits) IT 235 ExcelI(2credits) CU 105 Word I(2credits) CU 103 IntroductiontoWindowsandWWW(1credit) CU 102 CU 100 IntroductiontoLogic(5credits) PHIL 119 Argument&Persuasion(5credits) ENGL 103 IntroductiontoCriticalThinking(5credits) COMSK 100 BusinessEthicsandCorporateResponsibility BUS Leadership&HumanRelations(5credits) 230 BUS 164 MulticulturalCommunication(5credits)* SPCH 110 Motivation&Productivity(3credits)* SMG 264 GeneralPsychology(5credits) PSYCH 100 ManagingDiversity(5credits) BUS 255 BusinessEthicsandCorporateResponsibility BUS 230 WorkTeamsandOrganizationalDynamics(5credits) BUS 167 Leadership&HumanRelations(5credits)* BUS 164 postsecondary institution. approved occupationalortechnicalprogramatanotheraccredited is awardedtostudentstransferringTCCaftercompletingan Arts: General Associate inTechnical Living andWorkingCooperatively. three relatedinstructionareas:Communication,Computation,and each certificateofmorethan40creditscontainsaminimum program. Curriculumincludestechnicalprogramrequirements.Also, advisory committee,determinesthecurriculumforeachcertificate the graph,page53,foralistingofcertificateprograms. week ofthequarterinwhichrequirementsaretobecompleted.See forwarded totheProgramChairnolaterthanendofsecond “Application forVocationalCertificate.”Theapplicationis certificate, studentsmustsubmitTacomaCommunityCollege’s requirements forprogramsoflessthan90credits.Toreceivea Certificate Programs Professional/Technical ATA DegreeRequirements(General) A general(non-specific)AssociateinTechnicalArts(ATA)degree Faculty ofTacomaCommunityCollege,alongwithaprogram Certificates ofcompletionaregrantedtostudentsmeetingthe EachATAdegreeprogramatTCCcontainsfiverelated > CoursestakenatTCCshouldnotrepeatorduplicatecourse > Electivesmaybeneededtomeetthebalance ofthe90 > Atleast30ofthelast45applicablecreditsmustbeearned > Ninety(90)quarterhours, includingaminimumof45quarter > Certificationofcompletionanapprovedoccupationalor > related instructioncategories: technology. Aminimumof20creditsmustbeearnedinthe relations, leadership,andinformation instruction areas:communication,quantitativeskills,human program. work completedintheapprovedoccupational/vocational degree. Theseelectivesmustbe100-levelcoursesorabove. credits requiredfortheGeneralAssociateinTechnicalArts at TacomaCommunityCollege. classroom instruction. may beacceptedforcreditwithlessthan900hoursof approved program.Stateapprenticeshipprograms hours ortheequivalent(usually900oftraining)in vocational program. Degrees and Graduation 49 Environmental Science) Physics, Physical Science) Philosophy 120, Geography 205 course work completed at TCC. course work College. at Tacoma Community requirements. including the following apply toward the degree. Humanities, Philosophy) a) Social Sciences (Economics, Geography, Political Science) a) Social Sciences (Economics, Geography, Political Sociology) b) Behavioral Science (Anthropology, Psychology, c) History a) Natural Science (Astronomy, Biology, Botany, b) Physical Science (Chemistry, Geology, Oceanography, c) Mathematics (100 or above), Anthropology 201, 270, >in point average of 2.00 college-level grade A cumulative > earned 30 of the last 45 applicable credits must be At least > 100 or above, Ninety (90) quarter hours in courses numbered > of three physical education activity credits will A maximum Any three activity credits Five credits in each of the following: a) Performing and Fine Arts (Music, Art, Drama) b) Literary Arts (Literature, Foreign Language, Journalism, Five credits in two of the following: Five credits in two of the following: English 101, and one of the following: English 100, 102, 103 Speech 100, 101, 110, 120, 130 6. Electives (47 credits) 2. Humanities (10 credits) 3. Social Science (10 credits) 4. Math/Science (10 credits) 5. Physical Education (3 credits) Associate in General in Associate Studies Requirements AGS Degree Requirements AGS Degree Distribution counted in only one distribution area. Please note: Credits may be (10 credits) 1. Communications CU 100CU 102CU Introduction to Windows and WWW (1 credit) 103CU Word I (2 credits) 105CU Excel I (2 credits) 235IT Word I, Excel I, PowerPoint (5 credits) LS 102 Technology Introduction to Information Research Methods BUS 164BUS Leadership & Human Relations (5 credits) 167BUS (5 credits) Work Teams and Organizational Dynamics 255BUS Managing Diversity (5 credits) 101SMG Essentials of Supervision (3 credits) 131SMG Supervision and Group Behavior (3 credits) 261SMG Leadership Dynamics (3 credits) 264SMG Motivation and Productivity (3 credits) BUS 164BUS 167 Leadership & Human Relations (5 credits) BUS Organizational Dynamics (5 credits) Work teams and 255BUS Managing Diversity (5 credits) HD 110HSP 261 Human Relations 100PSYCH Understanding Diversity General Psychology (5 credits) 264SMG Motivation and Productivity (3 credits) 110SPCH (5 credits) Multicultural Communication BUS 11097 Business MATH Math Intermediate Algebra for the Liberal Arts (5 credits) 99MATH Algebra (5 credits) Intermediate or above Or any Math course 100 ENGL 101ENGL (5 credits) College Freshman Composition 100ENGL credits) Business English (5 100SPCH (5 credits) of Speech Communications Fundamentals 101SPCH (5 credits) Public Speaking 110SPCH Communication (5 credits) Multicultural 120SPCH Communication (5 credits) Small Group 130SPCH (5 credits) Interpersonal Communication (1-5 credits) 5. Information and Information Technology 4. Responsibility/Leadership (3-5 credits) 3. Living and Working Cooperatively (3-5 credits) 3. Living and Working Cooperatively 2. Quantitative Skills (5 credits) 2. Quantitative Skills ATA Related Instruction Requirements: Related Instruction ATA credits) (8-10 1. Communication 50 Degrees and Graduation Mathematics &NaturalSciences requirement. which thesecoursesareprerequisitealsoapplytothisdistribution In additiontotheabovecourselist,anyadvancedartfor Humanities distribution area.Allcoursesmustbenumbered100andabove. distribution requirements.Creditsmaybecountedinonlyone total quarterhourrequirementbutmaynotbeusedtomeet These coursesmaybeusedtofilltheelectiveportionof90 Math/Science orSocialScienceswillbeclassifiedaselectives. education activitycourses,thosecoursesnotlistedasHumanities, select coursesfromthelistbelowtomeetdistributionrequirements. Courses ApplicabletoAGSDegree With theexceptionofEnglishcompositionandphysical Students pursuinganAssociateinGeneralStudiesdegreemust Physical Science100 Physics 114,115,116,121,122,123 Philosophy 120 Oceanography 101 220, 224,238 Mathematics 107,108,111,112,115, 116,117,124,125,126, Geology 101,108,125 Geography 205,210 Environmental Science106,145,210 Chemistry 100,101,102,140,150,160,231,232,233 Business 256 Botany 101 220, 221,240,241,242 Biology 100,105,107,108,118,140,161,201,210,211,212, Astronomy 105 Anthropology 201,270,280 Spanish 101,102,103 290 Philosophy 100,119,120,190,200,215,230,260,267,270, 270, 280,299 121, 123,124,125,126,130,150,160,170,180,199,260, Music 100,101,102,103,106,107,108,109,110,111,112, Library Science105 Journalism 209,101,103 Japanese 111,112,113 285 Humanities 100,101,102,103,110,120,130,131,220,260, German 101,102,103 French 101,102,103 265, 267,268,269,271,276,277,278,279,280,290 English 232,234,240,241,242,250,257,258,259,260,264, Drama 101 American SignLanguage121,122,123,124 260 127, 131,146,150,156,172,199,201,202,203,249,258, Art 100,101,102,103,105,106,117,118,119,120,121,126, considered earnedcredits.) Honors List.(Gradesof“N”,“I”,“W”,“WI”,and“V”arenot grade pointaverageof3.33to3.65willbeplacedonthequarterly numbered 100andabove(excluding“S”“U”)inaquarterwith Quarterly Honors Awards Scholastic Honorsand Social Sciences advisor, Dr.Pamela Costaat253.566.5389. community service.Formoreinformation contactthefaculty recognition ofexcellenceinscholarship, leadership,researchand development ofpsychologystudents throughpromotionand behavior andintegrity.Themission ofPsiBetaisprofessional genuine interestinpsychologyand highstandardsofpersonal least 2quartersofpsychology,andhavedemonstrateda Members mustmaintaina3.0orbetterGPA,havecompletedat contact thePTKadvisorat253.566.6007. services tothecollegeandcommunity.Formoreinformation, communication andleadershipskillsprovideavarietyof scholarships. PTKmembersalsocandevelopinterpersonal better gradepointaverageandbeeligiblefortuition associate’s degreeprograms.Membersmustmaintaina3.5or Kappa, anhonorsocietyservingtwo-yearcollegesthatoffer Delta Omega. of studentlifeatTCC:PhiThetaKappa,PsiBeta,andAlpha Honor Societies High HonorsList.(seenoteaboveregardinggrades.) grade pointaverageof3.66to4.00willbeplacedonthequarterly numbered 100andabove(excluding“S”“U”)inaquarterwith Quarterly HighHonors Students whoearn12ormoreTCCgradedcollege-levelcredits Psi Betaisanationalhonorsocietyforpsychologystudents. Academic excellenceistheprimaryhallmarkofPhiTheta Three nationallyrecognizedscholasticorganizationsarepart Students whoearn12ormoreTCCgradedcollege-levelcredits Sociology 110,240,247,252,262,270,271,287 Psychology 100,204,205,206 231, 240,290 Political Science101,201,202,203,204,205,210,220,230, Library Science101,102,103 267, 290 230, 231,241,242,243,244,248,249,250,254,255,260, History 111,112,113,120,121,147,211,221,222,223,225, Geography 110 Engineering 100 Education 201 Economics 200,201 Anthropology 100,201,202,203,205,210,270,280 Degrees and Graduation 51 The three Associate in Applied Sciences degree candidates and degree candidates Sciences in Applied Associate The three Instructional Council shall select the A subcommittee of the students’ grade point averages are Where distinctions among an In cases where only breadth of course work separates criteria, If no clear distinction exists among the above Did You Know? Each spring nearly 700 students graduate from TCC with a degree, GED or certificate. President’s Medal Awards Medal President’s of degree and Associate in Arts and Sciences the three Associate at least 60 graded who have completed Science candidates and above) at Tacoma credits (numbered 100 college-level earned the highest cumulative College and who have Community for automatically be eligible average above 3.84 will grade point Medal. consideration for the President’s for each degree by a majority vote. In President’s Medal winner Medal winner in each degree category, selecting the President’s first consideration to a student’s grade the committee will give point average. view, the following additional not significant in the Council’s by examination: the number of courses criteria will be considered received an I, W (consideration will be in which the student has classes for given to students who completely withdraw from grade; the breadth substantiated medical reasons), and/or repeat sciences, math and of the student’s courses in humanities, social studies; and the science; the rigor of the student’s program of College. number of credits completed at Tacoma Community and an Option B Option A, Arts and Sciences degree candidate Medal. candidate, each student may be awarded a President’s in each more than one President’s Medal may be awarded degree category.

For commencement, scholastic honors are computed using Grade point average computations for degrees and awards at Students with a graduation grade point average of 3.66 or higher Students with a graduation grade point average Students with a graduation grade point average of 3.33 to Students with a graduation grade point average Upon graduation, TCC students who have achieved outstanding Upon graduation, TCC students who have achieved Degrees are conferred at the end of each quarter. Commence- Degrees are conferred Alpha Delta Omega is a national honor society for students honor society is a national Delta Omega Alpha grades earned through the winter quarter preceding commencement. Changes in a student’s honor status will be made to the student’s record if the last quarter of college work or if grades earned from transfer credits affect a student’s qualifications. graduation are based on all college-level credits (numbered 100 and above) earned at Tacoma Community College as well as credits transferred from other institutions which are used to meet degree requirements. who have completed at least 60 grade college-level credits (numbered who have completed at least 60 grade college-level have met award 100 and above) at Tacoma Community College and criteria described below will be graduated with “High Honors”. Awards Criteria (Graduation with Honors and Graduation with High Honors) Graduation with High Honors 3.65 who have completed at least 60 graded college-level 3.65 who have completed at least 60 graded Community College credits (numbered 100 and above) at Tacoma will be graduated and have met award criteria described below with “Honors.” Graduation with Honors grades will be honored. Students who graduate with scholastic grades will be honored. Students who graduate on their diploma. honors will have the award designated by a seal official The award will be noted on their transcript when for the following transcripts are requested. Students are eligible honors or awards: Graduation Awards

ment Ceremonies for degrees are held annually at the end of ment Ceremonies for degrees who have earned degrees in the spring quarter. All students are invited to participate in the June current academic year within one course of completing their Commencement. Students in the required course for summer degree and who have enrolled to participate in Commencement. Contact quarter may also apply and early the Credentials Evaluator in Bldg. 18 for degree Commencement application. Graduation enrolled in Human Services programs. Chartered in 1990, the TCC in Chartered Services programs. in Human enrolled of and promotes the ideals academic excellence chapter stresses is open to students profession. Membership the human services in who are enrolled higher grade point average with a 3.0 or For more information, or related programs. Human Services Peterson at 253.566.5388. contact Barbara 52 Professional/Technical Programs Asanadultreturningtoschoolaftermanyyearsinthework force, “ for acourserequiredbytheprogram. require astudenttoalterhisorherindividualplanofstudyinclude courseswhichpreparethestudent enrolling, thestudentshouldcontactProgramChairlistedwith each program.TheProgramChairmay certificate programs.Inthefollowingpagescourserequirements fortheprogramsarelisted.Before myself, arejugglingcareerandeducation.” to realizethattherearealotofpeopleonthis campuswho,like I havehadtolearnalotabouttimemanagement.wasshocked Tacoma CommunityCollegewelcomesinquiriesregardingitsmanyprofessional/technical degreeand Lisa Tinsley,DiagnosticMedicalSonographyProgramstudent Professional/Technical Programs 53 54 Professional/Technical Programs NOTE: StudentsmaysubstituteSPCH101, 110,120,or130. Fundamentals ofSpeechCommunication Career ReadinessSkills Business Correspondence Leadership &HumanRelations Business Mathematics Business English Introduction toBusiness Business andCommunicationCourses(31Credits) Editing &ProofreadingBusinessDocuments Access I Excell II Excel 1 Word I Computer andOfficeCourses(14Credits) 220, 230forACCNT140,141,142. No.Credits Course Note: Studentsmaysubstitute,withProgramChair’sapproval,ACCNT210, Work Internship Computer ApplicationsinAccountingII Computer ApplicationsinAccountingI Payroll andBusinessTaxes Practical ManagerialAccounting Practical AccountingII Practical AccountingI Accounting Courses(35Credits) Course Title Associate inAppliedSciencesdegree Automated AccountingApplications Accounting OfficeAssociateCertificate: Assistant BookkeepingClerkCertificate: Bookkeeping SystemsCertificate: Associate inAppliedSciencesdegree: accounting positions. accounts payable/accountsreceivableclerksandforentry-level integrated computerizedaccountingsystems. positions. Graduatesareespeciallywellpreparedtoworkwith prepares youforemploymentinawidevarietyofaccounting environments. prepare youforemploymentinavarietyofbusinessaccounting with aone-quartercertificatetotwo-yearassociate’sdegree,that Program Chair:AnnaleeRothenberg Applications Program Automated Accounting Records &DatabaseManagement Our certificateprogramsprepareyoutobebookkeepers, The two-yearAutomatedAccountingApplicationsprogram You canchoosefromfourprogressiveprograms,providingyou ...... U122 CU 102 ...... C 0*3 2 CU 203* ...... CU 103 ...... U10 2 CU 110* ...... U 2*EG 0*EG 0*5 BUS 225*/ENGL102*/ENGL103* ...... A45-creditprogram...... U 1 rMT 1*5 BUS 110orMATH111* U 0 rEG 0*5 BUS 100orENGL101* ...... Atwo-yearprogram...... A16-creditprogram. A31-creditprogram. CN 4*5 5 ACCNT 240* ACCNT 145* 5 ACCNT 141* CN 9*5 5 ACCNT 290* ACCNT 241* 5 ACCNT 142* 5 ACCNT 140 FC 0*2 OFFCE 105* FC 1*3 OFFCE 116* PH105 SPCH 100 253.566.5181 U 8 1 BUS 280 5 BUS 164 5 BUS 101 Course Title Course No.Credits Course Practical AccountingI Course Title Certificate Program Bookkeeping Systems completion ofthisprogram. NOTE: Demonstrationofkeyboardingand10-keyproficiencyarerequiredfor * Prerequisiterequired(seecoursedescription). From ACCNT,BUS,COMSK,IT,GBUSor Electives (10Credits) ENGL 91andREAD93.Assessmentabove orcompletionofMATH86. Also requiredforcompletionofthisprogram: Assessmentaboveorcompletionof * Prerequisiterequired(seecoursedescription). No.Credits Course Practical AccountingI Course Title Certificate Program Assistant BookkeepingClerk 142. NOTE: StudentsmaysubstituteACCNT210,220,230for140,141, * Prerequisiterequired(seecoursedescription). Electives: Excel II 2 Access I CU103 ...... Excel I Word I Career ReadinessSkills Leadership andHumanRelations Business Mathematics Business ...... English Practical AccountingII Records andDatabaseManagement 2 Excel II CU103 ...... Excel I Word I Career ReadinessSkills Business Math Practical AccountingII Choose oneofthefollowingthreecourses: ECON coursesapprovedbyProgramChair Records &DatabaseManagement OFFCE 105 .. Editing &ProofreadingBusinessDocuments Computer ApplicationsinAccountingI Payroll andBusinessTaxes Practical ManagerialAccounting Leadership &HumanRelations Federal IncomeTax Payroll andBusinessTaxes ...... U233 CU 203 ...... 2 CU 102 ...... U23 3 CU 203* ...... 2 CU 102 ...... U102 CU 110 ...... 10 ...... U 0 rEG 0 5 BUS 100orENGL101 ...... 5 ...... 10 ...... Total Credits:90 Total Credits:31 Total credits:45 ACCNT 145* CN 4*5 5 ACCNT 141* ACCNT 140 ACCNT 142* ACCNT 240* ACCNT 145* CN 4*5 5 ACCNT 141* ACCNT 140 ACCNT 250* OFFCE 116 FC 1 3 OFFCE 116 U 1 5 BUS 110 U 8 1 BUS 280 U 6 5 BUS 164 U 1 5 BUS 110 U 8 1 BUS 280 BUS 164 Professional/Technical Programs 55 ADJ 140ADJ 179 5 ADJ 200 2 5 ADJ 100ADJ 101 5 ADJ 102 5 ADJ 103 5 ADJ 105 2 ADJ 200 3 ADJ 104 5 ADJ 107 5 5 ADJ 201ADJ 202 5 ADJ 204 5 ADJ 205 3 ADJ 207* 3 ADJ 208* 5 ADJ 209 5 ADJ 211 2 ADJ 212 5 ADJ 213 3 ADJ 240 5 5 SOC 110 5 ENGL 101ENGL 102* 5 5 SPCH 100 5 POLSC 202 5 PSYCH 100 5 ...... 5 ...... 102 CU 2 ...... Total Degree Credits: 94 ...... MATH 107 or BUS 110 5 ...... 100 PE 2 ...... Natural Science any course listed for the Associate of Arts and Science Degree * Instructor permission required. Program Electives courses: Select a minimum of 10 credits from the following Introduction to Corrections Topics ...... Special Criminal Investigations Forensics Administration of Law & Justice of Law Administration degree Sciences in Applied Associate Course Title (35 credits) Core Requirements of Justice Intro to Administration Criminal Law Criminal Procedure and Evidence Community Policing Ethical Issues in Law Enforcement Criminal Investigation the Law Power, Multiculturalism and Juvenile Justice system Course No.Credits Requirements (49 credits) General Education transferable) (These courses are generally College Freshman Composition College Freshman Composition MS Word (or other approved computer course) Survey of Sociology General Psychology Fundamentals of Speech Communication Public Speech Communication ...... 101 SPCH American National Government and Politics Science (select one) 5 Total Fitness Math .... Police Leadership Juvenile Delinquency in America Crime and Justice in America Law Enforcement/Criminal Justice Internship I Law Enforcement/Criminal Justice Internship II De-escalation Techniques Police in America Law Enforcement Communication Prevention and Control of Delinquency Parole and Probation BUS 280 1 253.566.5076 OFFCE 116 3 ACCNT 140 5 Total Credits: 16 ...... 102 CU 2 ...... 203* CU 3 Requirements for the Certificate include a total of 35 credits The Administration of Law & Justice Certificate is designed to Assessed placement at college-level English and reading is Assessed placement at college-level English and General education courses are usually “distribution courses” and General education courses are usually “distribution Successful graduates may be eligible for criminal justice careers Successful graduates may be eligible for criminal The Administration of Law and Justice Program offers three The Administration of Law and Justice Program from core courses in the Administration of Law and Justice Program. The student may select a curriculum program to fit their own academic goals, but must take the eight core courses required for the AAS Degree. enhance the career potential of those planning to enter the profession or who are already employed with an agency. Flexible course times offer students a wide variety of options to work around their schedules. The Certificate curriculum can be directly applied toward completion of an Associate in Applied Science Degree in Administration of Justice. Certificate in Administration of Certificate in Administration Law & Justice required for most ADLJ courses. will normally transfer to all major baccalaureate institutions in will normally transfer to all major baccalaureate four-year institution Washington. Students wishing to transfer to a requirements should contact that institution to determine their when planning an academic schedule. in: law enforcement, municipal police and private police; parole, in: law enforcement, municipal police and private counseling and probation and counseling; juvenile justice, diversion, security, loss probation; court security and administration; private criminal prevention and private investigations; legal system, research and trial preparation. areas of concentration: law enforcement, juvenile justice, and areas of concentration: law enforcement, juvenile specifically paralegal/legal assistant. Each concentration is positions in each designed to introduce and prepare students for Program below). area. (A separate section is listed for the Paralegal Excel IExcel ...... 103 CU Excel II 2 Records and Database Management Program Chair: Career Readiness Skills Career Readiness Word I course description). * Prerequisite required (see of Law Administration Program and Justice Certificate Program Certificate Course Title I Practical Accounting Course No.Credits Accounting Office Associate Office Accounting 56 Professional/Technical Programs course tofulfilltherequirements. legal specialty,studentsmaychoose adifferentlegalspecialty must retakethecourseifitisrequired. Ifthecourseisanoptional program course.Ifthegradeearned islowerthana2.0,students Students mustearnaminimumof2.0GPA(“C”)ineachParalegal college-level EnglishandreadingisrequiredforallParalegalcourses. can becompletedinatwo-yearperiod.Assessedplacementat this program. encouraged totakeadvantageofthevariedlawcoursesofferedin for lawschool.Studentsinterestedinattendingschoolare may alsoparticipateinadministrativehearings. court hearingsandmediation,helpattorneysinlitigation.They They draftcorrespondenceandlegaldocuments,prepareclientsfor prepare probateinventories,andorganizeindexdocuments. research andinvestigations,interviewclientswitnesses, salaries andbenefitsaregood. for paralegalsinWashingtonStatecontinuestogrowandthe system, privateinvestigationfirm,andparalegalservices.Theneed office, legaldepartmentofacorporation,publicagency,court field, graduatesareeligibleforpositionsasaparalegalinlaw services underthesupervisionofanattorney.Inthisexcitingcareer to enterintothelegalservicesfieldasaspecialistbyproviding Program Advisor:JanetOlejar Associate inAppliedSciencesdegree Paralegal applicable totheirresidencystatus. Degree inAdministrationofJusticeasaconcentrationrequirement. 290, 5ofwhichcanapplytotheAssociateAppliedScience Training Commission. the Academyandreceivecertificatesofcompletionfrom in WashingtonState. program preparestherecruittofunctionasaReservePoliceOfficer Administration ofLawandJusticeSecretary253.566.5076.This completed. Anapplicationforadmissionwillbesentfromthe agency thatguaranteesthebackgroundinvestigationhasbeen requirements bypresentingaletterofsponsorshipfrompolice or springtermsbasedondemandandstudentsmustmeetadmission the eveningsandweekends.Theacademyisofferedinfalland/ Criminal JusticeTrainingCommission.Classesarenormallyheldin week, ReservePoliceAcademyapprovedbytheWashingtonState Academy Basic LawEnforcementReserve Paralegal coursesareavailableduring thedayandinevening. The ParalegalProgramconsistsof92creditsinstructionand This curriculumisalsoanexcellentprogramtopreparestudents Paralegals aretrainedtopreparelegaldocuments,conduct The two-yearParalegalProgramisdesignedtopreparestudents Out-of-state residentsmustpaytheprevailingenrollmentfees Students enrolledintheAcademyreceive18creditsforADJ Students sponsoredbylawenforcementagenciesmayenrollin The AdministrationofJusticeProgramoffersa220+hour,10- ...... 253.566.5053 Internship II Criminal ProcedureandEvidence Editing andProofreading Interviewing andInvestigation Multicultural CourseElective Commercial Transactions Business Organizations/Corporations Intellectual PropertyLaw(includese-commerce) Employment Law Environmental Law/LandUse Administrative Law Bankruptcy Law Real EstateLaw Alternative DisputeResolution(ADR) Probate/Estate Planning Family Law Litigation (torts/casemanagement) Legal SpecialtyElectiveCourses:(12credits) Health/Dealing withStress Internship I...... No.Credits Course Criminal Law Law OfficeManagement Civil Procedure Introduction toCivilLaw Legal ResearchandWritingII Legal ResearchandWritingI Paralegal FundamentalsandEthics Core Requirements(45credits): Course Title Recommended courseforenteringprogram:BUS100(BusinessEnglish). courses) orBusinessPCcourses;Typingat50wpmwithmaximum5errors. Prerequisites forInternship:ADJ150,CU105(orotherapprovedcomputer reading. Prerequisites forenteringprogram:Assessmentatcollege-levelEnglishand * Prerequisiterequired(seecoursedescription). Natural ScienceElective Political ScienceorHistoryElective Social ScienceElective Business Math(orothercollege-levelcourse) Speech Communications College FreshmanComposition General EducationRequirements(35credits) Transition Planning (any MulticulturalcourseontheA.A.distributionlist) (any naturalsciencecourseonA.A.distributionlist) ...... 5 ...... 5 ...... 5 ...... Total Credits:92 O/SC 5 SOC/PSYCH FC 0*2 OFFCE 105* PH105 SPCH 100 NL115 ENGL 101 U 1 5 BUS 110 D 3 3 ADJ 232 D 3*5 ADJ 234* D 0 5 ADJ 102 D 3 3 ADJ 231 5 ADJ 101 D 2 3 ADJ 229 3 ADJ 227 3 3 ADJ 225 ADJ 224 3 ADJ 222 5 ADJ 151 D 3 3 ADJ 230 3 ADJ 223 3 3 ADJ 221 ADJ 220 5 ADJ 233* 5 5 ADJ 154 5 ADJ 153 3 ADJ 152 ADJ 251* 5 ADJ 150 D 2 3 ADJ 228 3 ADJ 226 D 5 1 ADJ 155 D 3 1 ADJ 239 Professional/Technical Programs 57 BUS 245 5 BUS 265 5 BUS 260 5 BUS 270 5 BUS 167 5 BUS 240 5 BUS 164 5 BUS 101BUS 163 5 5 BUS 230 5 BUS 280 1 BUS 165BUS 255 5 5 GBUS 220 5 ACCNT 150*or Total Credits: 91 ...... SPCH 100 or 110* 5 ...... 105 or CU 202/203 5 ...... BUS 265 or BUS 200* 5 BUS 110 or BUS 265* 5 ...... BUS 225 or ENGL 102* 5 BUS 255 or GBUS 210 5 ECON 211 or ECON 200* 5 ...... ACCNT 140 or ACCNT 210* 5 ACCNT 220* or ACCNT 230* 5 ...... CU ...... Managing Diversity E-Business and Commerce E-Business and Commerce Business in a Changing World Retail and Professional Sales Entrepreneurship Small Business Entrepreneurship Required General Courses for AAS Degree (45 credits) Business English ...... ENGL 1001* BUS 100 or Business Correspondence 5 Accounting for Decision Makers General Economics * Generally transferable to baccalaureate institutions ** BUS 290 “Work Internship” may be substituted for one course in the three specialty areas subject to Program Chair approval. Business Management and Management Business Leadership Organizational in Applied Sciences degree Associate Course Title credits) Courses (31 Core Business to Business Introduction Organizational Systems Management Principles & Dynamics Work Teams and Organizational Responsibility Business Ethics and Corporate Development Marketing and Business Career Readiness Skills Introduction to Global Business Course No.Credits Courses (15 credits)** Specialty Business areas of specialization: Select one of the following Human Resource Leadership Leadership cnd Human Relations Personnel Management Managing Diversity Marketing and Customer Service Fundamentals of Speech Communication Business Math Practical Accounting Word I, Excel I, PowerPoint Choice of any 100/200 level 5-credit elective except BUS or SPCH 5 ADJ 151ADJ 251* 5 ADJ 152 3 ADJ 153 5 ADJ 154 5 ADJ 101 5 5 ADJ 239 1 ADJ 150 5 ADJ 232ADJ 233* 3 5 253.566.5321 Total Credits: 45 ADJ 220 - ADJ 231 3 ...... An Associate in Applied Sciences degree will be awarded to This two-year associate’s degree program prepares you for a This certificate is awarded to students who have completed an who have completed is awarded to students This certificate The Paralegal Certificate is designed for those who already Certificate is designed The Paralegal students successfully completing the 91-credit program. career as a business professional. With the ability to select specialties in Human Resource Leadership, Marketing and Customer Service, or Small Business Entrepreneurship, graduates are prepared for a multitude of first-entry supervisory, administrative or small business management positions. These specialties provide a unique business education experience in topics attuned to employer needs and workforce retraining. Program Chair: Christopher Gilbert * Prerequisite required (see course description). Business Management and Organizational Leadership Program Elective Choose one legal specialty course Legal Research and Writing II Introduction to Civil Law Civil Procedure Law Office Management Criminal Law Interviewing and Investigation Required Courses (45 credits) Paralegal Fundamentals and Ethics Course Title Course No.Credits Legal Research and Writing I Internship I Transition Planning AAS or a BA degree and 45 credits of paralegal classes as listed AAS or a BA degree and this program, students must show below. To graduate from of an AAS or a BA degree, proficiency in evidence of completion of 2.0 GPA (C) in each of the paralegal computer skills, a minimum of meeting related study requirements. courses, as well as evidence program should meet with an advisor Students interested in this For information please call Janet who can explain the requirements. Olejar at 253.566.5053. possess an Associate of Arts & Sciences or a Bachelor of Arts or a Bachelor of of Arts & Sciences possess an Associate in or if already employed to enter the profession degree and wish potential. to enhance their career the legal field, Certificate Program Certificate Paralegal 58 Professional/Technical Programs See Information Technology, page64. Developer Computer Application Accounting forDecisionMakers Practical Accounting Business inaChangingWorld Small BusinessEntrepreneurship Management Principles&OrganizationalSystems Entrepreneurship Global Marketing Business inaChangingWorld E-Business andCommerce Retail andProfessionalSales Introduction toBusiness Marketing andCustomerService Managing Diversity Personnel Management Leadership andHumanRelations Management Principles&OrganizationalSystems Introduction toBusiness Human ResourceLeadership No.Credits Course Select oneofthefollowingareasspecialization: Certificate SpecializationRequirements Any combinationofComputerUsercourses Career ReadinessSkills Marketing andBusinessDevelopment Business EthicsandCorporateResponsibility Work TeamsandOrganizationalDynamics Core CoursesRequiredforallCertificates Course Title complete 44creditsinthechosenarea. Management willbeawardedtostudentswhosuccessfully entrepreneurship. AcertificateinBusinessAdministrationand future, corporateethics,andconceptsofsmallbusiness diversity intheworkplace,technology’srolebusinessesof international business.Studentswillgainanunderstandingof administration andmanagement,humanresources,supervision, Coursework isdesignedtodevelopskillsinmarketing,business and lookingforprofessionaladvancementgrowthopportunities. individuals interestedinacareerbusinessorcurrentlyemployed techniques andprinciples.TheBAMCertificateisdesignedfor business instruction,concentratingoncurrentmanagement business andmanagerialoccupations.Itprovidesabroadbaseof offers coursesthathelpindividualsprepareforadvancementin Certificate Program Management Business Administrationand The BusinessAdministrationandManagement(BAM)Certificate ...... CN 4 rACT205 ACCNT 140or210 ...... C 3 CU ...... Total Credits:44 CN 5 5 ACCNT 150 BS205 GBUS 230 U 7 5 BUS 270 5 BUS 163 5 5 BUS 270 5 BUS 265 5 BUS 245 BUS 101 5 5 BUS 255 BUS 165 5 5 BUS 163 BUS 101 1 BUS 280 5 BUS 230 U 6 5 BUS 260 5 BUS 164 5 BUS 240 5 BUS 167 technical students.Formoreinformation,call253.566.5072. through anyoftheComputerUsercoursesdesignedfornon- Sciences orothernon-technicalprogramsmaylearncomputerskills Information Management.Inaddition,studentsintheArtsand Program, ComputerUserSpecialist,Engineering,andHealth Security, AutomatedAccountingApplications,OfficeProfessional Developer, WebGraphics,Electronics/WirelessEngineering& Network HardwareSupport,Administrator,Web including: InformationTechnology,ComputerApplicationDeveloper, offers completecoursesofstudyinseveralcomputer-relatedfields information technologyanditsapplicationtomanycareers.TCC Programs Computer Related See Electronics/WirelessEngineeringandSecurity,page60. Electronics Repair Computer Equipment/ Course Title Course No.Credits Course Leadership andHumanRelations Business Math Word, Excel,PowerPoint Introduction toWindowsandWWW Proficient LevelCertificate(16credits) Course Title advisable tocontactyouradvisorforassistancewiththisProgram. and obtainadegree,manyofthecreditsaretransferable.Itis placement testresults.Ifstudentswishtocontinuetheireducation program. Additionalcourseworkmayberequiredbasedon program coordinator’spermissionpriortoenrollmentintothe placement testinginreading,Englishandmathobtainthe certification exam.Potentialstudentsmustcompletecollege individual tositfortheMicrosoftOfficeUserSpecialist(MOUS) offered. TheComputerUserSpecialistProgramcanalsopreparethe trouble-shooting, aswellfundamentaladministrativeskillsare Center. Up-to-datecomputersoftwareapplications,someminor 45-credit certificateprogramofferedbyTCC’sGigHarbor/Peninsula allows studentstoachieveshort-termcertificatesonthepatha administrative settingswithinmanyjobmarkets.Theprogram Retraining programpreparingstudentstoworkinavarietyof Joyce Schultz Certificate Program Computer UserSpecialist Students atTacomaCommunityCollegereceivetrainingin The ComputerUserSpecialistProgramisdesignedasaWorker or PowerPoint or Excel1 or WordI ...... 2 CU 102 ...... C 0 2 CU 103 ...... C 0 1 CU 104 ...... U155 CU 105 ...... C 0 1 CU 100 ...... 253.851.2424 U 1*5 BUS 110* U 6 5 BUS 164 Professional/Technical Programs 59 DMS 250* 10 DMS 260* 2 DMS 220* 5 DMS 100* 4 DMS 130* 3 DMS 121*DMS 131* 5 3 DMS 111* 3 DMS 151* 5 DMS 123*DMS 152* 5 DMS 161* 8 2 DMS 251* 13 DMS 261* 2 DMS 252* 13 DMS 105*DMS 110* 4 3 DMS 120* 5 DMS 150* 2 DMS 122* 5 DMS 160* 2 DMS 270* 1 ENGL 101 6 PHYS 114 5 CHEM 100 5 PSYCH 100 5 ...... Total credits: 110 ...... BIOL 220 or 221 5 ...... 170** HT 5 ...... 105 CU 5 ...... SPCH 100, 101, 110, 120 or 130 5 ...... 130 HT 3 ...... Ultrasound Clinical VI Ultrasound Seminar and Critique III General Psychology Speech Communication .... Computer User or other approved CU course Medical Terminology Precalculus I: College Algebra ...... 115 MATH Introduction to Chemistry Anatomy and Physiology 5 General Physics Fourth Quarter (Summer) Obstetrical Scanning and Techniques Fifth Quarter (Fall) Intro. to Vascular Sonography & Echocardiography Sixth Quarter (Winter) Ultrasound Clinical V Seventh Quarter (Spring) Ultrasound Clinical VI * Requires prerequisite or instructor permission. ** Must be taken the summer before enetering the program. Prerequisites: The following courses must be completed before entering the Diagnostic Medical Sonography program. College Freshman Composition Diagnostic Medical Sonography Medical Diagnostic degree Sciences in Applied Associate Course TitleQuarter Summer Care to Fundamentals of Patient Introduction (Fall) First Quarter Medical Sonography Introduction to Diagnostic Anatomy Ultrasound Cross-Sectional Pathophysiology I I Ultrasound Physics & Instrumentation Second Quarter (Winter) Course No.Credits Techniques Abdominal Scanning and Techniques Small Parts Scanning and II Ultrasound Physics & Instrumentation Ultrasound Clinical I ..... Third Quarter (Spring) Pathophysiology II Gynecological & First Trimester Scanning & Tech. Ultrasound Clinical II Ultrasound Seminar and Critique I Ultrasound Clinical III Ultrasound Seminar and Critique II Ultrasound Seminar and Critique IV Ultrasound Registry Review Seminar BUS 225* 5 253.566.5135 see below 2 see below 6 SPCH 100 5 ACCT 140ACCT 141 5 5 OFFCE 106* 2 Total Credits: 45 ...... 130* CU 3 ...... 091 CU 2 ...... 215* CU 1 ...... 115* CU 1 ...... 210* CU 3 ...... 110* CU 2 ...... 202* CU 3 ...... 203* CU 3 A separate application to the Diagnostic Medical Sonography Upon successful completion of this program, graduates are The Diagnostic Medical Sonography program leads to an The Diagnostic Medical Sonography program Business Correspondence MOUS Prep I MOUS Prep II program is required and may be obtained at the Health, Justice and Human Services Office, Bldg. 19, room 70 or by calling 253.566.5113. eligible to take the certifying examinations of the American Registry of Diagnostic Medical Sonographers in the specialty areas of ultrasound physics and instrumentation, abdomen and obstetrics-gynecology. Positions often are available in hospital ultrasound departments, clinics and private physicians’ offices. Associate of Applied Sciences degree. The program is Associate of Applied Sciences degree. The program time. Students 18-21 calendar months in duration and is full campus and complete classroom and laboratory work on the Students clinical education in an affiliated ultrasound department. clinical patient acquire skills in reviewing and recording pertinent providing for the history, performing the sonographic examination, examination and comforts and needs of the patient during the data for recording the anatomic, pathologic and physiologic interpretation by the supervising physician. Thoroughness, accuracy and empathy are traits needed by persons interested in this program. They should also be versatile and able to follow precise and detailed directions. Program Chair: Rachel Kendoll Diagnostic Medical Sonography Program * Requires prerequisite or instructor permission. Elective(s) (8 credits) Recommended Electives Accounting I Accounting II Quickbooks Accounting on Computers: Keyboarding Basics Typing: Speed and Accuracy English ...... BUS 100* ENGL 101 or Elective(s) 5 Access II Communication Fundamentals of Speech Word II Excel II Certificate (45 credits) Program Expert Level Certificate (31 credits) Level Certificate Expert I Access 60 Professional/Technical Programs Peripherals andCommunications Microprocessors Pre-Calc I/CollegeAlgebra Third Quarter No.Credits Course Schematics Digital Techniques Leadership &HumanRelations Second Quarter Electronic Devices&Systems Fundamentals ofElectricity&Electronics ...... English First Quarter Course Title One YearCertificateProgram and Security Electronics/Wireless Engineering remaining coursework. Security willbeawardeduponsatisfactorycompletionofthe Applied SciencesdegreeinElectronics/WirelessEngineeringand complete thefirstyearofprogram.AnAssociatein fundamentals andapplicationsincludingcryptologictheory. theory, repair,installationandtesting;security including radiofrequencyequipmentandtheory;electronics cellular industries.Theprogramteachesthelatesttechnologies current technologiesusedinthewireless/fixedbroadband/ program, intendedtobeintroducedFall2003,reflectsthe Contact: TimMason (Formerly ComputerEquipment/ElectronicsRepair) Engineering andSecurity Electronics/Wireless See ParaeducatorProgram,page73. Paraprofessional Educational A certificatewillbeawardedtostudentswhosuccessfully The newElectronic/WirelessEngineeringandSecurity ...... Total CertificateCredits:45 U 0 rEG 0 5 BUS 100orENGL101 ...... AH155 MATH 115 LC165 ELEC 106 LC105 5 ELEC 110 ELEC 109 5 5 ELEC 108 ELEC 107 5 ELEC 104 253.566.5286 U 6 5 BUS 164 *Prerequisite required(seecoursedescription). Engineering Physics Sixth Quarter Principles ofWirelessNetworks No.Credits Course or IntroductiontoSpeech Public Speaking Calculus I Fifth Quarter Wireless (RadioFrequency)Theory Pre-Calc II/Trigonometry Fourth Quarter Course Title Associate inAppliedSciencesdegree and Security Electronics/Wireless Engineering Course Title Course No.Credits Course 5 Medical Terminology BIOL 118 ...... Human Anatomy&Physiology First Quarter(Summer) Course Title Certificate Program Paramedic Education details, orcallformoreinformation. admission. Seethedescriptionsofcoursesinwhichyouareinterestedfor * AllEMCcoursesrequirethatanapplicationprocessbecompletedpriorto services, hospitalsorambulancecompanies. physician whileinthefield,andaretypicallyemployedbyfire Paramedics serveastheeyes,earsandhandsofanemergency field experience,andwishtocontinuetheireducationinthefield. have completedEMT-Btraining,aminimumofoneyear or StateofWashingtoncertifiedEMT-B’s. 112-hour course,studentsmaybecomenationallyregisteredand/ level forstudentspursuingcareersintheEMSfield.After opportunities intheemergencymedicalservicesfield. from Basic-EMT-BtoParamedicprogramsandprovidecontinuing education andtrainingprogramsatseverallevels.Theyrange Program Chair:MikeSmith Health ServicesProgram Emergency Medicaland Wireless Security&EncryptionFundamentals Radio WaveModulationandSignalPropagation Wireless (RadioFrequency)SecurityFundamentals The Paramediceducationprogramisdesignedforstudentswho Emergency MedicalTechnician-Basicisthefirstcertification Tacoma CommunityCollegeoffersemergencymedicalservices ...... Additional creditsforAssociatedegree:45 ...... T103 HT 130 ...... PH11o PH105 SPCH 101or100 ...... AH14 5 MATH 124* AH16 5 MATH 116* HS11 5 PHYS 121* LC265 ELEC 216 LC225 ELEC 212 LC285 ELEC 218 LC205 ELEC 220 LC245 ELEC 214 253.566.5220 Professional/Technical Programs 61 BUS 280 1 BUS 101BUS 163 5 BUS 240 5 5 BUS 110 5 BUS 164 5-8 ECON 211 5 GBUS 220GBUS 230 5 GBUS 240 5 5 GBUS 210 5 ACCNT 150 5 ...... SPCH 100/101 5 Total Credits: 90-94 GBUS 290*/299* 5 BUS 100*/ENGL 101* 5 ...... ACCNT 140/ACCNT 210* 5 ...... BUS 225/or ENGL 102*/103* 5 ...... 5-8 ...... 105 CU 1-5 ...... Individual Study in Business College Freshman Composition .. or Accounting Principles Students may substitute: SPCH 110, 120, or 130 Students may substitute: MATH 107, 108, 111 or BUS 256. Students may substitute: one of these courses (BUS 167 or 255, PSYCH 100, SMG 264*, SPCH 110 AND one of these courses (HSP 270*, SMG 101,131,261*) Students may substitute: CU 102, 103, or 104. The program is designed for people interested in a career that in a career people interested for is designed The program this Global Business Program should Students interested in Introduction to Global Business Global Marketing Global Trade & Transportation Career Readiness Skills Work Internship/or Electives (5 to 8 credits) *Prerequisite required (see course description). See also the International Business Program, (page 33) to earn an Associate in Arts & Sciences - Option B degree for transfer to UW Tacoma. Students must take Bus 101 and/or Bus 163 during their first quarter and must Students must take Bus 101 and/or Bus 163 during their complete both by their third quarter in the program. Global Business (26 credits) Cultural Aspects of Global Business Related Studies (26 - 33 credits) Business English/or Business Correspondence Global Business Sciences degree Associate in Applied Course TitleFunctional Areas of Business (30 credits) Introduction to Business Management Principles & Organizational Systems Marketing & Business Development Practical Accounting I General Economics . Course No.Credits Fund of Speech Comm/or Public Speaking Business Mathematics Leadership & Human Relations Word I, Excel I, PowerPoint would benefit from an understanding of both (a) key business both (a) key of an understanding benefit from would well as organizations, as performed in business functions normally that conduct concepts used by organizations (b) tools and the fundamentals of Students will learn business globally. financial decision making, management, accounting, marketing, context. In addition, students in a global business and economics of a broad set of global business skills will gain an understanding and cultural competencies. or 253.566.5257. An contact Jim Wiek at [email protected] degree will be awarded to students Associate in Applied Sciences the curriculum listed below. who successfully complete Accounting For Decision Makers BUS 110 5 SOC 110SOC 152 5 SOC 240 5 BUS 163 5 BUS 164 5 253.566.5257 EMC 200* 2 EMC 122* 5 EMC 118EMC 120* 4 12 EMC 130* 4 EMC 121* 12 EMC 131* 7 EMC 132* 9 ENGL 101 5 SPCH 101 5 SPCH 100 5 MATH 107 5 PSYCH 100 5 Total Credits: 65 ...... Total Degree Credits: 103 - 107 ...... 200 PE 2 ...... CU 1-5 ...... 100 PE 2 OR Marriage & The Family OR Social Psychology OR Leadership and Human Relations See list of approved CU courses. OR Fundamentals of Speech Communication This program offers professional/technical training to help individuals prepare for advancement in business and managerial occupations in which knowledge of global business concepts will be helpful to the individual and the employing organization. Global Business Program Program Chair: Jim Wiek See Office Professional, page 71. General Office Assistant *Prerequisite required (see course description). Additional or alternative courses *Prerequisite required (see course description). Additional subject to approval of Program Chair. The EMT-Paramedic program is accredited by the Committee on Accreditation of Educational Programs for the EMS Professions (CoAEMSP), a specialized accrediting board, in collaboration with the Commission on Accreditation of Allied Health Education Programs (CAAHEP) and recognized by the Council for Higher Education Accreditation and/or the US Department of Education. General Psychology Business Math Second Year Required Courses (37-40 credits): Second Year Required Courses (37-40 Contemporary Issues in Pre-Hospital Care Associate in Applied Sciences degree Course Title Course No.Credits Emergency Medical & Health Emergency Medical Services Paramedic (didactic) III Paramedic Clinical III College Freshman Composition OR Math: A Practical Art Select one from each of the following areas: Survey of Sociology Principles of Management Computer Course Public Speech Communications Fourth Quarter (Spring) Third Quarter (Winter) Third Quarter II Paramedic (didactic) Second Quarter (Fall) Quarter Second & Prevention EMS Wellness (didactic) Paramedic I IParamedic Clinical ...... Total Fitness Paramedic Clinical II Advanced Total Fitness 62 Professional/Technical Programs Pharmacology forHealthProfessionals Speech Communications Word I,ExcelPowerPoint Medical TerminologyII No.Credits Course Second Quarter(Winter) English Composition Health CareDeliverySystems ...... Medical TerminologyI Anatomy andPhysiology First Quarter(Fall) First Year Course Title Associate inAppliedSciencesdegree Program Health InformationTechnology higher inallclasses: must completethefollowingcurriculumwithagradeof“C”or instructor’s permission. courses areonlyopenforacceptedprogramstudentsorby are opentoallqualifiedstudents,whilethe200levelHIM the AlliedHealthOfficeinBldg.19,room70.Firstyearclasses recognized bytheCouncilforHigherEducationAccreditation. cooperation withAHIMA’sCouncilonAccreditation.CAAHEPis Accreditation ofAlliedHealthEducationPrograms(CAAHEP)in nationally byallhealthcareinstitutions. Technician (RHIT)credentialsfromAHIMA,whicharerecognized exam, graduateswillreceivetheRegisteredHealthInformation Information ManagementAssociation(AHIMA).Uponpassingthis Management TechnicianssponsoredbytheAmericanHealth requirements. NationalRegistrationExamforHealthInformation with theadministrative,legal,accreditationandregulatory storage andretrievalsystems;preparinghealthdataconsistent coding andindexingdiseasesoperations,maintainingrecord performing qualityassessmentandutilizationreviewfunctions, a workingknowledgeofcomputersystemsinhealthcare, analyzing healthrecords,compilingandutilizingstatistics, federal healthagencies.Skillstaughtincludeorganizingand health carefacilities,skillednursingandstateor prepare graduatesforemploymentinhospitals,ambulatory combination ofmedicalknowledgeandbusinessapplicationsto 253.566.5179 ... Program Chair:IngridBentzen,RHIA,CCS Technology Program Health Information Graduates oftheHealthInformationTechnologyProgram The programrequiresaseparateapplicationprocessthrough The programisaccreditedbytheCommissionon The HealthInformationTechnologyProgramprovidesa (ENGLISH 100fulfillsrequirement) (BIOL 220,221fulfillsrequirement) ...... H 3*5 HT 131* ...... 5 BIOL 118 ...... U155 CU 105 ...... T104 HT 110 ...... T103 HT 130 ...... H 5*2 HT 150* ...... PH105 SPCH 100 NL115 ENGL 101 Medical ReimbursementManagement Clinical ApplicationsIII Health RecordsinAlternateCareSettings Sixth Quarter(Spring) Clinical ApplicationsII Fifth Quarter(Winter) ICD-9-CM Coding Fourth Quarter(Fall) Second Year Introduction toAccess Principles ofDisease Clinical ApplicationsI Introduction toHealthRecordManagement Business Math Third Quarter(Spring) college-level readingandEnglish,as well asMATH86isrequired. the AlliedHealthOfficeinBldg.19, room 70.Assessedplacementat basis. Studentsmustcompleteaseparate applicationprocessthrough test afterthreeyearsworkexperience. holders taketheCCAexamupongraduation,andCCSorCCS-P Information ManagementAssociationrecommendsthatcertificate Information ManagementAssociation(AHIMA).TheAmericanHealth Physician’s Office(CCS-P)administeredbytheAmericanHealth Certified CodingSpecialist(CCS)and/orSpecialist- national examstobecomeaCertifiedCodingAssistant(CCA), a CertificateofCompletion.holdersareeligibletotakethe Procedural Terminology). of Diseases,9thEdition,ClinicalModification),andCPT(Current coding methodologiessuchasICD-9-CM(InternationalClassification skills inclassifyingmedicaldatafrompatientrecordsusingvarious other healthcarebusinesses).Graduateswillpossessprofessional in avarietyofhealthcaresettings(hospitals,ambulatorycare,and program thatpreparesstudentsforemploymentasentry-levelcoders 253.566.5179 ... Program Chair:IngridBentzen,RHIA,CCS Certificate Program Coding Specialist Health Information AHIMA’s websiteatwww.ahima.orgforlistingsandinformation. Many collegesanduniversitiesofferbaccalaureateprogramsinthisfield.See Health InformationManagement CPT Coding Data QualityStandardsandStatistics Behavioral ScienceElective Legal ConceptsfortheHealthField HIM ClinicalLab Open enrollmentandapplicationsare acceptedonanongoing Upon successfulcompletionoftheprogramgraduateswillreceive The HealthInformationCodingSpecialistisaone-yearcertificate ...... H 1*5 HT 216* ...... T20 5 HT 210* ...... 2 CU 110 ...... 5 ...... H 2*3 HT 225* ...... Total DegreeCredits:101 ...... U 1 5 BUS 110 I 5*3 HIM 252* 5 HIM 180* I 3*6 3 HIM 232* HIM 222* 2 HIM 190* I 2*5 HIM 220* I 3*5 HIM 231* I 4*5 HIM 241* 3 HIM 230* I 4*3 HIM 242* Professional/Technical Programs 63 HSP 192 5 HSP 103 5 HSP 105 5 HSP 191HSP 200 4 5 HSP 112 5 HSP 106HSP 207 5 5 HSP 261 5 253.566.5076 ENGL 101 5 > continued, next page ...... 102 CU 2 ...... HSP*** 5 The Human Services Program is a competency-based program Services Program is a competency-based The Human progressive; The structure of the Human Services program is Fourth Quarter Clinical Practicum II MS Word (or other approved computer course) College Freshman Composition Specialty Course Case Aide Certificate Course TitleFirst Quarter Introduction to Human Services ...... 100 HSP Therapeutic Approaches & Techniques 5 Case Aid Certificate. You have completed the educational requirements for a Human Services Certificate Second Quarter Leadership, Ethics & Development Course No.Credits at this point. You may choose to apply to the State for Counselor Registration Third Quarter Clinical Practicum I After completing the nine courses outlined above, you may apply for a Certificate of Completion in Human Services. The academic competencies outlined by the State for Chemical Dependency Professionals have also been completed. Human Services Associate in Applied Sciences degree Human Services Program Services Human Jim Carroll Chair: Program and as practitioners in social train students for work designed to offers a 3-tier certification agencies. The program health service three- Case Aide certificate; a (15 credits) process: a one-quarter Services certificate; and a two-year quarter (44 credits) Human (AAS) degree in Human Services. To Associate in Applied Sciences must be assessed at the English 101 enter the program, students instrument. All students must level by the college assessment (clinical practicum) in community successfully complete internships in order to qualify for either the Certificate agencies of their choice AAS degree. Acceptance to the program is in Human Services or the college assessment, orientation, and a based on participation in Students must be ready for English program information session. 101 to enter the program. reason, the courses leading to three levels of achievement. For this outlined below should be taken in order. Case Management & Systems Advanced Helping Strategies Behavioral Health & Wellness Pharmacology & Survey of Chemical Dependency Understanding Diversity BIO 118 5 possess the possess 130/131* 3/5 137/138 5/3 HIM 180 5 HIM 220 5 HIM 252 3 140*/141*/142* 3/3/3 ...... 170 HT ...... 188 HT 5 5 ...... ENGL 101 or ENGL 100 5 ...... 150 HT 2 ...... 150* HT 2 ...... HT ...... Total Certificate Credits: 57 ...... 120* HT 5 ...... 215 HT 2 ...... 215* HT 2 ...... 130 HT 3 English language and language and English ...... 225* HT 3 ...... 110 HT 4 ...... 110 HT 4 ...... 105 CU 5 ...... 214* HT 2 ...... 131 HT 5 ...... HT ...... HT ...... 210 HT 5 ...... 210 HT 5 ...... 250 HT 3 ...... 216 HT 5 ...... 216* HT 5 Health Technology cluster courses are basic requirements for Health Technology cluster courses are basic requirements Medical/Dental Office management Health Care Delivery Systems Medical Terminology Course Title Course No. Credit several of the Allied Health professional/technical programs. several of the Allied Health professional/technical field but However, students interested in the health care for these courses. undecided as to a specific program, may enroll recommended for a Enrollment in any of the following courses is health care. student wishing to gain knowledge related to to a certificate. Completion of these courses alone does not lead For more Admission to a specific program is not a requirement. information, call 253.566.5179. Or online courses ...... Medical Transcription Health Technology Courses Principles of Disease Management Introduction to Health Record Professionals Pharmacology for Health ICD-9-CM Coding CPT Coding Management Medical Reimbursement Clinical for HICS Pharmacology For Health Professionals Introduction to Fundamentals of Patient Care Survey of Chemistry, Microbiology & Physics Principles of Disease Legal Concepts for Health Field CPT Coding Advanced ICD-9-CM & CPT Coding Advanced ICD-9-CM & CPT English Composition Course TitleDelivery Systems Health Care IMedical Terminology ...... Medical Terminology II Anatomy & Physiology Course No.Credits Basic ICD-9-CM Coding Advanced ICD-9-CM & CPT Coding Applicants must be fluent in the fluent in the must be Applicants Word I, Excel I, PowerPoint physical and emotional ability to complete the program. Graduates the program. to complete ability and emotional physical with a the following curriculum Program must complete of the HICS or higher in all classes. grade of “C” 64 Professional/Technical Programs their choice. confer withtheiradvisorinadditiontothe4-yearinstitutionof Transferability Certification. Seeyouradvisorfordetails. educational competenciesforChemicalDependencyProfessional Chemical Dependency schedule forthecurrentoffering. at www.tacoma.ctc.edu/start.shtm.Checkthequarterlyclass 253.566.5076 orlookusupontheInternetforfurtherinformation meet theneedsofindividualstudents.ContactHSPofficeat during thelastthreequartersofprogram. See youradvisorfordetails.Specialtycoursesaregenerallytaken of Justiceprogram,HumanDevelopmentand/orBehavioralScience. specialty coursesfromtheHumanServiceprogram,Administration select 10creditsofrelatedelectivecourses.Studentsmay Sciences degree(alongwiththeHumanServicesprogram)must Special Courses Advanced CaseManagement Program PlanningandGrantWriting Advanced PreventionStrategies Substance AbusePrevention goals. Students areencouragedtoselecttwothatfitchosencareerandacademic Some SpecialtyCoursesare: study * Ifyouneedremedialmathcourses,planthoseintoyourlastthreequartersof Math Introduction toSociology Specialty Course Sixth Quarter Introduction toPsychology College FreshmanComposition ...... Clinical PracticumIII Fifth Quarter Students desiringtotransfera4-yearinstitutionshould The HumanServicescurriculum(44credits)meetsthe Continued academicadvisingisprovidedtoadjusttheprogram Each studentcompletingtheAppliedSciencesdegreeorArtsand ...... S * 5 HSP *** ...... BS10O AH175 *BUS 110ORMATH107 Total DegreeCredits:91 SC 0 5 PSYCH 100 NL125 ENGL 102 O 1 5 SOC 110 S 1 5 5 HSP 212 5 HSP 208 5 HSP 206 HSP 205 5 HSP 193 any certificate. Associate ofAppliedSciencesdegreeinInformationTechnologyor must becompletedwithagradeof“C”orhighertoqualifyforthe cate programs,studentsmustmeetthefollowingrequirements: Prerequisites: (Bldg. 9,253.566.5072),seeourwebsiteat: tion inquiriesshouldbeaddressedtotheBusinessDivisionOffice Washington-Tacoma. Computing andSoftwareSystemsprogramattheUniversityof transfer option)allowsstudentstodirectlythe Application DeveloperAssociateinAppliedScience(UWTCSS Support, WebDevelopment,andGraphics.Inaddition,the are alsoavailableinNetworkAdministration,Hardware complete thetwo-yearprogram.Nine-monthcertificateprograms Sciences degreeisawardedtostudentswhosuccessfully positions ineachareaofspecialization.TheAssociateApplied skills. Advancedcourseworkpreparesstudentsforentry-level concepts alongwithrelatedbusiness,office,andcommunication technical corecoursesprovidefundamentalcomputerandsystem Development, andWebGraphics.Aseriesofnon-technical Hardware Support,ComputerApplicationDeveloper,Web careers inseveralareas:NetworkAdministration, Program Chair:ErikaBowles (formerly ComputerInformationManagementSystems) Technology Program Information Employability Skills fortheITIndustry Career ReadinessSkills Fundamentals ofSpeechCommunications Math: APracticalArt Business English Leadership andHumanRelations Introduction toBusiness Non-Technical Courses(27credits) Core Requirements Associate inAppliedSciencesdegree Information Technology Academic performancerequirement:Allprogramcoursework All ITprogramsrequireaseparateapplicationprocess.Applica- The InformationTechnologyProgramspreparestudentsfor Assessmentatcollege-levelinReadingORCompletionof > Assessmentatcollege-levelinEnglishORCompletionof > AssessmentatMATH90ORCompletionof 88witha > OR SmallGroupCommunication OR CollegeFreshmanComposition ... OR PracticalAccounting Reading 93withagradeof“C”orhigher. ENGL 91withagradeof“C”orhigherAND grade of“C”orhigherAND www.tacomacommunitycollege.com/inst_dept/it/ ToentertheAASdegreeprogramsoranyofcertifi- ...... I 9*1 IT 291* ...... U 0 rACT105 BUS 101orACCNT140 ...... PH10o 2 5 SPCH 100or120 NL10o 0 5 ENGL 100or101 AH175 MATH 107 253.566.5253 U 8 1 BUS 280 U 6 5 BUS 164 Professional/Technical Programs 65 ...... 5 BUS 101 5 ENGL 101ENGL 102* 5 5 PHYS 121* 5 SPCH 110 5 MATH 124** 5 MATH 108* 5 Total Credits: 92 238* or 240* 5 239* or 241* 5 242*/CS 142* 5 > continued, next page ..... IT ...... 235 IT 5 ...... 201* IT 5 ...... 201* IT 5 ...... 255* IT 5 ...... 105 CU 5 ...... 247* IT 5 ...... 251* IT 5 ...... IT ...... 110* IT 5 ...... 257* IT 5 ...... 254* IT 5 ...... 244* IT 5 ...... IT ...... 242* IT 5 ...... IT 102, IT 244, IT 245, Art 102, Bus 240, IT 290 IT 102, IT 244, IT 245, Art The Application Developer, UWT CSS transfer option of the The Application Developer, programming, The program focuses on fundamental computer College Freshman Composition Calculus I Introduction to Statistics Engineering Physics Multicultural Communication Introduction to Business Transferable Gen-Ed requirements (35 credits) Transferable Gen-Ed requirements (35 College Freshman Composition IT Core Requirements (40 credits) Introduction to Information Technology Web Developer (45 credits) Web Developer to Programming Introduction (or C++) Visual Basic C++) Basic (or Advanced Advanced Visual Developer Computer Application Option UWT CSS Transfer (IT) Program allows students to obtain a Information Technology that will competency based professional/technical degree (UWT) transfer to the University of Washington-Tacoma Students who Computing and Software Systems (CSS) program. jobs in the complete this degree are prepared to seek entry-level immediately or Information Technology field, as well as transfer program at the UWT in the future to a Bachelor of Science degree Technology Institute. related quantitative database, and systems concepts along with prepares and communication skills. Advanced coursework students for entry-level positions as a Programmer/Analyst, The Applications Developer, or Database Administrator. courses of additional math, physics, programming and business to UWT. the program prepare the student for transfer Word I, Excel I, PowerPoint Operating Systems I Introduction to Programming Database Systems Systems Analysis & Design Java Programming Java Programming for Engineers & Scientists .. IT 243*/CS143* 5 Java Programming Applications Web Graphics Web Development ... Advanced Web Development Server Data Access from the following: Electives: Choose 5 IT credits .... 270* IT 5 ...... 260* IT 5 ...... 260* IT 5 ...... 270* IT 5 Total Credits: 92 Total Credits: 95 Total Credits: 95 290* or 262* 5 290* or 265* 5 ...... 5 ..... IT ...... 279* IT 5 ...... 262* IT 5 ...... 271* IT 5 ...... 235 IT 5 ...... 110* IT 5 ...... 261* IT 5 ...... 261* IT 5 ...... 267* IT 5 ...... 239* IT 5 ...... 202* IT 5 ...... 102* IT 5 ...... 102* IT 5 ...... 245* IT 5 ...... 201* IT 5 ...... 238* IT 5 ...... 105* CU 5 ...... 247* IT 5 ...... IT ...... 210* IT 5 ...... 210* IT 5 ...... 244* IT 5 ...... 242* IT 5 ...... 105 ENG 3 ...... 105 ENG 3 ...... 241* IT 5 IT 102, IT 254, IT 255, IT 257, IT 290 OR Administration of Novell Networks Windows Networks Java Programming Database Systems Advanced Database Systems Introduction to Visual Basic Advanced Visual Basic ...... C++ ...... 240* IT Advanced C++ 5 Electives: Choose 5 IT credits from the following: Introduction to Programming Computer Application Developer (45 credits) Network Hardware Support (48 credits) Technical Writing Microcomputer Fundamentals Mobile Computing Fundamentals Operating Systems II Client/Server Technology I - LANs (formerly IT 253) Administration of Windows Networks Administration of Windows Networks Technical Support of Windows II - WANs Client/Server Technology (formerly IT 264)..Advanced Network OS Technologies IT 269*Service and Support Fundamentals (formerly IT 263) 5 Work Internship Administration of Windows Networks Service and Support Fundamentals (formerly IT263) Network Hardware Service and Support Advanced Network Hardware Technologies Work Internship OR Technical Support of Network Administrator (48 credits) Network Administrator Technical Writing Program Specialization Requirements Program of specialization) of the following areas (select one Microcomputer Fundamentals Operating Systems II I - LANs (formerly IT 253) Client/Server Technology Technical Core Courses (20 credits) Courses (20 Core Technical Excel I, Powerpoint Word I, Introduction to Information Technology Introduction Operating Systems I (formerly IT 250) Operating Systems & Design System Analysis 66 Professional/Technical Programs Leadership andHumanRelations Administration ofWindowsNetworks Client/Server TechnologyI-LANs(formerly IT253) First Quarter(15credits) tor CertificateProgram: following technicalrequirementstoentertheNetworkAdministra- the InformationTechnologyProgram,studentsmustmeet Technical Prerequisites: and throughotheravailableprogramsatTCC. Further trainingmaybeobtainedthroughjobexperience,self-study required foraMicrosoftCertifiedSystemsEngineercertification. study andtraining,thestudentcansitforremainingexams 2000 ServerandtheCompTIANetwork+technician.Withfurther exam tobecomeaMicrosoftCertifiedProfessionalforWindows technology coursesoffertheopportunitytogainskillssitfor operating systemsisusedasaplatformofinstruction.The others tousetheresourcesofanetwork.TheMicrosoftsuite communicate withothers,workinateamenvironment,andtrain problems. Inadditiontotechnicalskills,thestudentlearns and software,totroubleshootsystemconfiguration manage IBM-compatiblepersonalcomputersandnetworkhardware successive quarters.Studentsaretrainedtodesign,install,and course sequencebeginsinFallQuartereachyearandlastsforthree business environmentasanetworkadministrator.Theprogram technical andnon-technicalskillsneededtobesuccessfulina Network AdministratorCertificate ** RequiresMATH115and116asprerequisites. * Prerequisiterequired(seecoursedescription). Select onefromthefollowingcourses Advanced DatabaseSystems 5 Advanced C++ IT 240* ...... C++ ...... Advanced VisualBasic Visual Basic Required IT ConcentrationRequirements(30credits) This 45-creditcertificateprogramfocusesondevelopingthe CompletionofCU105withagrade“B”higher,or > >Completion ofIT235withagrade“B”orhigher. >Passing scoreontheA+OSTechnologiesExamOR PassingscoreontheA+CoreHardwareExamOR > Work Internship Client/Server TechnologyI-LANs Microcomputer Fundamentals Server DataAccess Advanced WebDevelopment Web Development proven competencyinWord,Excel and PowerPoint. Completion ofIT110withagrade“B”orhigher,AND Completion ofIT102withagrade“B”orhigher,AND ...... I 3*5 IT 238* ...... T21 5 IT 241* ...... IT 290* ...... IT 254* ...... IT 257* ...... Inadditiontotheprerequisitesenter ...... T25 5 IT 245* ...... IT 255* ...... IT 102* ...... T29 5 IT 239* ...... T21 5 IT 261* ...... IT 260* ...... 5 ...... Total Credits:105 ...I 6*5 IT 260* ...... U 6 5 BUS 164 Certificate Program: technical requirementstoentertheNetworkHardwareSupport Information TechnologyProgram,studentsmustmeetthefollowing Technical Prerequisites: and throughotheravailableprogramsatTCC. Further trainingmaybeobtainedthroughjobexperience,self-study certification oraMicrosoftCertifiedSystemsEngineercertification. the examsrequiredforaCiscoCertifiedNetworkProfessional technician. Withfurtherstudyandtraining,thestudentcansitfor Cisco CertifiedNetworkAssociateandtheCompTIA+ offer theopportunitytogainskillssitforexambecomea the resourcesofanetwork.Thetechnologycoursesinprogram with others,workinateamenvironment,andtrainotherstouse In additiontotechnicalskills,thestudentlearnscommunicate hardware, andtotroubleshootsystemconfigurationproblems. compatible personalcomputernetworkclientsandinternetworking Students aretrainedtoinstall,configureandmanageIBM- in SpringQuartereachyearandlastsforthreesuccessivequarters. and internetworkinghardware.Theprogramcoursesequencebegins business environmentasahardwaretechnicianforclient,server, technical andnon-technicalskillsneededtobesuccessfulina Certificate Network HardwareSupport Work Internship(orelectivecredit) Service andSupportFundamentals(formerlyIT263) Client/Server TechnologyII-WANs Third Quarter(15credits) Technical Writing Career ReadinessSkills Employability SkillsfortheITIndustry Technical SupportofWindowsNetworks System AnalysisandDesign Second Quarter(15credits) Leadership andHumanRelations Administration ofWindowsNetworks Client/Server TechnologyI-LANs(formerlyIT253) First Quarter(15credits) This 45-creditcertificateprogramfocusesondevelopingthe CompletionofCU105withagrade“B”orhigher, > CompletionofIT235withagrade“B”orhigher. > Passingscoreon theA+OSTechnologiesExamOR > PassingscoreontheA+CoreHardwareExamOR > demonstrated competencyinWord,ExcelandPowerPoint. Completion ofIT110withagrade“B”orhigher,AND Completion ofIT102withagrade“B”orhigher,AND ...... Inadditiontotheprerequisitesenter ...... T27 5 IT 247* ...... I 9*5 IT 290* ...... T27 5 IT 267* ...... T21 5 IT 261* ...... I 9*1 IT 291* ...... T22 5 IT 262* ...... Total Credits:45 ... T20 5 IT 260* ...... T20 5 IT 270* ..... NL153 ENGL 105 U 8 1 BUS 280 U 6 5 BUS 164 Professional/Technical Programs 67 ART 210 5 IT/ART 120 5 IT/ART 121 5 IT/ART 122 3 IT/JOUR 205 5 IT/JOUR 222 5 Total Credits: 38-40 ...... In addition to the prerequisites required to In addition to the prerequisites ...... 102 IT ...... 254 IT 5 5 ...... 290 IT 5 ...... passing score on the A+ OS Technology exam, AND passing score on the A+ programming languages, AND proven competency in Word, Excel and PowerPoint. or Internship > of IT 235 with a grade of “B” or higher AND Completion > higher or Completion of IT 110 with a grade of “B” or > using one or more Completion of IT 201or proven experience > of “B” or higher or Completion of CU 105 with a grade The Web Graphics Certificate Program is a three-quarter program a three-quarter Program is Certificate Graphics The Web Introduction to Animation 1st Quarter (15 credits) Introduction to Multimedia Graphics Two-Dimensional Design Web Client Development 2nd Quarter (15 credits) Desktop Publishing Principles & Practice Color and Design 3rd Quarter (8-10 credits) Flash Intermediate Legal Assistant Program See Paralegal Administration of Law and Justice, page 56. Web Graphics Certificate Graphics Web to the essential skills designed to give students of 38-40 credits audience web page. The target components of a design the graphic have completed a web is students who may for this program additional web graphic degree who want to attain programming industry as a web programmer already working in skills, someone web graphics skills, or a graphic who wants to attain additional web graphics skills to their skills set. artist who wants to add Technical Prerequisites: Program, students must meet the enter the Information Technology to enter the Web Grpahics Certifi- following technical requirements cate Program: Advanced Web Graphics BUS 280 1 .... 270* IT 5 Total Credits: 30 Total Credits: 45 ...... 271* IT 5 ...... 291* IT 1 ...... 290* IT 5 ...... 202* IT 5 ...... 255* IT 5 ...... 251* IT 5 ...... 247* IT 5 ...... 247* IT 5 In addition to the prerequisites to enter the ...... 257* IT 5 ...... 242* IT 5 ...... 254* IT 5 ...... 105 ENG 3 passing score on the A+ OS Technologies Exam. languages proven experience using one or more programming and PowerPoint. 98% of TCC’s professional/technical program students are employed after 98% of TCC’s professional/technical program students are graduation or continue their studies. Did You Know? > of “B” or higher AND Completion of IT 235 with a grade > of “B” or higher OR Completion of IT 110 with a grade > Completion of IT 201, Introduction to Programming or > CU 105 or proven competency in Word, Excel Completion of This 30-credit certificate program offers students the This 30-credit certificate Web Graphics Applications System Analysis & Design 3rd Quarter (10 credits) Server Data Access 2nd Quarter (10 credits) Advanced Web Development Web Development 1st Quarter (10 credits) Java Programming opportunity to gain specific skills in Web Programming to prepare opportunity to gain specific positions such as Web Programmers, Web them for employment for This program builds on basic Developers, and Webmasters. to obtain the computer/programming skills, so a student desiring as described below. certificate must meet certain prerequisite skills Technical Prerequisites: the following Information Technology Program, students must meet Certificate Program: technical requirements to enter the Web Developer Employability Skills for the IT Industry Employability Skills Career Readiness Technical Writing Certificate Web Developer Mobile Computing Fundamentals Service and Support Fundamentals (formerly IT 263) Support Fundamentals (formerly Service and (15 credits) Third Quarter and Support Network Hardware Service Second Quarter (15 credits) Quarter Second Design Analysis & System credit) Work Internship (or elective 68 Professional/Technical Programs * Prerequisite:Instructorpermission. Individual StudyandSpecialProjects SMG ValuingCulturalDiversity Managing forHighPerformance Organizational Behavior Motivation andProductivity Leadership Dynamics Managerial Excellence Supervisor andtheLaw Human ResourceManagement No.Credits Course Management andLaborRelations Public Relations Management Communications Supervision andGroupBehavior Supervising EmployeeTraining Supervising theProblemEmployee Essentials ofSupervision The NewSupervisor Management Requirements(Select18credits) Course Title are completed,theapplicationisforwardedtoProgramChair. the endofsecondweekquarterinwhichrequirements College’s “ApplicationForVocationalCertificate.”Nolaterthan participants intheprogrammustsubmitTacomaCommunity instruction offeredbyTacomaCommunityCollege-Downtown. complete aminimumof18credithoursmanagement eligible foracertificate,anindividualisrequiredtosatisfactorily supervisors toenhancetheirsupervisorytechniques.Tobe roles. Theprogramalsoprovidesanopportunityforexperienced assisted intheirpreparationforsupervisionandmanagement tunity todevelopand/orimprovemanagerialskills.Individualsare Management Program Chair:StevenEllis Certificate Program Management To receiveacertificate,aftersatisfyingrequirements, The ManagementProgramaffordsanindividualtheoppor- ...... 7 3 275 ...... Total RequiredCredits:18 M 9*1-5 SMG 299* 3 3 SMG 270 SMG 265 3 SMG 255 3 SMG 222 3 3 SMG 201 SMG 131 3 SMG 101 M 6 3 3 SMG 264 3 SMG 261 SMG 260 3 SMG 250 3 SMG 210 3 3 SMG 125 SMG 120 3 SMG 100 253.396.9128 following curriculumwithagradeof“C”orhigherinallclasses. Graduates oftheMedicalBillingProgrammustcomplete possess thephysicalandemotionalabilitytocompleteprogram. is required.ApplicantsmustbefluentintheEnglishlanguageand placement atcollege-levelreadingandEnglish,aswellMATH86 through theAlliedHealthOfficeinBldg.19,Room70.Assessed basis. Studentsmustcompleteaseparateapplicationprocess Certified ProceduralCoder(CPC). the CertifiedCodingSpecialist-Physicians(CCS-P)and Academy ofProceduralCoders(AAPC).Thesecredentialsinclude Information ManagementAssociation(AHIMA)andtheAmerican claims certificationexamsofferedbytheAmericanHealth program, studentsmayelecttositfornationalcoder/biller/ Associate inAppliedSciencesdegree.Uponcompletionofthis Information Technician(RHIA)aswellinpursuingan Health InformationTechnologyasaRegistered foundation forstudentsseekingtocontinuetheireducationinto delayed claims.Thiscourseworkprovidesasolidandapplicable processing includingmanagementofdisputed,rejected,and the specialistwillbeabletohandleallcomponentsofclaims offices, andinsurancemanagedcareproviders.Additionally, office, largegrouppractices,ambulatorysurgerycenters,dental graduate thetoolstobeavaluableresourcephysician optimize providerreimbursement.Thisprogramwillgivethe procedures andtobillaccurately,ethicallyassertively on beingabletounderstandandcodemedicaldiagnoses acquire ageneralknowledgeofthehealthcarefieldwithfocus administrative requirementsofhealthcare.Graduateswill includes clinicalapplicationsaswellthebusinessand variety ofothermedical/dentalsupportpositions.Training medical claimsreviews,patientandsurgeryschedulers,a and ADA),medicalbillers,patientaccountrepresentatives, employment asambulatorycarecoders(ICM-9-CM,CPT/HCPCS, Rich Weidman,RHIA,CCSP Program Chair: Certificate Program Medical BillingSpecialist Anatomy &Physiology No.Credits Course MS Excel Principles ofDisease CPT Coding ICD-9-CM Coding Business Math Medical/Dental OfficeManagement Healthcare DeliverySystems Medical TerminologyII . Medical TerminologyI Course Title Open enrollmentandapplicationsareacceptedonanongoing The MedicalBillingSpecialistProgrampreparesstudentsfor ...... U132 CU 103 ...... H 1 5 HT 216 ...... T205 HT 210 ...... H 3 3 HT 130 ...... H 3 5 HT 131 ...... T104 HT 110 ...... T105 HT 120 ...... Total CertificateCredits:44 253.566.5228 U 1 5 BUS 110 I 2 5 HIM 220 I 1 5 BIO 118 Professional/Technical Programs 69 130/131* 3/5 BUS 225* 5 BUS 110* 5 253.566.5280 253.566.5260 OFFCE 106* 2 OFFCE 228 3 160/161/162 2/2/2 140*/141*/142* 3/3/3 ENGL 100 or 101 5 ...... 143* HT 2 ...... Total Program Credits: 54 ...... 241* HT 5 ...... 139 HT 3 ...... 150* HT 2 ...... HT ...... 105 CU 5 ...... HT ...... 118 BIOL ...... HT 5 ...... application to the Medical Transcription program is program Medical Transcription to the application ...... 202* CU 2 ...... 102 CU 2 The Museum/Gallery Operations (MGO) Program is an option in The Museum/Gallery Operations (MGO) Program or Marlene Bosanko Recommended Courses: Business Correspondence * Prerequisite required (see course descriptions). Museum/Gallery Operations Program Program Chair: Rick Mahaffey the Business Administration and Management Program. The MGO option prepares graduates to analyze the business environment of the museum/gallery organization. It provides an understanding of the fundamentals of museum/gallery business operations, and will prepare students to coordinate the human, material, technological, and financial resources of a museum/gallery business. It will provide the graduate with an appreciation of the visual arts, design, and visual display as they relate to museum/gallery operations. The program provides ample flexibility in curriculum design to focus student interest and meet a multitude of career goals in business and museum/gallery operations management. Course Title (40 Credits) Technical Core Courses Anatomy and Physiology Medical Terminology I, II III Medical Transcription I, II, Medical Transcription Lab Introduction to Pharmacology Introduction to Disease Process Seminar Medical Transcription Management hours) Clinical Applications (150 Course No.Credits (5 Credits) General Core Courses Business English or English Composition Business Math Credits) Office Professional Core Courses (4 Typing for Speed and Accuracy Word I Word I, Excel I, PowerPoint Word II Word Processing: Professional Skills 45 wpm and have completed CU 100 and 102 or equivalent. A equivalent. and 102 or CU 100 completed have and wpm 45 separate certificate, students order to obtain the completion required. In of courses with a grade complete all program must successfully “C” or higher: HIM 252 3 HIM 180 5 253.851.2424 ...... 150 HT 2 ...... 215 HT 2 ...... 102 CU 2 To enter the program, students must complete Typing I After completion of four quarters of study, the students will A medical transcriptionist works in the medical transcription This one year certificate program qualifies a student for This one year certificate program qualifies a student This program is held at TCC’s Gig Harbor Center. Students will earn an Associate in Applied Sciences degree upon Students will earn an Associate in Applied Sciences The Medical Office Professional Program prepares the student to The Medical Office Professional (OFFCE 103) with a grade of “C” or higher, or accurately type be able to understand and apply medical terminology, transcribe medical reports of all types with speed and accuracy using word processing software and transcription equipment, and calculate and monitor productivity within a medical transcription department. department or special professional services department (radiology, pathology, etc.) of hospitals, medical practice clinics and other health care institutions, as well as in medical transcription services, or independently in their own home business. This one-year certificate program is held at TCC’s Gig Harbor Center. One Year Certificate Program Curriculum for this program was under revision at the time of catalog printing. Curriculum for this program was under revision at the time Center. For accurate and current information, contact the Gig Harbor Medical Transcriptionist employment in an entry-level position as a receptionist or clerical employment in an entry-level position as a receptionist agency. To enter the worker in a hospital, clinic or other health care 103) with a program, students must complete Typing I (OFFCE grade of “C” or higher, or accurately type 45 wpm. One Year Certificate Program Medical Office Assistant Medical Office Professional Associate in Applied Sciences degree of catalog printing. Curriculum for this program was under revision at the time Center. For accurate and current information, contact the Gig Harbor completion of all required courses. perform general duties in a physician’s office, hospital, clinic, or perform general duties in Duties may include receptionist, making other health care agency. financial details (billing, payments, patient appointments, managing patients prior to examination, etc.), interviewing and preparing office keeping and transcribing medical records, preparing software. documents using word processing and spreadsheet (formerly Medical Secretary) Pat Von Knorring Program Coordinator: Medical Office Program Professional Additional Recommended Courses: Recommended Additional and CPT Coding ICD-9-CM Advanced Management Medical Reimbursement for Health Professionals Pharmacology to Health Records Management Introduction MS Word 70 Professional/Technical Programs See InformationTechnology,page 66. Network Administrator * Prerequisiterequired(seecoursedescriptions). Desktop Publishing:Principles&Practice Business inAChangingWorld Small BusinessEntrepreneurship Retail andProfessionalSelling Introduction toMarketing Business Law Elective Requirements(Select15credits) Work Internship Principles ofManagement Introduction toBusiness Practical Accounting Business RequirementCourses(20credits) Fundamentals ofSpeechCommunication College FreshmanComposition Word I,ExcelPowerPoint Leadership andHumanRelations Related InstructionCourses(20credits) Introduction toHistoricalReasoning History ofWashingtonandThePacificNorthwest Russian History United StatesHistory:20thCentury United StatesHistory:19thCentury United StatesHistory:17th,18thCenturies Far EastinModernWorld Color andDesign 5 History ofWesternArt:Baroque-Modern ART 202 ...... History ofWesternArt:Medieval&Renaissance . History ofWesternArt:Ancient No.Credits Course Three-dimensional Design Two-dimensional Design Art Basics . Appreciation ofTheVisualArts Native AmericanCultures Principles ofArchaeology The Africans Introduction toAnthropology Program RequirementCourses(Select35credits) Course Title credits ofBusinessclasselectives. of relatedclassrequirements,20creditsBusinessrequirementsand15 one Anthropologyclass,HistoryandStudioArts20credits NOTE: Studentsmustcomplete:35creditsofrequiredprogramclasses,including Associate inAppliedSciencesdegree Museum/Gallery Operations ...... U155 CU 105 ...... Total DegreeCredits:90 ...... NH 1*5 5 ANTHR 210* 5 ANTHR 205 5 ANTHR 115 ANTHR 100 CN 4 5 ACCNT 140 PH105 SPCH 100 OR22 3 JOUR 222* NL115 ENGL 101 IT205 HIST 290 5 5 HIST 243 5 HIST 242 5 HIST 241 HIST 110 IT245 5 HIST 264 HIST 260 U 7 5 BUS 270 5 5 BUS 245 5 BUS 240 BUS 200 5 5 BUS 163 BUS 101 5 ART 203 5 5 ART 201 5 ART 103 5 ART 102 5 ART 101 ART 100 U 6 5 BUS 260 5 BUS 290 5 BUS 164 5 ART 210* the NCLEXlicensingexaminationorobtainalicensetopracticenursing. safety, shouldbeawareofthepossibilitythattheymaynoteligibletositfor Commission, orwhichpreventthepracticeofnursingwithreasonableskilland alterations totheprogramofstudyasapprovedbyWashingtonStateNursing *Applicants whohavechronichealthconditionsordisabilitieswhichrequire for licensureasaregisterednurse. Department ofEducation. the CouncilforHigherEducationAccreditationand/orUS Health NursingCareQualityAssuranceCommissionrecognizedby League forNursing(NLN)andtheWashingtonStateDepartmentof Associate DegreeNursingProgramisaccreditedbytheNational perform nursingdutiesinavarietyofhealthcaresettings.The Program Chair:SusanFord Nursing Program See InformationTechnology,page66. Support Network Hardware Nursing FocusVI:TrendsandIssues Nursing FocusV:EndofLife Nursing FocusIV:Leadership&Management Nursing V:CaringfortheClientwith Nursing IV:CaringfortheClientwith Second Year Nursing FocusIII:PharmacologyII(Theory) Nursing FocusII:PharmacologyI(Theory) Nursing FocusI:Gerontological(Theory) .. Nursing InterventionsIII:AdvancedSkills(Lab) Nursing InterventionsII:BasicSkills(Lab) No.Credits Course Nursing InterventionsI:Assessment(Lab) Nursing III:CaringfortheChildbearing Nursing II:CaringfortheClientwithMinor Nursing I:CaringfortheWellClientTheory First Year Course Title Associate inAppliedSciencesdegree Nursing Allied HealthOffice,Bldg.19,Room70,orcall253.566.5163. prerequisites. Admissionandprograminformationisavailableinthe Graduates oftheprogramwillbeeligibletotakeexamination The AssociateDegreeNursingProgrampreparesstudentsto Nursing programapplicationsareacceptedaftercompletionof Clinical Chronic ProblemsTheory 5 Clinical NURS 211* ...... Acute ProblemsTheory Clinical Family Theory Clinical Deviations fromWellnessTheory Clinical ...... US23 2 NURS 243* 5 NURS 221* 1 1 NURS 143* 1 NURS 142* 1 NURS 141* 1 NURS 133* 1 NURS 123* NURS 113* 5 NURS 131* 5 NURS 111* US22 2 2 NURS 242* 5 NURS 241* NURS 222* 5 NURS 212* 5 NURS 132* 5 NURS 122* 5 NURS 112* US11 5 NURS 121* 253.566.5358 Professional/Technical Programs 71 BUS 280 1 253.566.5333 OFFCE 231* 3 OFFCE 234* 5 OFFCE 290* 5 OFFCE 101OFFCE 105* 1 OFFCE 106* 2 OFFCE 127 2 3 OFFCE 117* 3 OFFCE 100 2 OFFCE 116 3 ACCNT 140 5 ..... > continued, next page ...... 105 CU 5 ...... 110* CU 2 ...... 102 LS 2 ...... 130* CU 3 ...... 108 CU 2 ...... 203* CU 3 Using Desk-top Publishing The Office Professional Program prepares students for a The Office Professional in This is a two-year program that leads to an Associate Graduates are eligible to take the examination for licensing as a for licensing the examination to take are eligible Graduates Creating Business Publications Word I, Excel I, PowerPoint Outlook Introduction to Access QuickBooks Excel II Practical Accounting Research Methods Career Readiness Skills Word Processing: Microsoft (Word) Office Reference Resources Editing and Proofreading Business Documents .. Typing Speed and Accuracy Development Overview of Today’s Office Records and Database Management Machine Transcription Work Internship Office Professional Associate in Applied Sciences degree Course TitleTechnical Core Requirements (52 credits) General Office Procedures Course No.Credits Office Professional Program Munson, C.P.S. Program Chair: Dr. Karen an administrative assistant, secretary, or variety of positions as staff. These positions require a other administrative support a variety of tasks, accept person to be able to organize effectively as a team member or responsibility, and work typing, computer applications, and individually. English skills, general office procedures are emphasized. required courses. Applied Sciences degree upon completion of all OFFCE 103 with a To enter the program, students must complete ENGL 90, READ 92, grade of “C” or higher. Assessed placement at Chair for and MATH 86 or higher is required. Call the Program more information. registered nurse. Applications are accepted after completion of after completion are accepted Applications nurse. registered in the information is available Admission and program prerequisites. This 70, or call 253.566.5358. Office, Bldg. 19, Room Allied Health third eligible to enter at the piloted with students program is being quarter level. SOC 110 5 NURS 231*NURS 232*NURS 1 8 NURS 260 1 NURS 233 1 CHEM 101*+ 5 ENGL 101*+ 5 PSYCH 100*+ 5 PSYCH 206# 5 Total Credits: 118 ...... BIOL 220*+/221*+or ...... BIOL 240*+/241*+/242*# 10/15 SPCH 100/101/110/120/130 5 ...... 201*+ BIOL 5 Non-Nursing Credits: 46-51 Nursing Credits: 72 ...... (see list of approved courses, LS 102 recommended) ... CU 2 or Principles of Sociocultural Anthropologyor Principles of Sociocultural ..202ANTHR 5 This program is designed for students who are unable to attend This program is designed for students who are Licensed This program is designed for students who are Students interested in four-year nursing programs can complete Students interested in four-year nursing programs class as a full-time student. Courses are intended to parallel the full- time program. Students complete theory classes; then the following quarter attend clinical rotation for specific course content. Once admitted into the part-time option, students will attend quarterly without a summer quarter break, until completion of the program. Program completion is approximately twice as long as the full-time program of study. Nursing, Part-time Option Practical Nurses in the State of Washington. Students who Practical Nurses in the State of Washington. Students transition courses successfully complete one of the practical nurse (NURS 130 or NURS 210) may enter the third or fourth quarter of the basic nursing program. Graduates are eligible to take the examination for licensing as a registered nurse. Applications are accepted after completion of prerequisites. Admission and program information is available in the Allied Health Office, Bldg. 19, Room 70, or call 253.566.5358. Nursing, LPN to RN Articulation Associate Degree Nurse Articulation Program a number of courses at a community college. Students need to a number of courses at a community college. Students they expect to consult a nursing advisor at the university at which a Nursing complete their education before consultation with Program advisor. * Prerequisite required (see course description). program. +Must be completed prior to submitting application to nursing but not prior to # Must be completed prior to beginning the Nursing Program submitting program application. Inorganic Chemistry Advanced IV Therapy Skills (Theory/Lab) Advanced IV Courses Other Required equivalent, are required prior to beginning the The following courses, or their program or prior to graduation. Electives Nursing Seminar in Care Management (Theory) Care Management Seminar in Nursing General Psychology Speech Communication Computer Course Nursing Preceptorship: Manager of Care (Clinical) Manager Preceptorship: Nursing for Licensure Nursing Prep General Microbiology Survey of Sociology Life Span Developmental Psychology: College Freshman Composition Anatomy and Physiology 72 Professional/Technical Programs *Requires prerequisitesorinstructorpermission. Work Internship Credit No. Course Machine Transcription .. Editing andProofreadingBusinessDocuments Business Math Overview ofToday’sOffice Records andDatabaseManagement Outlook Word I,ExcelPowerPoint Business English Required Courses Course Title for entryintotheprogram. placement atENGL90andMATH86levels(orbetter)isrequired Typing I(OFFCE103)withagradeof“C”orhigher.Assessed creating spreadsheets. inputting andeditingbusinessdocuments,usingdatabases, might includeansweringmulti-linephones,greetingclients, an entry-levelpositionasofficeassistant.Typicalduties One YearCertificate General OfficeAssistantProgram quarter; studentsneedtocarefullyplanscheduleswithadvisor. *Requires prerequisitesorinstructorpermission.Notallcoursesareofferedeach Elective: Fundamentals ofSpeechCommunication Business English Leadership andHumanRelations Business Correspondence Business Law Business Math General CoreRequirements(40credits) Word Processing:Microsoft(Word) Practical Accounting Leadership andHumanRelations Prerequisite: Toentertheprogram,studentsmustcomplete This one-year(4-quarter)certificatequalifiesastudentfor guage, oronlinecourseapprovedbyProgramChair nated course):BUS101,GBUS210,PSYCH207,foreignlan- Choose twoofthefollowing(onemustbeamulti-culturaldesig- or PublicSpeaking ...... C 0 2 CU 108 ...... 10 ...... 5 CU 105 ...... Total CertificateCredits:48 Total DegreeCredits:92 PH10o 0 5 SPCH 100or101 ...OFE15 2 OFFCE105* ...... CN 4 5 ACCNT 140 FC 1 3 OFFCE 116 FC 1*3 OFFCE 117* 3 OFFCE 127 FC 9*5 OFFCE 290* FC 3*5 OFFCE 234* NL105 ENGL 100 5 ENGL 100 U 1 5 BUS 110 5 5 BUS 225* 5 BUS 200 BUS 110 U 6 5 BUS 164 U 6 5 BUS 164 One YearCertificate No.Credits Course Word ProcessingProgram Typing SpeedandAccuracyDevelopment General OfficeProcedures Course Title the ProgramChair.Call253.566.5333formoreinformation. without lookingatthekeyboard.Thistestwillbeadministeredby higher andmustpassatypingtestat35networdsperminute and filing. answering phones,greetingclients,typing,makingappointments, an entry-levelreceptionist-clerk.Typicaldutiesmightinclude One QuarterCertificate Receptionist-Clerk Program *Requires prerequisitesorinstructorpermission. Work Internship Creating BusinessPublications Introduction toAccess No.Credits Course Outlook Word I,ExcelPowerPoint . Editing andProofreadingBusinessDocuments Word Processing:Microsoft(Word) Machine Transcription Leadership andHumanRelations Business Math Business ...... English Required Courses Course Title is required. higher. AssessedplacementatENGL90,andMATH86orhigher Overview ofToday’sOffice(OFFCE127)withagrade“C”or completed TypingI(OFFCE103)withagradeof“B”orhigherand formatting, proofreading,andtranscriptionareemphasized. program providescurrentofficesoftwareapplications.Document for anofficecareerthatemphasizesinformationprocessing.The Individual StudyinBusiness Outlook Word I,ExcelPowerPoint Records andDatabaseManagement Business Correspondence Students musthavecompletedENGL100withagradeof“C”or This one-quarterprogrampreparesstudentstobeemployableas Prerequisite: Toentertheprogram,studentsmusthave This one-year(4-quarter)certificateprogrampreparesstudents Using Desk-topPublishing ...... C 0 2 CU 108 ...... 2 CU 108 ...... C 1*2 CU 110* ...... U155 CU 105 ...... 5 CU 105 ...... Total CertificateCredits:17 Total CertificateCredits:47 ...... FC 0 2 OFFCE 100 FC 0*2 OFFCE 106* FC 1*3 OFFCE 117* FC 9*5 OFFCE 290* 2 5 OFFCE 105* OFFCE 234* 3 OFFCE 116 FC 3*3 OFFCE 231* NL105 ENGL 100 U 1 5 BUS 110 U 9*3 BUS 299* U 6 5 BUS 164 U 2*5 BUS 225* Professional/Technical Programs 73 BUS 164 5 ART 100 5 SOC 110 5 SOC 252 5 253.566.5179 MUS 107 5 SMG 101 3 HIST 243 5 ANTHR 100 5 HUMAN 100 5 > continued, next page Total Degree Credits: 90 ...... 118 BIOL 5 ...... 100 CU 1 ...... 105 CU 5 ...... 100 BIOL 5 ...... 102 CU 2 This program prepares students for practice as Pharmacy This program prepares students for practice as Paralegal Program 56-57. See Administration of Law and Justice, pages Paramedic Training page 60. See Emergency Medical & Health Services, Pharmacy Technician Program Program Chair: Pat Brown Technicians, working under the supervision of a licensed pharmacist, performing a variety of tasks in both hospital and retail pharmacies. This program is a partnership between Tacoma Community College and St. Joseph Medical Center, and meets eligibility requirements for state certification as a Pharmacy Technician by the Pharmacy Technician Certification Board (PTCB). A separate application is required for admission into the St. Joseph portion of the program. Application must be made no later than July 1 each year, and applicant must have completed all prerequisites by the end of summer. Students interested in the program should call the Allied Health Division at 253.566.5179, to meet with an advisor. Leadership (3-5 credits required) credits (3-5 Leadership of Supervision Essentials Human Relations Leadership & required) Literacy (3 - 5 credits Computer and WWW Intro to Windows Word I I, PowerPoint Word I, Excel (25 credits) Elective Requirements required) Humanities (10 credits Introduction to Humanities Arts Appreciation of the Visual Introduction to Music credits required) Social Sciences (10 Survey of Sociology Introduction to Anthropology U.S. History-20th Century Natural Science (5 credits required) Human Anatomy and Physiology Introduction to Biology Sociology of the Family EDP 100 3 EDP 101EDP 102 3 EDP 112 3 3 EDP 202 3 EDP 130 2 EDP 290 3 EDP 203 3 EDP 204 3 253.566.5010 PHIL 120 5 ENGL 101ENGL 102 5 5 EDUC 135 5 SPCH 100 5 MATH 107 5 PSYCH 100 5 PSYCH 140 3 PSYCH 206 5 ...... Total Credit required for Certificate: 39 ...... or Child Development This program is designed to train participants to be successfully is designed to train participants This program Symbolic Logic (MATH 99 Prerequisite) College Freshman Composition Oral Communication Skills (5 credits required) Speech Communication Quantitative (5 credits required) Mathematics: A Practical Art General Education Requirements (31 credits) Written Communication Skills (10 credits required) College Freshman Composition Associate in Applied Sciences degree 51 additional credits to be taken from the distribution as listed below. Paraeducator Early Childhood Emphasis General Psychology 100, 101, 202 after Note: EDP 104, 105, & 106 may be substituted for EDP completion of nine Core Requirement classes. General Education Requirement (5 credits) Course TitleCore Requirements (34 credits) Introduction to Early Childhood Course No.Credits Paraeducator Early Childhood Paraeducator Emphasis Program One Year Certificate Effective Instruction I employed in a variety of educational settings. Enrollment is open to settings. Enrollment is a variety of educational employed in and individuals who wish to currently employed paraeducators in the field. Employment in the field will prepare for employment check. Students may earn a require a criminal background Associate in Applied Sciences degree. Certificate or a two-year in the evenings. Core classes are offered Program Coordinator: Mary Skinner Program Coordinator: Paraeducator, Early Paraeducator, Emphasis Childhood Program Effective Instruction II Curriculum Development Family Health, Nutrition & Safety Individual and Cultural Diversity Practicum Family Systems and Support Services Effective Communications with Families Behavioral Management Developmental Psychology: Life Span 74 Professional/Technical Programs Fundamentals ofSpeechorPublic Business Correspondence Intro toChemistry Required CoreCourses(20 Credits) 30 additionalcreditstobetakenfromthedistributionaslistedbelow. Associate inAppliedSciencesdegree Pharmacy Technician faculty toentertheseclasses. ** StudentsmustbeformallyacceptedintotheclinicalprogrambySt.Joseph Pharmacy TechnicianPracticumII Pharmacy TechnologyandPracticeIII (Spring) Third Quarter(ClinicalProgramatSt.Joseph)** Pharmacy TechnicianPracticumI Drug OrientationandPharmacologyII Pharmacy TechnologyandPracticeII (Winter) Second Quarter(ClinicalProgramatSt.Joseph)** Pharmacy Calculations Drug OrientationandPharmacologyI Pharmacy TechnologyandPracticeI (Fall) First Quarter(ClinicalProgramatSt.Joseph)** No.Credits Course Medical TerminologyII MATH 99orhigher Word I,ExcelPowerPoint Leadership andHumanRelations Business EnglishorComposition ...... Medical TerminologyI higher, beforeenteringthePharmacyTechnicanProgram. Prerequisites: Thefollowingcoursesmustbecompletedwithagradeof“C”or Prerequisites Course Title of “C”orhigher. Sciences degreemustsuccessfullycompletethefollowingcourseswithagrade The graduateofthePharmacyTechnicianCertificateorAssociateinApplied One yearcertificate Pharmacy TechnicianProgram Department ofEducation. the CouncilforHigherEducationAccreditationand/orUS Pharmacists (ASHP),aspecializedaccreditingboardrecognizedby program isaccreditedbytheAmericanSocietyofHealth-System Associate inAppliedSciencesdegree.ThePharmacyTechnician of thetwo-yearprogramqualifiesstudentstoreceive prepared foremploymentasaPharmacyTechnician.Completion requirements, thestudentiseligibletoreceiveacertificateand Two programsareavailable.Uponcompletingthefirstyear Communication or ...... Intro to Biology ...... H 3 5 HT 131 ...... U155 CU 105 ...... T103 HT 130 ...... HM10*o IL10*5 CHEM 100**orBIOL ...... PH10o PH115 SPCH 100or101 ...... AH9 r10s5 MATH 99or100’s NL10o 0 5 ENGL 100or101 Total Credits:73 HR 4*4 PHARM 140* 7 PHARM 111* 8 8 PHARM 120* PHARM 110* HR 4*12 1 PHARM 141* PHARM 112* 3 PHARM 121* 2 PHARM 130* U 2*5 BUS 225* U 6 5 BUS 164 Department ofEducation. Council forHigherEducationAccreditationand/ortheUS (JRCERT), aspecializedaccreditingboardrecognizedbythe Review CommitteeonEducationinRadiologicTechnology Health OfficeinBldg.19,Room70. Technology programisrequiredandmaybeobtainedattheAllied Technologists. AseparateapplicationtotheRadiologic examination administeredbyTheAmericanRegistryofRadiologic the studentiseligibletoapplytakenationalcertification the associatedegreerequirementsandclinicaleducationcourses, successful completionofrequiredcoursesinradiologicsciences, program istwenty-fourcalendarmonthsinduration.Upon Applied Sciencesdegreeandacertificateofcompletion.The Program Chair:MichaelA.Mixdorf Program Radiologic Sciences electives. *** Studentsmaychoose10creditsfromanycombinationofcourseslistedas meet requirements. ** Studentsmaysubstitutehigherlevelchemistry,biologyormathcoursesto * Requiresprerequisitesorinstructorpermission. Legal ConceptsfortheHealthField Health CareDeliverySystems Principles ofManagement Intro toHumanitiesor Survey ofSociology Elective Courses(10Credits) Radiographic FilmCritiqueandTechnique II Radiographic PositioningII Clinical EducationI No.Credits Course Radiation PhysicsI Second Quarter(Winter) Intro toFundamentalsofPatientCare Radiographic FilmCritiqueandTechniqueI Radiographic PositioningI Fundamentals ofRadiologicScience&HealthCare Radiologic SciencesOrientation First Quarter(Fall) Course Title Associate inAppliedSciencesdegree Radiologic Sciences The RadiologicTechnologyprogramisaccreditedbytheJoint The RadiologicTechnologyProgramleadstoanAssociatein other HumanitiesDistribution or GeneralPsychology ...... S10 5 5 RS 120* ...... RS 108* ...... S10 5 RS 140* ...... Total AssociateDegreeCredits:101 ...... R 4*5 RS 141* ...... T105 HT 110 ...... S103 RS 100 ...... H 2 3 HT 225 ...... S10 5 RS 170* ...... O 1 rPYH105 SOC 110orPSYCH100 ...... S10 1 RS 150* ...... R 5*1 RS 151* ...... S11 4 RS 101* ...... UA 0 5 HUMAN 100 253.566.5113 U 6 5 BUS 163 Professional/Technical Programs 75 253.566.5113 > continued, next page ...... 210 MR 3 ...... 200 MI 3 ...... 200 MI 3 Total Certificate Credits: 14 Total Certificate Credits: 10 Total Certificate Credits: ...... 230 MR 3 ...... 210 CT 2 ...... 220 MR 3 ...... 220 CT 3 ...... 205 MI 1 ...... 205 MI 1 ...... 240 MR 1 ...... 230 CT 1 Respiratory Therapy is a medically directed, CoARC The Computed Tomography (CT) 11-credit certificate program is certificate 11-credit (CT) Tomography The Computed Program is The Magnetic Resonance Imaging (MRI) Certificate (Committee on Accreditation for Respiratory Care) accredited, Allied Health specialty, caring for patients with heart and lung pathologies. The program is accredited by CoARC in collaboration with the Commission on Accreditation of Allied Health Programs which is recognized by the Council for Higher Education Accreditation, and/or the U.S. Dept. of Education. Magnetic Resonance Imaging Certificate Program Magnetic Resonance Imaging Certificate Course TitleFirst Quarter Cross Sectional Anatomy & Pathology Computerized Imaging Second Quarter Principles of MR Image Formation (MR PHysics) MR Imaging Procedures Third Quarter MR Image Acquisition & Processing Course No.Credits MR Registry Review Receptionist Clerk See Office Professional Program, page 71. Respiratory Therapy Program Program Chair: Jan Coad Computed Tomography Computed technologists who seek who are registered ARRT for students for certifying examination for the national academic preparation in CT. of Radiologic Technologists American Registry Program Tomography Certificate Computed Course TitleFirst Quarter & Pathology Cross Sectional Anatomy Computerized Imaging Second Quarter CT Physics & Instrumentation CT Imaging Procedures CT Registry Review Course No.Credits Magnetic Resonance Imaging who seek for students who are registered ARRT technologists examination for academic preparation for the national certifying in MRI. American Registry of Radiologic Technologists MATH 99 5 ENGL 101 5 CHEM 100 5 BIOL 220/221 5/5 ...... 152* RS 1 Total Degree Credits: 111 SPCH 100, 101, 104 or 120...... 102 CU 5 2 ...... 250* RS 4 ...... 255* RS 1 ...... 233 RS 1 ...... 275* RS 1 ...... 175* RS 1 ...... 243* RS 4 ...... 142* RS 5 ...... 244* RS 3 ...... 216* RS 3 ...... 214* RS 3 upon completion of the TCC Radiologic ...... 228* RS 10 ...... 130 HT 3 ...... 227* RS 7 ...... 122* RS 10 ...... 225* RS 7 ...... 226* RS 7 ...... 109* RS ...... 121* RS 5 5 Speech Communications Fundamentals of Speech Communication or Public College Freshman Composition Word of other approved CU course Transfer information: Technology program and successful writing of the national examination, students may apply to be accepted at the following baccalaureate programs: Boise State University, Idaho State University, Weber State University, Ogden, Utah, Midwestern State University, Wichita Falls, Texas. This list is not inclusive of all Bachelor degree programs in the radiologic sciences. Intermediate Algebra Anatomy and Physiology Introduction to Chemistry Medical Terminology Student Leadership Seminar Prerequisites the Radiologic Sciences The following courses must be completed before entering program. * Prerequisite required (see course descriptions). Clinical Education VI Advanced Imaging Modalities Eighth Quarter (Summer) Clinical Education VII Advanced Healthcare Organization Clinical Education V Leadership and Management Radiographic Positioning V Seventh Quarter (Spring) Sixth Quarter (Winter) Radiographic Pathology Clinical Education III Fifth Quarter (Fall) Pharmacology IV: Therapy Fourth Quarter (Summer) Fourth Quarter Clinical Education IV IV Radiographic Positioning Third Quarter (Spring) Quarter Third Physics II Radiation II Clinical Education Positioning III Radiographic Radiographic Film Critique and Technique III Film Critique and Technique Radiographic Student Leadership Seminar Student Leadership 76 Professional/Technical Programs Ethics &ProfessionalisminRespiratory Care Specialty ClinicalRotation Advanced Assessment&Diagnosis English Sixth Quarter-Fall(14credits) Respiratory TherapyClinicalIV Advanced MechanicalVentilation Fundamentals ofSpeechCommunication Fifth Quarter-Summer(13credits) Pulmonary Functions Respiratory TherapyClinicalIII Respiratory TherapyEquipmentIII Advanced Pathophysiology Fourth Quarter-Spring(18credits) Respiratory TherapyPharmacology Respiratory TherapyClinicalTrainingII Respiratory TherapyEquipmentII Arterial BloodGases*** Third Quarter-Winter(17credits) Respiratory TherapyClinicalI No.Credits Course Respiratory TherapyEquipmentI Cardiopulmonary A&PandPathophysiology*** Second Quarter-Fall(15credits) Medical Terminology** Fundamentals ofPatientCare** Anatomy andPhysiology** Survey ofChemistry,Microbiology&Physics** First Quarter-Summer(18credits) Course Title Associate inAppliedSciencesdegree Respiratory Therapy 118 orabove;MATH99;SPCH100;andENGL101above. Program. Theyinclude:HT130;170;PSYCH100orabove;BIOL support coursesbeforebeingacceptedintotheRespiratoryTherapy college-level English.Studentsareencouragedtotakeany/allofthe must testintoMATH99.Additionally,studentsplace by April1ofeachyear.MATH90mustbecompletedorstudents of Washington. graduate istheneligibletobecomelicensedpracticeinthestate becomes aCertifiedorRegisteredRespiratoryTherapist.The Board forRespiratoryCare.Ifthestudentpassesexam,he/she practitioner (Registry)examinationsadministeredbytheNational eligible totaketheentrylevel(Certification)andadvanced student isawardedanAssociateinAppliedSciencesdegreeand satisfactory completionoftheeightquartersinstruction, prepares thestudentforacareerasRespiratoryTherapist.Upon The programbeginseachsummerquarterwithapplicationsdue The sequentialdaytimeprogramatTacomaCommunityCollege ...... R 6 3 RC 163 ...... T10 3 HT 130* ...... C113 RC 161 ...... R 8 4 RC 280 ...... 3 RC 162 ...... BO 1*5 BIOL 118* ...... R 8 8 RC 180 ...... R 8 6 RC 183 ...... 8 RC 182 ...... C122 RC 192 ...... 3 RC 170 ...... 5 HT 170* ...... R 7 3 RC 171 ...... C123 RC 172 ...... C203 RC 240 ...... 2 RC 191 ...... R 8 8 RC 181 ...... C202 RC 290 ...... C104 RC 160 ...... R 8*5 RC 188* ...... PH105 SPCH 100 NL11 5 ENGL 101* Advanced CriticalCareClinicalRotation Pediatric andNeonatalRespiratoryCare Respiratory PathophysiologyCase See InformationTechnology,page64. Web Developer Individual Study Using Computers Additional RequiredSupportCourses Specialty ClinicalRotationII Neonatal ClinicalRotation Pulmonary Rehabilitation,HomeCare& Review ofApplicationRespiratoryCare Eighth Quarter-Spring(11credits) Psychology Seventh Quarter-Winter(14credits) Support, WebDeveloper, andWebGraphics. Engineering &Security,NetworkAdministrator, NetworkHardware Information Technology Management, andMuseum/Gallery Specialist. Organizational Leadership,EntrepreneursSucceed,GlobalBusiness, Administration &Management,BusinessManagement Business Technician, RadiologicTechnology,andRespiratoryTherapy. Secretary, MedicalTranscriptionist,Nursing,Paramedic,Pharmacy Health InformationCoding,MedicalBillingSpecialist, Allied Health professional/technical programs,including: who qualify.EligiblestudentscanretraininanyoneofTCC’s Financial Aidandjobsearchassistanceareavailableforthose the unemployedintrainingfornewandinterestingcareers. Programs Worker Retraining See OfficeProfessionalProgram,page71. Word Processing See InformationTechnology,page64. Web Graphics Computer ApplicationDeveloper,Electronics/Wireless Automated AccountingApplications,Bookkeeping,Business Emergency MedicalTechnician,HealthInformationTechnology, The WorkerRetrainingProgramatTCCisdesignedtoassist ...... C291-5 RC 299 ...... To U1-5 IT or CU ...... C222 RC 282 ...... RC 2832 ...... Total ProgramCredits:120-125 ...... C212 RC 251 ...... C213 RC 281 ...... C223 RC 272 ...... Total DegreeCredits:120 ...... R 6 4 RC 261 ...... C224 RC 262 ...... SC 0 5 PSYCH 100 Professional/Technical Programs 77 Courses in this program are offered to enhance the profession This review of major bloodborne pathogens including HIV/AIDS This review of major bloodborne pathogens including of gerontology. Certificate represents a specialization in the field students The Nursing Assistant program is designed to prepare Continuing education seminars offered each fall cover current AFH caregivers are required to complete ten hours of are required to complete AFH caregivers meet the 7-hour State requirement AIDS education workshops includes Introduction to the Building This certificate program of massage and bodywork therapy and satisfy requirements for 16 continuing education credits every two years for massage practi- tioners. Topics include aromatic hot stone, Thai massage, hara shiatsu, nutrition, ethics, reflexology, cranial sacral, integrative fascial release, high touch jin shin, as well as massage in the treat- ment of cancer, chronic back pain, multiple sclerosis, frozen shoulder, geriatric patients, stroke rehabilitation, headache, and more. and Hepatitis B and C meets OSHA and WISHA criteria for annual and Hepatitis B and C meets OSHA and WISHA professions, review for occupations such as healthcare, teaching providers. childcare providers and Adult Family or Group Home Certificate in Gerontology of health care Designed to enhance the knowledge and skills professionals who work with older adults. Certified Nursing Assistant centers and hospitals. to work as nursing assistants in convalescent and clinical The one-quarter program includes classroom training program, students experience. Upon satisfactory completion of the Assistants by can apply for Washington Certification as Nursing requirements for examination. Prerequisite: Must meet eligibility state certification. Certified Public Accountant topics in management, ethics, accounting, and auditing. CME for Licensed Massage Practitioners Adult Family Home Continuing Home Family Adult Education of year. A wide variety credits per calendar continuing education foster quality of care and offered to encourage the courses are excellence. professional AIDS Education There is also a 7-hour self- for health care professionals. take-home exam available for check-out. instructional video with Building Codes Mechanical Codes, and Non-Structural Code, Building Inspector, students to take the certification Plan Review. Classes prepare Conference of Building exams offered by the International for Officials and to enhance knowledge of the industry professional advancement. Bloodborne Pathogens The 28-hour Fundamentals of Caregiving course is offered for A two-day, 16-hour course to certify or re-certify professionals Continuing Professional Education programs meet the ongoing Continuing Professional Education programs meet Financial support and work-study positions are available for Financial support and work-study positions are WorkFirst offers screening for learning disabilities, and training WorkFirst offers screening for learning disabilities, The WorkFirst program serves low income and Temporary The WorkFirst program serves low income and Individualized Training Plans are available for students who wish Individualized Training Plans Case Aide and Human Services. Accounting Office Associate, Assistant Bookkeeping Clerk, Office Associate, Assistant Accounting Administration of Law & Justice, Paralegal, and Reserve Paralegal, Law & Justice, of Administration Adult Family Home Caregivers to meet the requirements of the State Department of Licensing. in the practice of ACLS, as defined by the American Heart Association. RN, MD, Paramedic status, or instructor permission is required. Adult Family Home Certification ACLS (Advanced Cardiac Life Support) educational needs of people in a range of occupations and educational needs of people in a range of occupations businesses. College credits, clock hours, or continuing education units (CEU’s) necessary for certification, licensing and renewals are offered in areas listed below. Many classes may be contracted for delivery on-site for individual businesses, agencies, and associations. In addition, customized courses can be developed. Continuing Professional Education Programs qualified students. Call 253.565.9610 for more information. qualified students. Call 253.565.9610 for more in basic skills. WorkFirst offers individualized training programs as in basic skills. WorkFirst offers individualized training programs. well as a variety of customized job service training Assistance for Needy Family (TANF) recipients. Eligible students Assistance for Needy Family (TANF) recipients. to beginning will receive assessment and career planning prior in wage training to prepare them to enter the work force progression positions. to develop individualized education plans to achieve specific to develop individualized information please contact the Worker marketable skills. For more Retraining office at 253.566.5188. WorkFirst Program Paraeducator, Early Childhood Paraeducator, Specialist Computer User Specialist, Office Professional, General Office Specialist, Office Professional, Computer User and Word Processing. Assistant, Receptionist/Clerk, Worker Human Services Police Officer. Office Occupations Office Administration of Law and Justice of Law Administration 78 Professional/Technical Programs broker officeentry-levelposition. positions asjuniorprocessor,loanofficertraineeorothermortgage industry experience.Uponcompletion,participantsareeligiblefor Mortgage BrokerageandLending clients withmentalhealthproblems. manager andstaffatAdultFamilyorBoardingHomesserving mentally illolderadult.Meetsthe20-hourtrainingrequirementfor Mental HealthSpecialtyTraining hypnotist andhypnotherapist. courses meettherequirementsforcertificationasamaster professional interestinhypnosis.Intermediateandadvanced hypnosis/self-hypnosis forpersonalgrowthorthosepursuinga Hypnosis/Hypnotherapy house -notontheory. knowledge oftheperformancesystemsandcomponentsa Communication/Professional Practice.Emphasisisonpractical Conditioning, andHeatPumps,InsulationInteriorsa Exterior, Roofing,Plumbing,Electrical,HeatingIandII,Air Home Inspection Students receiveacertificateofcompletion. and materiamedicaforChinese,AyurvedicWesternherbs. includes clinicalandpracticalapplicationsofherbalpreparations Herbalist, ProfessionalCertificate successful completion. Washington, Oregon,Montana,andIdahoareawardedupon are offeredmonthly.Three-yearcertificationcardsvalidin Flagger Training Healthcare Providersisalsoavailable. Washington StateNursesAssociation.Re-certificationinCPRfor for HealthcareProviders,approved4.2contacthoursbythe requirements inbothCPRandFirstAid.TCCalsooffers CPR/First Aid and Access. applications, suchasWindows’sapplicationsforWord,Excel, Computer Classes Fundamentals ofmortgageoriginationforindividualswithno Course providestrainingtomeetthespecialneedsof Beginning-level classesaredesignedforthoseinterestedin The trainingprogramconsistsoftencourses:Structure, This nine-monthprogramisofferedinthreemodulesand One-day trainingseminarsinflagging,safetyandtrafficcontrol This state-approved8-hourcoursemeetsLaborandIndustry Hands-on computerclassesconcentrateoncurrentsoftware toward certificationinRealEstate. Washington StateDepartmentofLicensingforclockhourcredits required inappraising.RealEstatecoursesareapprovedbythe license renewal,salespersonpre-examrequirementsandcourses Law. Classesareofferedforcollegecreditandapproved salesperson pre-licensing,RealEstateAppraising,Investmentand Real Estate hours tomaintaintheCPPcredential. continuing professionaldevelopment,and/orre-certificationcredit Certified PayrollProfessional(CPP)CertificationExamination,for appropriate forthoseenteringthepayrollfield,preparing defined bytheAmericanPayrollAssociation.Coursesare Payroll Professional employment inthefield. employed paraeducatorsandindividualswhowishtopreparefor variety ofeducationalsettings.Enrollmentisopentocurrently Paraeducator honing writingskillstoincreasebusiness,andmore. for submissiontopublicorprivatefundingsources,travelwriting, Writing forProfessionals practical skillsandexamination. Senior FitnessTrainerandGroupAerobicsTrainer.Includestheory, Trainer NationalCertification Approved forcontinuingeducationunitsandclockhourcredits. disabilities, andothercurrenttrendsineducationaleffectiveness. instructional methods,planningandorganization,learning Teacher Education Court employees,Bankpersonnel,Construction,andmore. Law Enforcement,LibraryStaff,ProbationOfficers,Teachers, professionals inmanyfieldssuchasparamedics,EMTs,Firefighters, to occupationalSpanishmeetsthereal-worldneedsof available forEmergencyResponders.Aground-breakingapproach Survival Spanish TCC offerscoursesforRealtorsandAppraisersincluding The PayrollProfessionalLearningSeriescoverscriticalskillsas Designed totrainparticipantsbesuccessfullyemployedina Classes coverbasictoolsfortechnicalwriting,grantproposals Courses availablefornationalcertificationasaPersonalTrainer, Designed forprofessionaleducatorsandtrainers,classescover Courses insurvivalandemergencySpanishcommandsare Course Descriptions 79 Courses numbered 1-99 are sub-college-level courses designed to develop skills needed for college Courses numbered 1-99 are sub-college-level courses designed to develop skills needed for On the following pages are descriptions of the course offerings of Tacoma Community College. The On the following pages are descriptions of the specific courses to be offered each quarter of 2003-2004 and 2004-2005 will be announced in the class specific courses to be offered each quarter of 2003-2004 and 2004-2005 will be announced schedules, which are published quarterly. the work and vocational courses. Courses numbered 100-299 are college-level courses. They meet well as the requirements of the degrees of Associate in Arts and Sciences and Associate of Science as degrees Associate in Applied Sciences, the Associate in Technical Arts and Associate in General Studies by four-year conferred by Tacoma Community College. These courses are normally accepted for transfer Sciences or colleges and universities in Washington State when they are part of an Associate in Arts and degrees should Associate of Science degrees. Students who transfer without one of the approved transfer courses not take for granted the transferability of all 100-level classes since some of them are vocational and apply toward the Applied Sciences and Technical Arts degrees only. 80 Course Descriptions Marlene Bosanko Social Sciences Arts, Humanities& through whichthosecoursesareoffered. descriptions inthissectionofthecatalogarelistedalphabeticalorderforconveniencereaders.) following thecoursetitlesinthissectionofcatalog. two hoursofclassperweekquarterforeachcredit.Creditsearnedsuccessfullycompletingcourseareshowninpa individual project. an instructorandthechairofdivisioninwhichcourseisoffered.Creditgrantedforcoursesnumbered299varieswith The divisionsandsubjectgroupingsareasfollows: Students wishingtolearnmoreaboutcertaincoursesareurgedtalkthosewiththechairofdivisionorde Courses atTCCareorganizedintoinstitutionaldivisionsorcategories,eachincludingarelatedgroupofsubjects.(Subject Normally, onecreditisgivenfor50-minuteperiodofclassperweekquarterlectureclasses.Laboratorysectionsg Courses numbered299arereservedforspecialprojects.Suchprojectsundertakenbyindividualstudentsuponarrangementwi Study Skills Speech Spanish Reading Political Science Philosophy Pacific RimStudies Music Museum/Gallery Operations Library Sciences Journalism Japanese Humanities History German French TCC BridgeProgram English Literature English Composition Education Drama Coordinated Studies Communication Skills/CriticalThinking Art American SignLanguage American EthnicandGenderStudies Mike Flodin Science Mathematics and Pat Brown Human Services Health, Justice& Physical Science Oceanography Mathematics Geology Geography Environmental Science Engineering Ecology Computer Science Chemistry Botany Biology Astronomy Anthropology Respiratory Therapy Radiologic Sciences Physical Education Pharmacy Technician Nursing, AssociateDegree Medical BillingSpecialist Magnetic ResonanceImaging Human Services Health InformationCoding Health InformationTechnology Emergency MedicalandHealth Diagnostic MedicalSonography Computed Tomography Administration ofLawandJustice Services Business andTechnology M. WayneWilliams Continuing Education Business Division, Jeanette Lunceford Receptionist Clerk Word Processing Office Professional Information Technology Global Business General OfficeAssistant Electronics/Wireless Economics Computer User Business Managementand Business Administrationand Business (Academic) Bookkeeping Systems Automated AccountingApplications Assistant BookkeepingClerk Accounting OfficeAssociate Accounting (Academic) Sociology Psychology Physics - WebGraphics - WebDeveloper - NetworkHardwareSupport - NetworkAdministrator - ComputerApplicationDeveloper Engineering andSecurity Organizational Leadership Management (Occupational) reas andcourse rentheses enerally require partment the th Course Descriptions 81 Science Degree Program Education Human Development Adult Basic Education ABE – English as a Second Language Citizenship College Preparatory Courses English as a Second Language General Education Development (GED) High School Completion Courses Distance Learning Professional/Technical Programs Worker Retraining WorkFirst Academic Transfer Classes Academic Transfer Associate in Arts and All Classes for Program A+ Certification Business Lab Computer Lab Health Technology Lab Lifelong Education Program Adult Literacy Program Math Lab Medical Secretary Medical Transcription Microsoft Certified Systems Engineer Office Computer User Specialist Student Services Trish Geringer ParaEducator, Early Childhood Emphasis Mary Skinner Learning Resources, Adult Basic Education, English as a Second Language and Distance Learning Yoswa Gwalamubisi Workforce Education Paula Norby Gig Harbor Peninsula College Peninsula Gig Harbor Center Becky Morgan Development (SBDC) Administrator and Sciences Degree Teleconferencing Small Business Management and CISCO Certification MCDBA Certification MCSA Certification MCSE Certification Network+ Certification Entrepreneurs Succeed Program Management Certificate Project Management Small Business Development Center A+ Certification Certified Internet Webmaster Certified Wireless Network Business and Industry Resource Center Business Lab Computer Lab Contract Training Credit Classes for Associate in Arts Interpersonal Skill Training Interpersonal Training Customized Sexual Harassment Diversity Team Building Communication Skills Customized Computer Training Leadership Occupational Spanish and more ... Information Technology Certification Center at the Tacoma Mall Rich Costanzo Steven Ellis TCC Downtown Contract Training Contract Washburn Linda Practitioners ACLS Adult Family Home (Certification & CE) Alcohol Server and Mixologist Permits AIDS Education Aromatherapy Certificate Building Codes Business & Industry Certified Nursing Assistant Certified Public Accountant CE Chemical Dependency Counselors CE Child Care Provider CE CME for Licensed Massage CPR/First Aid Flagger Training Herbalist, Professional Certificate Hypnosis/Hypnotherapy Kinesionics Mortgage Loan Processing Nursing Home Administrators CE Payroll Professional (CE & CPP Prep) Physical Therapists CE Professional Writing Classes Real Estate Spa Treatments Spanish for Professionals Teachers, Clock Hours Writing for Professionals Computer Training Dance Home and Garden Culture Language & Health & Wellness Recreation & Sports Writing Youth Academic Enhancement Linda Finkas Continuing Professional Education Susan Cristao Susan Center for Personal Enrichment for Personal Center 82 Course Descriptions instructor permission. Prerequisite: ACCNT140,210or deductions andotherbusinesstaxes. regulations onpayrollcomputations, Reviews stateandfederallaws Payroll andBusinessTaxes(5) ACCNT 145(Sp) equivalent withagradeof"C"orhigher. Prerequisite: ACCNT140and141or assignments usingthecomputer. Students willbeencouragedtocomplete analysis andmanagementdecision-making. and processcosting,budgeting,statement management. Includesanintroductiontojob Covers accountinginformationrequiredby Practical ManagerialAccounting(5) ACCNT 142(Sp) grade of"C"orhigher. Prerequisite: ACCNT140orequivalentwitha complete assignmentsusingthecomputer. corporations. Studentswillbeencouragedto accounting forpartnershipsand topics, includinganintroductionto A continuationoffinancialaccounting Practical AccountingII(5) ACCNT 141(W) 103 orCU105. Recommended: ConcurrentorpriorenrollmentinCU Students willbeintroducedtocomputers. preparation offinancialstatements. completion oftheaccountingcycle,including analysis ofbusinesstransactionsand proprietor businesses.Topicsinclude concepts andprocedures,emphasizingsole Introduces studentstobasicaccounting Practical AccountingI(5) ACCNT 140(F,W,Sp,Su) Accounting Please Note: Class availabilityisdependentonadequateenrollment. For currentcourseofferings,checkthequarterlyclassscheduleorconsultappropriatedivisionadministrator. If thereisnonotation,thisinformationwasnotknownatthetimeofcatalogpublication. which thiscourseisusuallyoffered. A specialnotationisusedinparenthesesnexttothecoursenumber.Thisspecifiesquarterduringyear Example: ACCNT145(Sp) alW=Wne p=Srn Su=Summer Sp=Spring W=Winter F =Fall financial statements. Introduction tomethodsusedinterpret preparation oftheStatementCashFlows. consolidated statements.Re-emphasizesthe reporting ofStockholders'Equityand investments. Examinesthemeasuringand accounting forlong-termdebtand Continuation ofACCNT210.Introduces Accounting Principles-Financial(5) ACCNT 220(F,W,Sp) statement ofowner'sequity. balance sheet,incomestatementandthe interpretation offinancialstatements:the Emphasis isonthedevelopmentand Accounting Principles-Financial(5) ACCNT 210(F,W,Sp,Su) and BUS110recommended). Prerequisite: ACCNT140or210(BUS101 and possibleusesofthisinformation. accounting reports,andtheinterpretation The majoremphasisisonthecontentof directed towardproceduresandtechniques. accounting cycle,withsomeattention perspective, thisclasswillreviewthe An accountingclassfromtheuser's Accounting forDecisionMakers(5) ACCNT 150 Prerequisite: ACCNT210witha"C"orhigher. use ofthestandardcostsystem. employed tocontrolcosts,suchas the manufacturing businessandthemethods determine productcostsofa budgeting process.Examinesmethodsto cost-volume-profit analysisandthe Introduction tocostconceptssuchas Accounting Principles:Managerial(5) ACCNT 230(F,W,Sp,Su) Prerequisite: ACCNT210witha"C"orhigher. payable andaccountsreceivablemodules. on experienceusinggeneralledger,accounts Includes analysis,demonstrationandhands- examine thecompleteaccountingcycle. software packageswillbeutilizedto methods usingmicrocomputers.Integrated An introductiontoautomatedaccounting Accounting I(5) Computer Applicationsin ACCNT 240(F) Prerequisite: ProgramChairpermission. public sectororganization. experience andtraininginaprivate or credits forhands-onaccountingwork year, studentsmayreceivecollege During onequarterofthesophomore Work Internship(5) ACCNT 290(F,W,Sp) affecting individuals. with specialemphasisontaxissues bookkeeper andsmallbusinessowner, accoun-ting student,workingaccountant/ Federal incometaxforthelayman, Federal IncomeTax(5) ACCNT 250(W) higher Prerequisite: ACCNT240withagradeof"C"or payroll applications. general ledger,accountspayableand computers. Thesesystemswillintegrate accounting systemusingthecollege's experience withatleastonecomputerized analysis, demonstrationandhands-on implemented onmicrocomputers.Includes An examinationofcomputerapplications Accounting II(5) Computer Applicationsin ACCNT 241(W) 141 orACCNT220withagradeof"C"higher. Prerequisite: CU102and103or105;ACCNT Course Descriptions 83 Prerequisite: Assessment at college-level English and reading. Prerequisite: Assessment at college-level English and reading. ADJ 152 Introduction to Civil Law (5) This course is designed to introduce the student to the foundations of civil law that include substantive and procedural issues, jurisdiction, the law of contracts, property law, family law, torts and personal injury, products liability, business law, estates and probate, and the legal profession. Classroom activities will include case analysis, the examination and assessment of legal documents, the examination of the Washington Uniform Commercial Code Title 62A, and relevant class projects pertaining to these areas. (writing intensive) Prerequisite: Assessment at college-level English and reading. ADJ 153 Civil Procedure (5) Students will be introduced to procedural requirements in the litigation process with an emphasis on skills and knowledge essential to the paralegal. Statutes and court rules will be examined as well as legal pleadings and documents for filing a lawsuit, discovery, pretrial motions, negotiation and pretrial conferences, the trial, and appeals. Prerequisite: Assessment at college-level English at college-level Prerequisite: Assessment and reading. ADJ 151 I (5) Legal Research and Writing simple, yet An introduction to developing legal effective methods of conducting and legal research by using general will participate reference material. Students include finding in a series of exercises that case decisions in regulations, statutes, and legal books and through computer-assisted problems; research; identifying legal legal shepardizing cases; researching encyclopedias, digests, reporters, and annotated codes. Primary, secondary, mandatory, and persuasive authority will be covered. Students will learn how to brief cases and prepare legal memoranda with emphasis on using reference material for Washington State. (writing intensive) legal community, paralegal organizations, legal community, responsibility, and professional ethics law, sources of American paralegal skills, for of law, and preparation specific areas the internship. ADJ 140 (F) Introduction to Corrections (5) An overview of corrections in the United States with special emphasis on: prisons, jails, case law, changing philosophy of punishment and future developments in penology. A field trip will highlight the course. Prerequisite: Assessment at college-level English and reading. ADJ 150 Paralegal Fundamentals and Ethics (5) Students will be introduced to the varied and rewarding responsibilities of a paralegal. Topics will cover careers in the ADJ 107 (F) Juvenile Justice System (5) In-depth examination of the magnitude of the juvenile delinquency problem, reviews of theories and philosophies that guide and direct our enforcement agencies, juvenile courts, juvenile corrections and treatment programs. Prerequisite: Assessment at college-level English and reading. Prerequisite: Assessment at college-level English and reading. ADJ 105 Ethical Issues in Law Enforcement (3) A seminar type course where intensive scenario-based workshops examine some of the most important ethical issues facing law enforcement. Topics within the police subculture and the dynamics of informal power are discussed. Recommended to be taken in conjunction with ADJ 103 (Community Policing). Prerequisite: Assessment at college-level English at college-level Prerequisite: Assessment and reading. ADJ 104(F) Power, Multiculturalism, and the Law (5) biases and This course examines personal the richness of the prejudices and explores Western diverse communities in of Washington. Consequences is focused discrimination when power are discussed. through the lens of prejudice from the law Issues are examined both perspectives. enforcement and community policing. Future trends of community- Future trends policing. and be presented policing will oriented to be course is recommended analyzed. This with ADJ 105 (Ethical taken in conjunction Enforcement). Issues in Law ADJ 103 (W) Community Policing (2) This course examines police/community relationships. Focus is on the most current models of community policing, including the community-oriented, strategic-oriented, neighborhood-oriented, and problem-oriented Prerequisite: Assessment at college-level English and reading. ADJ 102 (Sp) Criminal Procedure and Evidence (5) Discover kinds and rules of evidence, conclusions, opinions, and expert witness testimony. Discussion of Exclusionary Rule as it pertains to rules of search and seizure, criminal procedure, due process and Constitutional guarantees. Specific scenarios will be analyzed to ensure understanding of procedural due process as well as judicial due process. Prerequisite: Assessment at college-level English and reading. Criminal Law (5) Introduction to statutory law covering crimes against persons and property. Washington State law is emphasized regarding history of laws, common, and statutory law. Laws of arrest, act and intent, parties to crime, divisions of crime, principles and accessories, and penalties are covered. Course specific scenarios will be analyzed. ADJ 101 (F, W) History and evolution of the police History and evolution of profession; ethics and professionalization; the police, the the correlation between courts and corrections in the criminal justice system; court organization procedures and functions; survey of professional career opportunities and qualifications required; overview of current police practices. ADJ 100 (F, W, Sp, Su) Introduction to Administration of Justice (5) Administration of Law and Justice See page 54 for program requirements. See page 54 Automated Accounting Applications 84 Course Descriptions and reading. Prerequisites: Assessmentatcollege-level English of physicalevidencewillbeanalyzed. rule asitappliestoproceduraldueprocess evidence. Acloselookattheexclusionary analysis, andthelegaladmissibility of evidence collectiontechniques,methods of physical evidence.Coursefocusesonproper Advanced courseinthecollectionof Forensics (5) ADJ 201 and reading. Prerequisite: Assessmentatcollege-levelEnglish homicide, andsexcrimes. crimes againstpersons;i.e.assault, Special emphasisisplacedoninvestigating interviewing andinterrogationtechniques. evidence, crimescenerecording,and preservation, identification,recordingof techniques bypatrolofficers;collection students topreliminaryinvestigation This courseisdesignedtointroduce Criminal Investigation(5) ADJ 200 and reading. Prerequisites: Assessmentatcollege-levelEnglish sections ofthesecoursestowardadegree. the course.Studentsmayonlyapplytwo awarded iscontingentuponthelengthof correctional programevaluation.Credit diversity issues,criminalcaseanalysis,or crime analysis,legaltrends,cultural Areas coveredmayincludeinvestigations, based onneedandinteresttostudents. topics willbecovered.Topicsoffered Various shortcourses,seminars,orspecial Special Topics(2) ADJ 179(F,W,Sp) with stress. physical andmentalhealthwhilecoping course thatcoversthebasicsofmaintaining This isaself-paced,independentstudy Health/Dealing WithStress(1) ADJ 155 and reading. Prerequisite: Assessmentatcollege-levelEnglish software, willbecovered. computerization, commu-nicationsandlegal procedures, officeautomationand personnel, feestructure,standardoperating environment asitpertainstosupport paralegal/legal assistant.Theoffice offices isacriticalfunctionofthe The organizationandmanagementoflaw Law OfficeManagement(5) ADJ 154 leadership crisisandsolution. leadership andinvolvestudentsin course willalsoexaminecollaborative leadership traitswillbecovered.This leadership, andexamplesofineffective leadership, "GeneralX"perceptionsof commissioned policeofficers.Ethnic-based interacting andengagingwith Leadership skillswillbepresentedvia Police leadershipisalearnedtrait. Police Leadership(5) ADJ 202 Internship I,II(5,5) Law Enforcement/CriminalJustice ADJ 207,208(F,W,Sp,Su) and reading. Prerequisite: Assessmentatcollege-levelEnglish transportation, orconflictingschedules. regular basisbecauseofwork, campus orcannotvisittheona who liveconsiderabledistancesfrom independent studyformat.Idealforstudents justice fieldthroughaself-paced, interesting andcurrentissuesinthecriminal An opportunityforstudentstostudy Crime andJusticeinAmerica(3) ADJ 205(F,W,Sp,Su) classroom settingattheirownpace. added benefitofworkingoutsidethe meaningful andchallengingcoursewiththe those studentswhowishtoengageina independent studyformat.Itisidealfor juvenile delinquencythroughaself-paced, and studyinterestingcurrentthemesin juvenile justicesystemincurrentAmerica definitions andperceptionsapplicabletothe opportunity tograspandunderstand This courseisdesignedtoofferstudentsan Juvenile DelinquencyinAmerica(3) ADJ 204 and reading. Prerequisites: Assessmentatcollege-levelEnglish Program Chair'sapproval. placement. Studentsmustobtainthe or municipalcourtscanserveasafield well asprivateinstitutionsandlawoffices the justicefield.Stateandlocalagenciesas opportunity togainvaluableexperiencein The internshipprogramoffersstudentsthe and conflictresolution. violator contracts,arrests,reportwriting such asinterviewing,hostagenegotiations, course willincorporatenumerousactivities recruitment willalsobeexamined.This authority, policediscretion,and oriented policing,policetraining,abuseof evaluated. Issuesinvolvingcommunity- be comparedandtheireffectiveness covered. Contemporarypoliceagencieswill and problemsofpoliceworkwillbe Historical development,roles,socialization Police inAmerica(5) AJD 211 and reading. Prerequisites: Assessmentatcollege-levelEnglish Enforcement CommunicationSkills). concurrently withADJ212(Law hostility. Recommendedtobetaken would benefitanyonewhoneedstodiffuse situations; however,theacquiredskills based ontypicallawenforcement experienced negotiator.Scenariosusedare hostile encountersbyworkingwithan necessary verbalskillstode-escalate This coursefocusesonthedevelopmentof De-escalation Techniques(2) ADJ 209 and reading. Prerequisite: Assessmentatcollege-level English be usedinclass. also willbecovered.Severalexercises will failures. Discussionofcurrentpolicetactics delinquency programs-theirsuccessesand Emphasis willbeonananalysisof institutional responsesandpublicpolicy. its socialcontext,theyouthfulsubculture, include thehistoryofjuveniledelinquency, Survey ofjuvenilejusticeprogramswill Delinquency (5) Prevention andControlof ADJ 213(Sp) and reading. Prerequisite: Assessmentatcollege-levelEnglish Escalation Techniques). taken concurrentlywithADJ203(De- report writingskills.Recommendedtobe practice observation,interviewingand confessional/verbal evidence.Studentswill properly documentingpotentiallyuseful This isanadvancedcourseinanalyzingand Skills (3) Law EnforcementCommunication ADJ 212 Course Descriptions 85 Prerequisite: Assessment at college-level English and reading. Prerequisite: Assessment at college-level English and reading. ADJ 230 Business Organization/Corporations (3) Today's business owners may choose among a variety of business entities for business formation. Besides the traditional sole proprietorship, partnership, and corpo- ration, owners may form limited liability companies and limited liability partnerships. Students will learn about the different rela- tionships, rights, obligations, and regulatory schemes of the various entities. In corporate law, students will develop knowledge and skill in preparing articles of incorporation, drafting corporate bylaws, preparing min- utes of corporate meetings, drafting share- holder proposals, reviewing documents relat- ing to the sale of corporate securities, as- sisting with corporate mergers and acquisi- tions, and filing papers necessary to termi- nate a corporation. ADJ 228 (3) Labor Law and Employment and labor law includes laws Employment and safety in the governing health unions and union- workplace, labor relations, employment management wrongful employment discrimination, and pension plans, retirement termination, Security), employee disability income (Social wage, and privacy rights, the minimum will research overtime wages. Students compensation Washington State workers' agencies where statutes and learn about clients during paralegals may represent agency hearings. college-level English Prerequisite: Assessment at and reading. ADJ 229 Intellectual Property Law (includes e-commerce) (3) Intellectual property results from intellectual, creative processes. Copyrights, patents, trademarks, and trade secrets are examples. The ownership rights of today's high-tech products need protection. Students will develop knowledge and skill in conducting research on patent or trademark protection of an invention, drafting documents to apply for protection, drafting contracts or licensing agreements, and in assisting in litigation resulting from the infringement of a right. Prerequisite: Assessment at college-level English and reading. Prerequisite: Assessment at college-level English and reading. ADJ 227 Environmental Law/Land Use (3) Environmental law covers all state and federal laws or regulations enacted to protect the environment and preserve environmental resources. Students will develop knowledge and skills for the coordination of corporate programs and policies to ensure compliance with environmental regulations, for obtaining permits from governmental agencies for land use issues, for preparation of forms and documents relating the hazardous waste disposal, and for assisting in litigation relating to violations of environmental laws. Prerequisite: Assessment at college-level English and reading. ADJ 226 Administrative Law (3) Administrative law consists of the rules, orders, and decisions of administrative agencies at all levels of government. Students will learn how to research and analyze agency regulations to assist clients in their business activities, clients pursuing a claim against an employer, or clients seeking government benefits. Prerequisite: Assessment at college-level English Prerequisite: Assessment at and reading. ADJ 225 Bankruptcy Law (3) law with the Bankruptcy law is federal in the federal court proceedings taking place about the system. Students will learn both individuals various types of relief for gain knowledge and busi-nesses. They will and skills necessary for interviewing the debtor, reviewing creditors' claims, and preparing the documents for submission to the bankruptcy court. ADJ 224 (3) Law Real Estate as to law and legal systems An introduction estate transactions. Major related to real forms of ownership; title, topics include and insurance; fraud, deceit transfers and contract law and misrepresentation; real estate security documents; documents; of licensees. and duties and liabilities Prerequisite: Assessment at college-level English and reading. Alternative Dispute Resolution is a method of resolving disputes before they go to trial. Negotiation, mediation and arbitration are forms of ADR. Paralegals may qualify as mediators and directly assist parties in reaching an agreement. Other paralegals will assist attorneys in this fast growing method of settling disputes. Students will become familiar with the ADR laws in Washington State. ADJ 223 Alternative Dispute Resolution (ADR) (3) Prerequisite: Assessment at college-level English and reading. Probate/Estate Planning (3) Estate planning involves the financial and healthcare arrangements that are made during a person's lifetime as well as the preparation for transfer of that person's assets at death. Probate is the process of proving the validity of a will and ensuring that the instructions in a valid will are carried out. Students will develop knowledge and skills for the drafting of wills and trusts and for the procedural requirements of the probate process. Prerequisite: Assessment at college-level English and reading. ADJ 222 Family Law (3) a basic The Family Law course provides for disso- understanding of the procedures child support lution (divorce), child custody, and paternity actions, third party custody, familiar with issues. Students will become and state and Washington State statutes local court rules concerning marriage and divorce procedures, child support, and related issues. Students will learn the proper pleadings and the court rules for each type of case, from the standpoint of representing both the petitioner and the respondent. Prerequisite: Assessment at college-level English Prerequisite: Assessment at and reading. ADJ 221 This class emphasizes the civil rules of the civil rules This class emphasizes and the State of Washington procedure for The rules for Pierce County. the local civil logically through the curriculum moves trial covering discovery, litigation process and post-trial relief. preparation, ADJ 220 (3) Litigation 86 Course Descriptions maximum 5errors. Business PCcourse;andtypingat50wpmwith and reading;completionofCU105orapproved Prerequisites: Assessmentatcollege-levelEnglish Chair's approvaltoenroll. facilities. StudentsmustobtaintheProgram corporations canserveasfieldplacement and localagencies,legaldepartmentsof the paralegalprofession.Lawoffices,state opportunity togainvaluableexperiencein The internshipprogramoffersstudentsthe Program I,II(5,5) Internship Paralegal/LegalAssistant ADJ 233,234(F,W,Sp,Su) and reading. Prerequisites: Assessmentandcollege-levelEnglish with expertwitnesses. interviews; andlocate,evaluatework identify andlocatewitnesses;conduct plan aninvestigation;handleevidence; through aninvestigationbylearninghowto resources. Studentswillwalkstepby investigating, particularlyInternet the useofresourcesavailablefor communication skillsforinterviewingand emphasis isplacedonthedevelopmentof investigating skillsareutilized.Great contexts inwhichinterviewingand Students areintroducedtothelegal Interviewing andInvestigation(3) ADJ 232 and reading. Prerequisite: Assessmentatcollege-levelEnglish contract dispute. drafting asettlementlettertosettle in litigationofabreachcontract,and decisions inthelocaljurisdiction,assisting contract, researchingcontractcase has metalloftherequirementsforavalid reviewing acontracttomakesurethatit in thegenerallawofcontractsby students willdevelopknowledgeandskill RCW 62Aforthesaleofgoods.Also become familiarwiththerequirementsof Commercial Code(UCC).Studentswill that arebasedonArticle2oftheUniform of goods,aregovernedbystatestatutes Sales contracts,orcontractsforthesale Commercial Transactions(3) ADJ 231 evaluate theprogram. the changesinparalegalprofession;and of Ethics;searchthejobmarket;research resumes andself-evaluations;reviewCodes update theirportfolios,whichcontain they completetheprogram.Studentswill Students takethiscourseshortlybefore Transition Planning(1) ADJ 239 certification inthis220-houracademy. They mustpassthestateexaminationfor emergency vehicleoperation,andmore. procedures, communicationskills,firearms, criminal lawandprocedures,traffic,patrol Students engageinpolicetrainingcovering may applyforadmissiontotheAcademy. Commission. Agency-sponsoredstudents Washington StateCriminalJusticeTraining certification issuedandapprovedbythe Basic LawEnforcementReserveAcademy This courseallowsstudentstoobtaintheir Reserve PoliceAcademy(18) ADJ 290(F,Sp) Prerequisites: ADJ151. gies foreffectivewriting. citation oflegalresources,andstrate- shepardizing, formattingofdocuments, mary andsecondaryauthorities, sis isplacedonin-depthresearchofpri- pare acasefortrialandappeal.Empha- skills acquiredinADJ151,studentspre- Building ontheresearchandwriting Legal ResearchandWritingII(3) ADJ 251(Sp) and reading. Prerequisite: Assessmentatcollege-levelEnglish also beexamined. effectiveness ofparoleandprobationwill history ofparole,paroleboardandselection, probation andparole,itsrevocation.The of probationservices,supervision decision tograntprobation,administration foundations ofprobation,sentencingandthe This coursecoversthehistoryandlegal Parole andProbation(5) ADJ 240 and reading. Prerequisites: Assessmentatcollege-levelEnglish 253.566.5076. Prerequisite: Obtainapplicationfromsecretary, assessment throughoutthequarter. continuous enrollmentwithstudent WorkFirst participants.Theprogramoffers fits theneedsandrequirementstoserve curriculum. Workplaceliteracycurriculum literacy areanintegralpartofthe and writing.Workplaceliteracyfamily in theskillareasofreading,mathematics, Competency Indicators.Therearesixlevels mandated WashingtonStateBasicSkills competency-based andfollowsthe workforce. TheABEcourseofferingis study, aswelltobemoreeffectiveinthe Completion and/ordevelopmentallevelof in ordertoprogresstheGED,HighSchool reading, mathematics,writingandlifeskills for studentswhoneedtobuildskillsin This no-fee,no-creditprogramisdesigned Adult BasicEducation ABE 01/02/03/04/05/06 Education Adult Basic standard lectureformatofstudy. projects approvedbytheinstructorora Special projectscouldincludeindividual course intheirconcentrationareaofstudy. Students mayelecttotakeoneADJ299 relating tojusticeandlegalfieldsofstudy. variety oftopicscontemporaryinterest This specialprojectscoursewillcovera Special Projects(5) ADJ 299(F,W,Sp,Su) throughout thequarter. enrollment withstudentassessment participants. Theprogramofferscontinuous and requirementstoserveWorkFirst Workplace literacycurriculumfitstheneeds Basic SkillsCompetencyIndicators. that correspondtotheWashingtonState citizenship. TherearesixABE-ESLlevels mathematics, writing,lifeskillsand/or and familyliteracy,ABEskillsinreading, level skills,whoneedtraininginworkplace who areassessedtohavepre-developmental for EnglishasaSecondLanguagestudents This no-fee,no-creditprogramisdesigned English asaSecondLanguage ESL 11/12/13/14/15/16 Course Descriptions 87 Prerequisite: BIOL 100 or BIOL 118 or ANTHR 201. ANTHR 299 Independent Study (1-5) Independent observation, analysis and reporting of a selected problem in anthropology. Prerequisite: Instructor permission. Models for Human Evolution: The Living Primates (5) Examines the origins and evolutionary trends of the order Primates, from modern taxonomic relationships to ontogeny, behavioral and morphological adaptation, socioecology and conservation. Uses lectures, slides, labs, and readings to compare and contrast the major groups of non-human primates, consider their relationships to humans, and provide perspective on the status of endangered species, with which we may share a future as well as a past. Field trip included. Prerequisite: ANTHR 201. ANTHR 280 (W) Human Osteology and the Fossil Record An introduction to the human skeleton and its place among other mammalian and vertebrate forms. This course covers the morphology of teeth and bones. It explores various methods of identifying a human skeleton, and of age and sex determination. Other topics include bone development, fossilization, and human evolution. ANTHR 205 ANTHR (5) of Archaeology Principles to the study of the prehistory Introduction as revealed by material of humankind excavation techniques, remains. Covers survey dating artifacts, and a analyzing and of from the beginning of world prehistory appearance of writing. culture to the ENGL 91 with a "C" or Prerequisite: Completion of reading and higher or assessment at college-level writing. ANTHR 210 (5) Native American Cultures of cultures An examination of the diversity America, this among the Indians of North survey of Native course is an ethnographic European contact. American societies before (multicultural content) Prerequisite: Completion of ENGL 91 with a "C" or higher or assessment at college-level reading and writing. ANTHR 270 (Sp) Prerequisite: Completion of ENGL 91 with a "C" or higher or assessment at college-level reading and writing. Prerequisite: Completion of ENGL 91 with a "C" or higher or assessment at college-level reading and writing. ANTHR 203 Introduction to Linguistic Anthropology (5) Introduction to linguistic methods and theories used within anthropology. Topics include the structure of language, evidence for the innateness of language, the relationship between language and culture, the ethnography of communication, sociolinguistics, and historical linguistics. The linguistic database in the course is both historical and cross-cultural. (multicultural content) Principles of (5) Physical Anthropology Study of the origins and adaptations of the human species. An examination of the fossil record and living populations of monkeys, apes, and humans. (multicultural content) Prerequisite: Completion of ENGL 91 with a "C" or higher or assessment at college-level reading and writing. ANTHR 202 (F, W, Sp) Principles of Sociocultural Anthropology (5) An analysis of the social and cultural variation of humankind. Comparison of how various western and non-western peoples live. (multicultural content) A survey of the subfields of physical A survey of archaeology, anthropological anthropology, sociocultural anthropology linguistics and examination of selected through the and cultural problems in human biological to the discipline of evolution. An introduction it means to be anthropology that asks what human. (multicultural content) ENGL 91 with a "C" or Prerequisite: Completion of reading and higher or assessment at college-level writing. ANTHR 201 (F, W, Sp) Anthropology (F, W, Sp) ANTHR 100 to Anthropology (5) Introduction American Sign Language IV (5) A continuation of SIGNL 122, American Sign Language III, with more advanced vocabulary and conversational dialogues. Students will be introduced to advanced grammatical uses of ASL; how sign movement can be modified to change meaning, how and when facial expressions ocur; and how body, head and eye movements are used in phrasing and agreements. (multicultural content) SIGNL 123 (Sp) Prerequisite: SIGNL 121 or equivalent with a "C" or higher. SIGNL 122 (Sp) American Sign Language III (5) A continuation of ASL II, a study of American Sign Language (ASL), its use, and the culture of the people who use it. (multicultural content) Prerequisite: SIGNL 120 or equivalent with a "C" or higher. American Sign Language II (5) A continuation of ASL I with greater emphasis on American Sign Language grammar with concentrated effort on expressive and receptive skills. Includes broadening of cultural awareness. (multicultural content) SIGNL 121 (W) American Sign Language I (5) American Sign Language Sign A beginning course in American the student to Language (ASL) to introduce the language and culture of the hearing impaired. (multicultural content) SIGNL 120 (F) See page 43. Sign American Language American and Ethnic Studies Gender Certificate Program 88 Course Descriptions for credit. photographing anystudentworksubmitted temporarily retainforexhibitor instructor ofthatcourse. arrange foroptionalstudieswiththe reason, tostudyofthenudemodelmay courses whomayobject,forwhatever studies. Anystudentenrolledinoneofthese nude, maybeincorporatedintothese study. Thehumanmodel,sometimesinthe courses, thehumanformisasubjectof or universityoftheirchoice. should checktherequirementsofcollege program. Studentswhoplantotransfer Department forhelpinplanningyour every otheryear,etc.ContacttheArt are offeredonalimitedbasisonceyear, courses offeredatTCC. the foundationforadvancedart courses (ART102,103,105).Theseform concentrate onbasicdesignanddrawing art-related vocationshouldinitially Students whoareinterestedinan HistoryofWesternArt:Baroque ART 203 HistoryofWesternArt: ART 202 HistoryofWesternArt:Ancient ART 201 AppreciationoftheVisualArts ART 100 requirements. Theyhavenoprerequisites. recommended forHumanitiesdistribution The followingarelecture-orientedcourses Sculpture Beginning ART 172 Painting Beginning ART 156 Printmaking Beginning ART 150 Photography Beginning ART 146 Ceramics Beginning ART 131 BasicJewelry:Casting ART 118A BasicJewelry:Construction ART 117A Drawing Beginning ART 105 Design Three-Dimensional ART 103 Design Two-Dimensional ART 102 Basics Art ART 101 distribution creditfortheAASdegree. Note: Fivecreditsofstudiocoursesmaybeusedas courses andhavenoprerequisites. areas ofart.Theyarebeginningstudio students whowishtoexploreoneormore The followingcoursesaredesignedfor Art The collegereservestherightto In painting,drawingandsculpture Some ofthecourseslistedincatalog through Modern andRenaissance Medieval reading andwriting. Strongly recommendassessmentatcollege-level Appreciation oftheVisualArts(5) ART 100(F,W,Sp) category. Maximumof5credits. for AASdegreeunderperformance/skills Satisfies humanitiesdistributionrequirement as appliedinthree-dimensionalmaterials. (contour, volume,space,light,andtexture) Organization ofvisual-physicalelements Three-Dimensional Design(5) ART 103(F,W) graphic softwaretocompleteprojects. credits. Theonlineversionofthisclassuses performance/skills category.Maximumof5 requirement forAASdegreeunder classes.Satisfies humanitiesdistribution to PaintingandPrintmaking dimensional designmedia.Recommendprior shape, texture,color)asappliedintwo- The organizationofvisualelements(line, Two-Dimensional Design(5) ART 102(F,W,Sp) of 5credits. under performance/skillscategory.Maximum distribution requirementforAASdegree for beginners.Satisfieshumanities with limitedexperienceinart.Recommended design. Projectsaredesignedforstudents including drawing,painting,printmakingand Introduction tomaterialsandtechniques Art Basics(5) ART 101(F,W,Sp) hands-on participation. artists, fieldtrips,demonstrations,and may includelectures,slides,videos,guest requirement. Avarietyoflearningapproaches 5 creditsforHumanitiesdistribution media. Designedfornon-artmajors.Satisfies Arts -FineArts,Crafts,Architecture,new understanding andappreciationoftheVisual An introductorycoursetoguidethe Maximum of5credits. degree underperformance/skillscategory. humanities distributionrequirementforAAS composition, perspectiveandform.Satisfies techniques andmediathroughthestudyof General explorationofvariousdrawing Beginning Drawing(5) ART 105(F,W,Sp) 117E: JewelryConstructionID-Filigree 117D: 117C: 117B: JewelryConstructionIA-Basic 117A: Construction (2,max.10) Basic Jewelry: ART 117(F,W,Sp) Prerequisite: ART105. category. Maximumof5credits. AAS degreeunderperformance/skills humanities distributionrequirementfor communication concepts.Satisfies emphasis oncompositionand Further developmentofdrawingskillswith Drawing (5) ART 106(F,W,Sp) 105 arerecommendedforalldesignprograms. 117B, 117C,117Dand117E.ART102,103, Prerequisite: ART117Aisbasicrequirementfor category. Maximum5credits. degree underperformance/skills distribution requirementforAAS etc.) Satisfieshumanities (enamel highlights,granulation, accent andenhancejewelry surface techniquesandfinishesto Jewelry ConstructionIE-Special category. Maximum5credits. degree underperformance/skills distribution requirementforAAS techniques. Satisfieshumanities manipulation andmultiplesoldering design throughdelicatewire techniques: creatinglinearjewelry Maximum of5credits. performance/skills category. requirement forAASdegreeunder Satisfies humanitiesdistribution hammering andannealing. dimensional jewelryformsby techniques: creatingmorethree- Jewelry ConstructionIC-Forging Maximum of5credits. performance/skills category. requirement forAASdegreeunder Satisfies humanitiesdistribution advanced solderingproblems. fabrication techniquesand experience inusingsheetandwire: Jewelry ConstructionIB-Further category. Maximumof5credits. degree underperformance/skills distribution requirementforAAS polishing. Satisfieshumanities filing, sawing,solderingand and wire:techniquesofpiercing, forming ofjewelrythroughsheet Course Descriptions 89 Prerequisite: ART 151 and 102. ART 102, 103, and 105 recommended for all studio concentra- tions. Prerequisite: None. ART 102, 103, and 105 recommended for all art studio concentrations. ART 151 (F, Sp) Intermediate Printmaking (5) Refining of basic procedures learned in ART 150 with attention to experimentation with materials, color and design applications for poster, fabric and illustration products. A continuing study of historical and cultural roles of printmaking with attention to individual artistic contributions. Prerequisite: ART 150. ART 102, 103, and 105 recommended for all studio concentrations. ART 152 (Sp) Intermediate Printmaking (5) Printmaking design for fabric, decorative paper products and poster. Students develop procedures in designing for particular products, taking into consideration the print method, economy of color, repeating design patterns, and selections of appropriate materials. Students are introduced to the historical and cultural development of printed fabric, poster design, and paper products. ART 146 (F, W) ART 146 (5) Photography Beginning still photography. Basic black-and-white still cameras, developing Includes operating also prints. Attention is film and making aesthetics of photographic given to the The lighting, etc. imagery, composition, have an adjustable camera student must paper and and provide film, printing humanities incidental supplies. Satisfies for AAS degree distribution requirement category. under performance/skills 5 credits maximum. ART 150 (Sp) (5) Beginning Printmaking at college-level Strongly recommend assessment reading. techniques and Studies in traditional print processes including relief, etching, and lithographic methods. Historical and contemporary print developments serve as background material for technical application. Satisfies humanities distribution requirement for AAS degree under performance/skills category. Maximum of 5 credits. (multicultural content) ART 135 (F, Sp) Innovative Ceramics (5) A ceramics course designed to study primitive techniques and materials and their application to contemporary ceramics. Use of handmade, improvised, and found tools. Innovative firing techniques will be used to approximate the look of traditional firing methods. Experiments in combining old and modern techniques and materials will be encouraged. Prerequisite: ART 131 or instructor permission. ART 102, 103, and 105 recommended for all studio concentrations. ART 132, 133 (F, W, Sp) Intermediate Ceramics (5, 5) Further development of ceramic techniques: hand-built and/or wheel-thrown forming techniques, more advanced glazing and decorative techniques. Theory and practice in kiln loading and firing will be covered as part of ART 133. Prerequisite: ART 131 for 132; ART 132 and ART 102 (or 103 or 105) for 133. ART 102, 103, and 105 recommended for all studio concentrations. ART 131 (F, W, Sp) Beginning Ceramics (5) Introduction to creating ceramic forms using hand-building and wheel-throwing techniques. Student will learn the basic forming methods employed in making ceramic forms, and basic glazing and decorating techniques will be covered. Satisfies humanities distribution requirement for AAS degree under performance/skills category. Maximum of 5 credits. ART 122 (Sp) (3) Advanced Web Graphics a series of three This is the third course in Web Graphics courses which focuses on The course software and its applications. web graphic content will reflect current class as IT 122. trends. This is the same IT 122 or ART Students may take either 122, but not both. ART 121 (Sp) ART 121 (5) Intermediate Flash anima- class on web This is an intermediate The on interactive design. tion that focuses while use web animation tools student will and to organize information learning how systems that help create navigational is the through content. This viewers navigate may take same class as IT 121. Students but not both. either IT 121 or ART 121, Jewelry Casting IA - Introduction Jewelry Casting method for to the lost-wax includes creating jewelry: in techniques for instruction wax model from making the and basic casting various waxes lost-wax principles involved in the method. Satisfies humanities for AAS distribution requirement degree under performance/skills 5 credits. category. Maximum of and Jewelry Casting IB - Carving to form wax build-up techniques forms three-dimensional jewelry Satisfies (e.g., rings, bracelets.) humanities distribution under requirement for AAS degree performance/skills category. Maximum of 5 credits. wax build-up techniques to create figurative forms and detail as applied to jewelry (e.g., charms, pendants, etc.) Satisfies humanities distribution requirement for AAS degree under performance/skills category. Maximum of 5 credits. and casting techniques used to create precision fit and interlocking forms in jewelry design. Satisfies humanities distribution requirement for AAS degree under performance/ skills category. 5 credits maximum. joining and soldering pre-cast jewelry pieces. Satisfies humanities distribution requirement for AAS degree under performance/skills category. 5 credits maximum. Introduction to Animation (5) An introductory course for traditional and computer animation history and techniques. Students will learn key points in history of American animation, animation techniques from historical to current periods, including use of computer animation software. This is the same class as IT 120. Students may take either IT 120 or ART 120, but not both. ART 120 (W) Prerequisite: ART 118A is the basic requirement for 118B, 118C, 118D, and 118E. ART 102, 103, and 105 are recommended for all studio concentrations. 118B: 118C: Jewelry Casting IC - Carving and 118D: Jewelry Casting ID - Model building 118E: Jewelry Casting V - Techniques for 118A: ART 118 (F, W, Sp) ART 118 max. 10) Casting (2, Jewelry: Basic 90 Course Descriptions mended forallstudioconcentrations. 105 for174.ART102,103,andrecom- Prerequisite: ART172for173;173and103or materials, techniques,toolsandapproaches. Further experienceinsculpturedesign, Intermediate Sculpture(5,5) ART 173,174(F,W,Sp) category. Maximumof5credits. for AASdegreeunderperformance/skills Satisfies humanitiesdistributionrequirement modeling, carving,casting,andfabrication. variety inapproachestosculpturalform- tools. Emphasisondiversityofmaterialsand Sculpture design,materials,techniquesand Beginning Sculpture(5) ART 172(F,W,Sp) 10 credithours. composition. Thiscourseisrepeatableupto form development,expression,andfigure nude) withemphasisoncoloranditsrolein Painting fromtheposedmodel(clothedand Figure Painting(2,max.10) Life Studies: ART 162(F,W,Sp) ness, andexplorationoffigurecomposition. anatomy, developmentofformconscious- nude) includinganintroductiontosurface Drawing fromtheposedmodel(clothedand Figure Drawing(2,max.10) Life Studies: ART 161(F,W,Sp) 105 or102for158. Prerequisite: ART156for157.157and painting. color andcompositioninrepresentation Further experiencesinpaintingtechniques, Intermediate Painting(5,5) ART 157,158(F,W) recommended forallstudioconcentrations. Prerequisite: None.ART,102,103,and105are of 5credits. under performance/skillscategory.Maximum distribution requirementforAASdegree individual expression.Satisfieshumanities fundamentals providethegroundworkfor materials, techniques,color,anddrawing of representationalpainting.Painting Introduction tobasicprinciplesandmethods Beginning Painting(5) ART 156(F,W) Graded S/U. reports. Maybetakenatotalofthreetimes. view lecturesandwriteaseriesofshort local galleriesandmuseumsattendor and Humanitiesclasses.Studentswillvisit skills, andapplytheconceptstaughtinArt vocabulary, sharpentheircriticalthinking where studentscandeveloptheirvisual courses andisdesignedasa"viewinglab" 103. ART199supplementstheabove all artclassesandHUMAN100,101,102, Recommended concurrentenrollmentwith Gallery ViewingLab ART 199(varies) through Modern(5) History ofWesternArt:Baroque ART 203(Sp) completion ofREAD93witha"C"orhigher. Prerequisite: Assessmentatcollege-levelreadingor ties distributionrequirementforAASdegree. through the16thCentury.Satisfieshumani- Christendom fromtheBarbarianInvasions The majorartisticachievementsofWestern Renaissance (5) History ofWesternArt:Medievaland ART 202(W) completion ofREAD93witha"C"orhigher. Prerequisite: Assessmentatcollege-levelreadingor distribution requirementforAASdegree. Byzantine eras.Satisfieshumanities prehistoric timesthroughtheRomanand the nearEast,andNorthAfricafrom The majorartisticachievementsinEurope, History ofWesternArt:Ancient(5) ART 201(F) 253.460.4306 withanyquestions. are requiredandpartofthefinalgrade.Call quarter; Meeting#2atmid-quarter.Thesemeetings required: Meeting#1inthefirsttwoweeksof Bookstore. Twomeetingswithinstructorare Course packetmaterialsareavailableintheTCC Note: Thisclassisaself-pacedlaboratorycourse. completion ofREAD93witha"C"orhigher. Prerequisite: Assessmentatcollege-levelreadingor requirement forAASdegree. present. Satisfieshumanitiesdistribution of Westernculturefrom1600tothe The developmentandexpansionofthearts 1D JewelryConstructionIID-Inlaying 217D: JewelryConstructionIIC-Basic 217C: JewelryConstructionIIB-Facetted 217B: JewelryConstructionIIA-Bezel 217A: Jewelry Construction(2,max.8) ART 217(F,W,Sp) Prerequisite: ART103. Maximum of10credithours. and theproperuseoftoolsmaterials. wood. Emphasisondesign,craftsmanship, decorative three-dimensionalartformsin and fabricationappliedtofunctional Woodworking techniquesofcarving,tooling, Wood (5,max.10) Design andMaterials: ART 215(F,W) Prerequisite: ART102. advanced studiesintwo-dimensionalmedia. Exploration ofcolorasafoundationfor Color andDesign(5) ART 210(W) recommended forallstudioconcentrations. instructor permission.ART102,103,and105 Prerequisite: ART118series;or118Aand JewelryCastingIID-Designand 218D: JewelryCastingIIC-Facettedstone 218C: JewelryCastingIIB-Bezelsetting 218B: JewelryCastingIIA-Free-form 218A: Jewelry Casting(2,max.8) ART 218(F,W,Sp) recommended forallstudioconcentrations. instructor permission.ART102,103,and105 Prerequisite: ART117series;or117Aand into themetalsurface. techniques: embeddingstones,etc. shaped stones. principles formountingirregular stones withafour-prongmounting. stone setting:settingfacetted within anenclosedmetalmounting. setting: settingaround-cutstone techniques. making, cutting,andwaxinjection processes forduplication:mold jewelry forms. setting (prongmounting)incast in castjewelryforms. etc. incastjewelryforms. prong settings)ofstones,pearls, mountings (otherthanbezeland Course Descriptions 91 Prerequisite: Students must claim their intent to major in art and must have completed two of the three following courses: Art 102, 103, or 105. Instructor permission required. ART 296 (varies) Special Projects in Art (2) This course involves special group efforts which grow out of departmental need or artistic opportunity. The course will be offered as each project is identified. The number of participants would be limited by the nature of the project, and involvement would be subject to the applicant's background coursework and the instructor's approval. ART 297 (F, W, Sp) Folio Preparation (1) Designed to help students select, develop, and prepare a portfolio of work for application to a transfer institution. Students will be advised regarding their selections of samples, revisions and skill areas needing attention. Students will learn to photograph samples, mat and frame appropriate samples, develop special projects, and put together an organized presentation. ART 274 (F) ART 274 Techniques Fabrication Sculpture: (5, max. 10) to building sculptural forms Introduction and of materials, techniques, through the use modern industry - woodworking equipment of metal working tools and machinery, other brazing, etc.), and techniques (welding, are joined to build processes where materials craftsmanship are up forms. Good design and credits. stressed. Maximum of 10 102, 103, and 105 are Prerequisite: ART 174. ART concentrations. recommended for all studio ART 275 (Sp) Sculpture: Bronze Casting (5, max. 10) Concentration on wax manipulation making, and techniques, model and mold foundry procedures for casting metals through the lost-wax method. For additional experience and credit, this course may be repeated. Maximum 10 credits. Prerequisite: ART 174 and ART 103 or 105. ART 102, 103, and 105 recommended for all studio concentrations. Prerequisite: ART 174. ART 102, 103, and 105 recommended for all studio concentrations. ART 273 (F) Sculpture: Carving (5, max. 10) Introduction to tools, techniques, and materials used in the carving approach to sculpture, design and craftsmanship. Maximum of 10 credits. Prerequisite: ART 174. ART 102, 103, and 105 recommended for all studio concentrations. ART 272 (W) Sculpture: Modeling and Casting (5, max. 10) Basic experience in direct modeling, in the construction of molds and in the casting of various materials. Design, craftsmanship, and the proper use of tools and materials. Maximum of 10 credits. Prerequisite: ART 158 for 256; 256 for 257. ART 102, 103 and 105 recommended for all studio concentrations. ART 258, 259 (Su) Watercolor (5, 5) Development and broadening of technical skills and knowledge regarding watercolor tools and materials and their application to self-expression. Watercolor media used for sketching studies, for visualization processes and for final expression. Forms, methods selection, and interpretation of subject matter is encouraged. Prerequisite: ART 152 or instructor permission. Prerequisite: ART 152 or instructor for all studio ART 102, 103, and 105 recommended concentrations. ART 256, 257 (F, W) Painting (5, 5) and response to Individual interpretation to technical painting themes. Introduction of painting variations in the application media (oil or acrylic) and to personal expression. Formulating and developing images and ideas in sketchbook activities as preparation to painting. ART 251 (varies) ART 251 (5) Printmaking-Etching and contemporary etching Traditional and metal, techniques applied to related intaglio constructed plates. Selection plastic, and of paper and inking and properties studied. Historical and techniques are developments serve as contemporary technical background material for application. Prerequisite: ART 146 or instructor permission. ART 102, 103, and 105 recommended for all studio concentrations. Second quarter of black-and-white photography or introduction to color. The course emphasizes development of photographic vision and technical proficiency including composition and light, refinements of camera and light meter operation, development and printing techniques. Individual direction encouraged. Students must have an adjustable camera and provide film, paper and incidental supplies. ART 246 (Sp) Intermediate Photography (5) Prerequisite: ART 133 and ART 102 (or 103 or 105) or instructor permission. ART 102, 103, and 105 recommended for all studio concentrations. Ceramic Sculpture (5) The course will concentrate on clay as a medium for expression through purely sculptural forms. The ART 230 series is taught as a series of ceramic design courses offering experience in both hand-building and throwing on the wheel in a sequence of increasing involvement and difficulty. ART 233 (Sp) Prerequisite: ART 133 and ART 102 (or 103 or 105) or instructor permission. ART 102, 103, and 105 recommended for all studio concentrations. Surface Embellishment and Surface Embellishment Form Alteration (5) on the Course work will concentrate various alteration of forms and the techniques for surface textures. The student should be competent in the ability to make basic shapes to use on the techniques assigned. The ART 230 series is taught as a series of ceramic design courses offering experience in both hand-building and throwing on the wheel in a sequence of increasing involvement and difficulty. ART 232 (W) Prerequisite: ART 133 and ART 102 (or 103 or Prerequisite: ART 133 and ART 105) or instructor permission. Students will explore the possibilities Students will ceramics. Traditional available in low-fire Majolica and burnished forms such as non- will be used as well as earthenware is The ART 230 series traditional styles. courses series of ceramic design taught as a hand-building and offering experience in both a sequence of throwing on the wheel in difficulty. increasing involvement and ART 231 (F) ART 231 (5) Ceramics Low-fire 92 Course Descriptions 106, 145,179. 108, 118,140,161,BOT101orENVSC non-major courses:BIOL100,105,107, requirements shouldconsiderthefollowing interest ornaturalsciencesdistribution Students seekingcoursesforgeneral for assistanceinestablishingadegreeplan. Specialization. Biologyadvisorsareavailable of SciencedegreewithaBiology Sciences, OptionBdegreeoranAssociate pursuing eitheranAssociateinArtsand related disciplineshavetheoptionof Students interestedinmajoringbiologyor Biology probes. Laboratoryincluded. from ancientastronomerstocurrentspace notes thehistoricalmilestonesofastronomy characteristics oflightandtelescopes; evolution ofstars;thenatureand asteroids, andcomets;theformation characteristics oftheplanets,moons, including theformationofsolarsystem; Introduces basicconceptsinastronomy Astronomy (5) ASTRO 105(F,Sp,Su) Astronomy Jewelry 299J Watercolor 299I Sculpture 299H Printmaking 299G Photography 299F Painting 299E FigureDrawing 299D Drawing 299C Design 299B Ceramics 299A 105 and106. Problems inDrawing,hasaprerequisiteofART particular medium.Example:299C,Advanced sequence offeredbythedepartmentinthat the satisfactorycompletionofentirecourse Prerequisite toregistrationforany299classis permission oftheinstructor. the sequencechosen.All299classesrequire same feesastheindividualcourseswithin course sequencesandaresubjecttothe These coursesareanextensionofexisting Special ProblemsinArt(5) ART 299(F,W,Sp) physiology. Laboratoryincluded. and anoverviewofhumananatomy/ genetics; ecologyandenvironmentalissues; biochemical processes;evolutionand diversity oflife;basiccellularanatomyand starting inlifesciences.Topicsinclude: principles fornon-majorsorstudents A one-quarterintroductiontobiological Introduction toBiology(5) BIOL 100(F,W,Sp) Northwest PlantsandAnimals(5) BIOL 108 courses. the biologyprerequisiteforall200level BIOL 107isequivalentto100andsatisfies tory included. genetics, andthebiologyofdisease.Labora- lar anatomy,biochemicalprocesses,evolution, earth. Topicsinclude:biodiversity,basiccellu- standing ofprocessesfundamentaltolifeon periments thathavecontri-butedtoourunder- mental approach.Emphasisisonmilestoneex- ogy areintroducedusinganhistorical,experi- Alternative toBiology100.Principlesofbiol- Milestones inBiology(5) BIOL 107(F) 108 butnotboth. may receivecreditforeitherBIOL105orGEOL This courseisthesameasGEOL108.Students trips. Laboratoryincluded. fossil specimensandincludeslocalfield The laboratoryfocusesonstudyingrockand evolution, andasurveyofthehistorylife. fossilization processes,principlesof such asplatetectonics,rockidentification, record oflifeonthisplanet.Coverstopics processes thatcreatedtheastounding Introduction tothegeologicalandbiological Fossils andtheHistoryofLife(5) BIOL 105(W,Sp) Prerequisite: ENGL91orabove. organism. Laboratory included. support andmaintainthelifeof and howthesystemsfunctionallyunite to anatomy ofthemajorsystems body ments forlifeatthecellularlevel.Basic A studyofbasicmechanismsandrequire- A briefoverviewforthenon-science major. Human AnatomyandPhysiology(5) BIOL 118(F,W,Sp) Laboratory included. Some weekendfieldtripsrequired. conspicuous PacificNorthwestspecies. adaptations, andinteractionsamong field andlabworkfocusingonidentification, A generaloverviewofnaturalhistorywith disease. Laboratoryincluded. the relationshipofmicroorganismsto consideration ofmicrobialecologyaswell emphasis onbacteriaandviruses.Includes activities ormicroorganisms,withan Biological characteristicsandmetabolic General Microbiology(5) BIOL 201(F,W,Sp) of acomputerdatabasefordietaryanalysis. life. Laboratorysessionswillincludetheuse understanding ofdietaryneedsthroughout of thegastrointestinaltractandapractical the majornutrients,abiologicunderstanding an emphasisonachemicalunderstandingof A scientificstudyofhumannutrition,with Human Nutrition(5) BIOL 161 during classandoneweekendday. environmental concerns.Manyfieldtrips survive, theirecologicalrelationships,and categorized, abouttheirhabitats,howthey nonmajors. Learnhowmarineorganismsare Introductory marinebiologydesignedfor Marine Biology(5) BIOL 140(Sp) Prerequisites: BIOL100andCHEM140. Laboratory included. molecular geneticsandgenomics. metabolism andmetabolicdiversity; prokaryotic andeukaryoticcells;cell of biologicalmolecules;anatomy Introduction tothestructuresandfunctions Molecular Biology(5) Introduction toCellularand BIOL 211(W) rently). equivalents (CHEM140maybetakenconcur- Prerequisites: BIOL100andCHEM140ortheir Laboratory included. 212) designedforsciencemajors. One ofathreequartersequence(210,211, distribution andabundanceoflivingthings. that influencetheorigin,evolution, including reviewofpatternsandprocesses generation ofourplanet'sbiodiversity, ecological processesinvolvedinthe Introduction totheevolutionaryand and Biodiversity(5) Introduction toEvolution,Ecology, BIOL 210(F) equivalent; CHEM102recommended. Prerequisite: BIOL100andCHEM101or Course Descriptions 93 A review of basic math and its application to business problems. Topics include bank reconciliation, discounts, taxes, installment buying, payroll, insurance, depreciation, and interest. Electronic calculators are used to solve problems. Ten-key skills emphasized. Prerequisite: MATH 86; MATH 88 strongly recommended because BUS 110 uses basic algebraic formulas. BUS 100 (F, W, Sp)(Previously BUS 104) Business English (5) An introduction to current business writing practices with particular attention to mechanics, punctuation and grammar. Students may take either ENGL 100 or BUS 100, but not both. Prerequisite: Assessment at college-level English and reading or grade of "C" or higher in ENGL 91 and READ 93. BUS 101 (F, W, Sp, Su) Introduction to Business (5) For both business and non-business majors. Dynamics and complexities of the competi- tive business world are explored through the study of topics including economic systems, forms of business ownership, social respon- sibility and ethics, entrepreneurship, market- ing, management, organizational design, fi- nance, banking, and securities markets. BUS 110 (F, W, Sp) Business Math (5) Botany Sp) BOT 101 (W, (5) General Botany to Biology 100 (for non-majors). Alternative is learned through exploration Basic biology by traditionally studied of the organisms bacteria, algae and botanists (plants, and fungi). Topics include: characteristics cell struc- taxonomy of living creatures, photosynthesis, tures, basic chemistry, and relevant genetics, anatomy, ecology drugs, food, "real-life" topics such as techniques. Hands- fibers and horticultural (observations, on activities are emphasized and field trips). experiments, presentations Laboratory included. Prerequisite: ENGL 91 or above. Business See Office Education for Office Professional courses including word processing, typing, etc. For related courses, see Global Business, Small Business Management, and Supervision and Management sections. Study of selected topics in biology primarily through field study, discussions, and readings. This is a two-credit laboratory dissection course. Students will dissect a human cadaver to include removal of skin and superficial fascia, isolation of selected muscles, and opening of thoracic and abdomino-pelvic cavities. Students will also participate in the annual Surgical Demonstration event and present selected surgical procedures to the public. Prerequiste: BIOL 220 or BIOL 240 (minimum grade "C") or BIOL 118 (minimum grade "B+"). BIOL 294 Field Studies (1-5) A continuation of BIOL 241. Includes A continuation of BIOL and physiology of studies of the anatomy the digestive, respiratory, urinary, and reproductive systems. Lectures focus on the physiology of the systems. Lab supports lectures and antomical studies using lab models, cadaver studies, and physiology exercises. Prerequisite: BIOL 241 or by permission of instructor. BIOL 260 (Sp) Human Cadaver Prosection (2) Prerequisite: Successful completion of BIOL 240 or Prerequisite: Successful completion sequence of the first quarter of a three-quarter and physiology, or the college-level human anatomy sequence of first semester of a two-semester and physiology. college-level human anatomy BIOL 242 (F, W, Sp) Physiology (5) Human Anatomy and BIOL 241 (F, W, Sp) (F, W, BIOL 241 (5) and Physiology Anatomy Human of BIOL 240 and includes A continuation of anatomy and physiology studies of the endocrine, circulatory, the nervous, immune systems. The lymphatic, and of the focus on the physiology lectures will supports the lectures with systems. Lab lab models, anatomical studies using exercises. cadaver studies, and physiology Prerequisite: CHEM 101 (CHEM 102 and BIOL 100 highly recommended). Human Anatomy and Physiology (5) Lecture focuses on the fundamental biochemical structures and processes associated with most cells of the body. Includes membrane structure and molecular dynamics, especially membrance proteins and lipids. Muscle contraction, bioelectric signal transmision, transduction and the biochemistry of cellular energetics (cell respiration) are covered. Laboratory focus is on microscopic tissue study (histology) and the anatomy of the skeletal and muscular systems. Prerequisite: BIOL 220. BIOL 240 (F, W, Sp) The second of a two-quarter sequence of human anatomy and physiology. The course will examine the endocrine system, blood, the cardiovascular system, the lymphatic system, the immune system, the respiratory system, the digestive system, the urinary system, and the reproductive system. Laboratory sessions include the study of histology, anatomical models, and the human cadaver. BIOL 221 (F, W, Sp) Human Anatomy and Physiology (5) Prerequisite: CHEM 100 or higher. CHEM 102 and BIOL 100 recommended. The first of a two-quarter sequence of The first of a two-quarter The course human anatomy and physiology. cell biology, covers basic molecular and system, the histology, the integumentary skeletal system, the muscular system, the nervous system and the special senses. Laboratory sessions include the study of microscopy, histology, anatomical models, preserved bones and human cadavers. BIOL 220 (F, W, Sp) Physiology (5) Human Anatomy and Prerequisites: BIOL 211 and CHEM 150. Prerequisites: BIOL 211 and may be taken NOTE: The biology majors' sequence 212 or as BIOL 211, either as BIOL 210, 211, and 212, and 210. Introduction to the structures and Introduction eukaryotic organisms with functions of to animal and plant particular attention and development. anatomy, physiology, Laboratory included. BIOL 212 (Sp) BIOL 212 of the Biology to Introduction (5) Organisms 94 Course Descriptions of groupdynamics. behavior ontheorganization,and study the impactofemployeeattitudesand exercises andgroupinteractiontoreview work performance.Utilizesexperiential influences onindividualperceptionsand subsequent behaviors.Exploresgroup setting onworkerattitudesandtheir Examines theeffectsoforganizational Organizational Dynamics(5) Work Teamsand BUS 167(Sp) relations, andgrievanceprocedures. compensation, union/management development, performanceappraisals, work analysis,staffing,trainingand quality workteams,equalopportunity, Topics includeworkplacediversity,forming and effectivelyutilizehumanresources. Explores howorganizationsobtain,retain, Personnel Management(5) BUS 165(Bi-Annually,Sp) individual interpersonalcompetence. will practiceleadershipskillsandevaluate relationships atwork.Small-groupprojects ues, needsandcommunicationstylesaffect ers. Studentsexaminehowattitudes,val- ity, sensitivityandteamworkamongwork- skills thatcanmaximizecooperation,flexibil- world. Focusesoninterpersonalleadership Applies humanrelationsskillstothework Leadership andHumanRelations(5) BUS 164(F,W,Sp,Su) organization's success. and howmanagementcontributestoan they do,howdifferfromnon-managers, management is,whomanagersare,what management. Courseexamineswhat Basic theoryandcommontermsof Organizational Systems(5) Management Principlesand BUS 163(F,Sp) implementation processes. development oftimelinesandanoutline implementation requirements,the cover theestablishmentofpriorities, strategic implementationplan.Theclasswill organizations and/orindividualsdevelopinga Quality Improvement.Itisdesignedfor planning toolsneededtoachieveContinuous This coursepresentsTQMmanagementand Continuous QualityImprovement(2) BUS 155 the businesscommunity. arrangements andbusinessassociationsin a preliminaryanalysisofcontractual the processofresolvingdisputesinsociety; business environment;legalreasoningand system andthefunctionsoflawina An introductiontotheAmericanlegal Business Law(5) BUS 200(F,W,Sp,Su) future ofsellingandretail. pricing products,retailpromotion,andthe retailing, consumerbehavior,buyingand "nuts &bolts"ofpersonalsellingand include thetraditionalsalesprocess, and consumerlevels.Majortopicscovered goods andservicesatthewholesale,retail, A studyofthebusinessactivityselling Retailing andProfessionalSales(5) BUS 245(Bi-Annually,F) sales anddistributionsystems. development, promotion,advertising, customer behavior,strategiesinproduct consumer needs,demandmanagement, Students willstudytheconceptsof their impactonbusinessandsociety. Examines marketingfundamentalsand Development (5) Marketing andBusiness BUS 240(W) citizenship andsocialresponsibility. society, andlearntoexaminecorporate management decisionshaveonbusinessand Students willalsoassesstheimpact at thepersonalandprofessionallevels. standards andtheethicsofdecisionmaking Explores themoralprinciples,community Responsibility Business EthicsandCorporate BUS 230(W) keyboarding skillsbytouch. Prerequisite: BUS100orENGL100,OFFCE103 are reviewed.(writingintensive) business letters.Punctuationandgrammar Fundamentals ofwritingmemorandumsand Business Correspondence(5) BUS 225(W,Sp) BUS 260(Bi-AnnuallyForW) MATH 99. Prerequisite: MATH99,orassessmentabove correlation andrelatedconcepts. estimation, hypothesistesting,chi-square, descriptive techniques,probability, business decisions.Introductionto Statistical techniquestobeusedinguiding Statistical Analysis(5) BUS 256(F,Sp) (multicultural content) increasingly diverseworkpopulation. and theaddeddimensionofsupervisingan performance, productivity,jobenrichment level, itwillexamineissuesrelatedto From thepersonaltoorganizational offered byaculturallydiverseworkforce. mix ofperspectives,ideasandtalent available tobusinesstoday,fromtherich This coursewillexploretheopportunities Managing Diversity(5) BUS 255(Sp) versity, andglobalinterdependence. geared to21st-centurytechnologies, di- Management systems,andinnovation ration ofstrategicplanning,TotalQuality of businessonsocietyleadstotheexplo- view oftheeconomicandculturalimpacts competitive environment.Anhistoricover- operate inanincreasinglydynamicand Examines thestrategiesbusinessesuseto Business inaChangingWorld(5) BUS 270(Bi-AnnuallySp) consumer expectationsandsociety. ness worldandhowe-businessischanging technological aspectsofchangeinthebusi- of Internettechnologies.Exploresboththe ness processesthroughtheexpandinguse Examines thetransformationofkeybusi- E-Business andCommerce BUS 265(Bi-AnnuallyW) supports theirfutureentrepreneurialefforts. Students willwriteabusinessplanthat that influenceentrepreneurialbehavior. succession; andskills,qualities,traits tips onhowtoplanforgrowthand optimum benefitsfromlimitedresources; business; techniquesonhowtoachieve successfully launchandmanageasmall A "how-to"courseconcentratingonwaysto Small BusinessEntrepreneurship(5) Course Descriptions 95 Prerequisite: CT 210 or CT 220; Registered Radiologic Technologist (ARRT). Prerequisite: Registered Radiologic Technologist (ARRT). CT 220 (W) CT Imaging Procedures (3) This class provides information concerning CT imaging protocols for the head, neck, thorax, spine, abdomen, pelvis, and musculoskeletal system. These include procedure indications, patient education, preparation, orientation and positioning, patient history and assessment, contrast media usage, scout image, selectable scan parameters, and filming and archiving of the images. Prerequisite: Registered Radiologic Technologist (ARRT). CT 230 (W) CT Registry Review (1) Review of CT imaging information in preparation for the national certification exam in CT administered by the ARRT. The topics in the review will consist of patient care, CT imaging procedures, and CT physics and instrumentation. Communication Skills (F W, Sp) COMSK 100 (5) to Critical Thinking Introduction practice in reading, Through directed and speaking, students writing, listening, of learn to recognize the structure and improve arguments, to interpret texts They will their critical thinking skills. discuss carefully analyze, write about and texts. chosen classical and contemporary Computed Tomography CT 210 (W) CT Physics and Instrumentation (2) X-ray generation with an emphasis on human tissue interaction, CT beam attenuation, linear attenuation coefficients, and Hounsfield Unit applications are discussed. Additionally, back-projection, filtered back-projection and Fourier transform are discussed. Computed tomography system components inherent in computer acquisition, processing and image display will also be explained. Prerequisite: CHEM 160; CHEM 231 for CHEM 232; CHEM 232 for CHEM 233. Prerequisite: MATH 115 or MATH 111 (may be taken concurrently), and high school chemistry or CHEM 101. CHEM 140 for 150. CHEM 150 for 160. CHEM 231(F), 232 (W), 233 (Sp) Organic Chemistry (5, 5, 5) This series of courses includes the study of the structure, properties, nomenclature, synthesis, reactions, and reaction mechanisms of the main classes of organic compounds. CHEM 233 includes the study of polyfunctional compounds, natural products and an introduction to biochemistry. The laboratory includes basic organic techniques including: synthesis, qualitative organic analysis, and instrumental analysis of organic compounds. Prerequisite: CHEM 101. CHEM 140 (F, W), 150 (W, Sp), 160 (Sp, Su) General Chemistry (5, 5, 5) (For science and engineering majors.) These courses include study of the structure of matter, atomic theory, quantitative relationships, solutions, solids, liquids and gases, thermochemistry, periodic properties, chemical bonding, kinetics, equilibria, acids and bases, electrochemistry and nuclear chemistry. Laboratory included. CHEM 160 lab includes qualitative analysis for common cations and anions. Prerequisite: High school chemistry or CHEM 100 Prerequisite: High school chemistry 100. and MATH 97, 99 or TMATH CHEM 102 (W, Sp) Survey of Organic and Biochemistry (5) Study of (For non-science majors.) organic compounds: hydrocarbons, ethers, alcohols, aldehydes, ketones, carbohydrates. acids, fats, proteins and Laboratory included. CHEM 101 (F, W, Sp, Su) 101 (F, W, CHEM (5) Chemistry of Inorganic Survey and non-engineering (For non-science metric includes study of the majors.) Course theory, bonding, quantitative system, atomic and solutions, gases, acids relationships, and nuclear chemistry. bases, salts, Laboratory included. Prerequisite: MATH 97, MATH 99 or TMATH 100 and college-level reading and writing. CHEM 100 (F, W, Sp, Su) Introduction to Chemistry (5) Survey of the fundamental principles of chemistry. Includes study of the metric system, atomic theory, bonding, properties of matter, reactions, nomenclature and applications of chemistry to everyday life. Laboratory included. Chemistry Students seeking courses for general interest and degree distribution requirements should consider the following non-major courses: CHEM 100, 101, and 102. These courses are also appropriate for students working toward Allied Health careers. Students pursuing a major in the sciences, engineering, or some medical fields should select courses from CHEM 140, 150, 160, 231, 232, and 233. An academic advisor should be consulted to determine the appropriate courses for your degree goal. Students intending to major in Chemistry at a baccalaureate institution should work toward an Associate of Science degree with a Chemistry Specialization. Individual Study in Business (1-5) Study on an individual basis. Prerequisite: Instructor permission. BUS 299 Prerequisite: Program Chair permission one quarter Prerequisite: Program Chair prior to the internship. Work Internship (5) sophomore year, During one quarter of the credits for hands- students can earn college training in a private on work experience and Internships or public sector organization. business can cover any of the related Business subjects introduced in the and Administration Management Program. Organizational Leadership BUS 290 (F, W, Sp) This course covers employment search skills covers employment search This course skills needed to be and the employee the job. It is recommended successful on 290, for internships: ACCNT preparation 290. 290, IT 290, OFFCE BUS 290, GBUS BUS 280 Skills (1) Readiness Career 96 Course Descriptions recursion, datastructures,andan polymorphism, exceptionhandling, will includeclasses,interfaces,inheritance, Java, thatfollowsENGR/CS142.Topics An intermediateprogrammingcourse, using Engineers andScientistsII(5) Java Programmingfor CS 143 computer programmingcourseandMATH115. Prerequisites: ENGR140(CS140)orstructured but notboth. may receivecreditforENGR142orCS142, course isthesameasENGR142.Students collections, events,andinterfaces.This decision structures,iteration,arrays, classes, objects,messages,expressions, debug computerprograms.Topicsinclude design, implement,document,test,and oriented programming,includinghowto students learngeneralprinciplesofobject- Using theJavaprogramminglanguage, Engineers andScientistsI(5) Java Programmingfor CS 142 concurrently). Prerequisite: MATH115(maybetaken or CS140,butnotboth. Students mayreceivecreditforENGR140 This courseisthesameasENGR140. advanced computerprogrammingtopics. Basic. Coursewillpreparestudentsfor used tocreatecomputerprogramsinVisual decision structures,loopsandarraysare fundamentals suchasdatatypes,operators, Flowcharts, algorithms,andprogramming Engineers andScientists(5) Visual BasicProgrammingfor CS 140 Technology andComputerUser. see courseslistedunderInformation courses orBusinessapplicationsshould interested inintroductorycomputer Computer ScienceSpecialization.Students Associate ofSciencedegreewitha institution shouldworktowardan Computer Scienceatabaccalaureate majors. Studentsintendingtomajorin requirements forengineeringandscience designed tosatisfycomputerprogramming applications. Thecourseslistedbeloware range ofcoursesinvolvingcomputer Tacoma CommunityCollegeoffersawide Science Computer not both. receive creditforEN the sameasENGR143.Studentsmay implementation tradeoffs.Thiscourseis introduction toperformanceanalysisand (MATH 86levelrecommended). Prerequisite: KnowledgeofWindowsrequired Level" competencies. Microsoft Excel.EmphasizesMOUS"Core Beginning spreadsheetsclassusing Excel I(2) CU 103(F,W,Sp,Su) wpm typingrecommended). Prerequisite: KnowledgeofWindowsrequired(25 Level" competencies. Microsoft Word.EmphasizesMOUS"Core Beginning WordProcessingclassusing Word I(2) CU 102(F,W,Sp,Su) and theinternet. Introduction totheuseofelectronicmail operate thecomputerandmanagefiles. Introduction totheuseofWindows World WideWeb(1) Introduction toWindowsand CU 100(F,W,Sp,Su) speed andaccuracy. Computer 10-keypadbytouch.Emphasison 10-Key Basics(1) CU 092(F,W,Sp) Prerequisite: READ92levelrecommended. development ofspeedandaccuracy. Computer keyboardbytouch.Includes Keyboarding Basics(2) CU 091(F,W,Sp) Computer User Prerequisite: ENGR142orCS142. (MATH 86and25wpmtypingrecommended). Prerequisite: KnowledgeofWindowsrequired Power Point. competencies inWord,Exceland Suite. EmphasizesMOUS"CoreLevel" Introduction tousingMicrosoftOffice Word I,ExcelPowerPoint(5) CU 105(F,W,Sp) Prerequisite: KnowledgeofWindowsrequired. MOUS "CoreLevel"competencies. using MicrosoftPowerPoint.Emphasizes Introduction toelectronicpresentations Power Point(1) CU 104(F,W,Sp,Su) GR 143orCS143,but and CU110(orequivalent). Prerequisite: CU102,103,104or105 of proficiency. and PowerPointtotheMOUSCoreLevel self-assessment inWord,Excel,Access Provides practiceapplicationsfor MOUS Prep,LevelI(1) CU 115(varies) 105. Recommended: PriorenrollmentinCU103or "Core Level"competencies. Microsoft Access.EmphasizesMOUS Beginning databaseclassusing Introduction toAccess(2) CU 110 English 100recommended). Prerequisite: CU105orequivalent(Business contacts, calendar,andscheduling. of thesoftware'sfollowingfeatures:e-mail, Beginning Outlook.Courseincludescoverage Outlook (2) CU 108 managing databases. modules, managingdatabaseobjectsand and forms.Includescreatingmacros pages, advancedqueries,tables,reports import andexportfeatures,dataaccess using MicrosoftAccess.Emphasizesdata Intermediate toadvanceddatabaseskills Access II(3) CU 210(varies) Prerequisite: CU103or105equivalent. Level" competencies. Microsoft Excel.EmphasizesMOUS"Expert Advanced spreadsheetclassusing Excel II(3) CU 203 Prerequisite: CU102or105equivalent. Level" competencies. Microsoft Word.EmphasizesMOUS"Expert Advanced Wordprocessingclassusing Word II(3) CU 202 Prerequisite: ACCNT140orequivalent. methods usingQuickBooks. Introduction toautomatedbookkeeping Quick Books(3) CU 130 Course Descriptions 97 A continuation of Ultrasound Physics and Instrumentation I. Topics covered include hemodynamics, Doppler physics (including color and spectral Doppler), acoustic artifacts, bioeffects and safety and quality assurance. Prerequisites: Successful completion of DMS 130. Provides information on the female reproductive system and fetal development. Emphasizes obstetrical states in the second and third trimesters and the associated pathological findings. Basic scanning techniques and protocols are introduced and practiced in lecture/lab. Prerequisites: Successful completion of DMS 122. DMS 130 Ultrasound Physics and Instrumentation I (3) Provides a theoretical and practical under- standing of acoustic physics and its applica- tion in diagnostic medical sonography. In- cludes a review of related mathematic con- cepts and explores wave concepts, proper- ties of attenuation, ultrasound beam forma- tion, transducer construction, and function and system operation. Prerequisites: Acceptance into the program or Program Chair permission. DMS 131 Ultrasound Physics and Instrumentation II (3) Prerequisites: Acceptance into the program or Acceptance into the program Prerequisites: permission. Program Chair DMS 122 Gynecological and Obstetrical (5) Scanning and Technique the female Provides information on fetal development reproductive system and a review of in the first trimester, including: and female pelvis anatomy, physiology Introduces associated pathologic findings. and maternal embryonic development Focuses on changes in the first trimester. which scanning protocols and techniques, in lecture/lab. are discussed and practiced Prerequisites: Successful completion of DMS 120 and 121. DMS 123 Obstetrical Scanning and Techniques (5) symptoms. Also explores the use of the use Also explores symptoms. Routine procedures. in surgical ultrasound are learned and practiced scanning protocols during lecture/lab. Prerequisites: Acceptance into the program or Program Chair permission. DMS 121 Small Parts and Intraoperative Scanning and Techniques (5) Focuses on the sonographic scanning techniques of various superficial structures. Reviews the anatomy, physiology, and pathology of these small parts; discussing laboratory tests and clinical signs and Prerequisites: Successful completion of DMS 110. DMS 120 Abdominal Scanning and Techniques (5) Introduces ultrasound terminology and basic scanning techniques. Discusses the normal and pathologic appearances, laboratory tests and clinical signs and symptoms pertinent to the organs studied. Routine scanning protocols are learned and practiced during lecture/lab. Pathophysiology I (3) of disease Explores the pathogenesis processes and their impact on the human body. Discusses the clinical manifestations, diagnosis, treatment and surgical interventions of different disease processes affecting specific body systems. Emphasizes disease processes relevant to sonography. Prerequisites: Acceptance into the program or Program Chair permission. DMS 111 Pathophysiology II (3) A continuation of Pathophysiology I. Discusses clinical manifestations, diagnosis, treatment and surgical interventions of diseases affecting specific body systems. Emphasizes disease processes relevant to sonography. Provides information on cross-sectional Provides information human body with an anatomy in the the organs of sonographic emphasis on scanning planes are interest. Different including longitudinal, represented oblique views. transverse, coronal and of Students also gain an understanding relation to organs transducer positioning in their studies within the body, and correlate with sonographic images. the program or Prerequisites: Acceptance into Program Chair permission. DMS 110 DMS 105 DMS Cross-Sectional Ultrasound Anatomy (4) Prior to acceptance in the Diagnostic Prerequisites: Acceptance into the program or Program Chair permission. Introduces the field of sonography including: the history and uses of ultrasound, roles and responsibilities of a diagnostic medical sonographer, health care settings that use ultrasound, as well as job and training opportunities for sonographers. Discusses medical ethics and legal issues relevant to sonography. DMS 100 Introduction to Diagnostic Medical Sonography (4) Medical Sonography program, students must complete the following courses (or equivalent) as prerequisite requirements with a grade of "C" or higher: ENGL 101, SPCH 100, BIOL 220/221, RS 170, PHYS 114 or RS 108/109, and MATH 115. The required prerequisite courses must have been taken in the last five years unless the applicant has been actively employed as a radiologic technologist at least 20 hours per week for the last two years. In addi- tion, all applicants must hold a minimum cumulative GPA of at least 2.5 with a grade of "C" or higher in all radiologic sci- ence, communication, math and science courses. It is highly recommended that a refresher course in MATH 115 be taken if coursework is more than 2 years old. A separate application to the Diagnostic A separate application to is required Medical Sonography program the Allied Health and may be obtained at or by calling office, Bldg. 19, room 70, 253.566.5113. Diagnostic Medical Sonography Prerequisite: CU 202, CU 203, CU 110 (or Prerequisite: CU equivalent). Provides practice applications for Provides practice in Word, Excel, Access self-assessment to the Expert Level and Power Point of proficiency. CU 215 (varies) CU 215 II (1) Prep, Level MOUS 98 Course Descriptions supervision. Requirescompletionof clinical are performedundergeneralized in aclinicalsetting.Patientexaminations performance ofalldutiesasonographer Continued observationwithincreasing A continuationofUltrasoundClinicalIII. Ultrasound ClinicalIV(10) DMS 250 Prerequisites: SuccessfulcompletionofDMS220. laboratory practiceofroutineprotocols. protocols andultrasoundfindings.Includes pathophysiology, andbasicscanning vascular anatomyandphysiology,pertinent Includes anoverviewofthebasiccardio- vascular sonographyandechocardiography. Introduction tothebasicconceptsof and Echocardiography(5) Introduction toVascularTechnology DMS 220 of "C"orhigher. didactic andlabcourseworkwithapassinggrade Prerequisites: SuccessfulcompletionofDMS151 Requires completionofclinicalcompetencies performed undergeneralizedsupervision. in aclinicalsetting.Patientexaminationsare performance ofalldutiesasonographer Continued observationwithincreasing A continuationofUltrasoundClinicalII. Ultrasound ClinicalIII(8) DMS 152 of "C"orhigher. didactic andlabcourseworkwithapassinggrade Prerequisites: SuccessfulcompletionofDMS150 and signed-offbyasupervisingsonographer. clinical competencieswhichwillbeobserved strict supervision.Requirescompletionof patient care,andsonographicdutiesunder various technical,clerical,professional, student willobserve,assist,andperform A continuationofUltrasoundClinicalI.The Ultrasound ClinicalII(5) DMS 151 Program Chairpermission. Prerequisites: Acceptanceintotheprogramor and qualityassurance. scanning techniques,protocols,patientcare setting. Includesprofessionalskills, limited hands-onscanninginaclinical sonographic theorytoobservationand Provides studentstheopportunitytoapply Ultrasound ClinicalI(2) DMS 150 graphic laboratory. a vascularultrasoundandechocardio- competencies. Alsoincludesobservationin DMS 260,261 Program Chairpermission. Prerequisites: Acceptanceintotheprogramor presentation, discussionandcritique. sonography. Includescasestudy This courseisaseminaroncurrentissuesin Critique I,II(2,2) Ultrasound Seminarand DMS 160,161 of "C"orhigher. didactic andlabcourseworkwithapassinggrade Prerequisites: SuccessfulcompletionofDMS251 completion ofDMS251. examinations independentlybythe competencies andisperformingall the studenthascompletedallclinical competencies. Thiscoursemaybewaivedif supervision. Requirescompletionofclinical examinations areperformedunderminimal sonographer inaclinicalsetting.Patient Continued performanceofalldutiesa A continuationofUltrasoundClinicalV. Ultrasound ClinicalVI(13) DMS 252 of "C"orhigher. didactic andlabcourseworkwithapassinggrade Prerequisites: SuccessfulcompletionofDMS250 clinical competencies. supervision. Requirescompletionof examinations areperformedunderminimal sonographer inaclinicalsetting.Patient Continued performanceofalldutiesa A continuationofUltrasoundClinicalIV. Ultrasound ClinicalV(13) DMS 251 of "C"orhigher. didactic andlabcourseworkwithapassinggrade Prerequisites: SuccessfulcompletionofDMS152 exam, includingphysicsandinstrumentation, Diagnostic MedicalSonographersregistry the contentinAmericanRegistry of This electivecourseisanintensivereview of Review Seminar(1) Ultrasound Registry DMS 270 Program Chairpermission. Prerequisites: Acceptanceintotheprogramor presentation, discussion,andcritique. sonography. Includescasestudy This courseisaseminaroncurrentissuesin Critique III,IV(2,2) Ultrasound Seminarand and practicesampleregistryexams. Students reviewwithinclassdiscussions abdomen andsmallparts,ob/gyn. of "C"orhigher. Prerequisite: CompletionofENGL101withagrade (multicultural content) Some sceneworkandstagedreadings. directing, design,andacting)areexplored. technical aspectsofproduction(producing, reviews ofplayproductions.Thebasic contemporary playwrights,andtowrite summarize playtexts,fromtheGreeksto production. Studentslearntoanalyzeand Basic introductiontodramaandtheatrical Introduction toDrama(5) DRAMA 101(varies) Drama Program Chairpermission. Prerequisites: Acceptanceintotheprogramor economics (surveyofmacroandmicro). Special emphasisoncurrentissuesin money supply,monopoliesandtheireffects. system, operationofthecentralbankand and spending,operationofthemarket topics aseffectsofgovernmenttaxation specifically fornon-majors.Includessuch A one-quartersurveyofeconomicsdesigned General Economics(5) ECON 211 MATH 99. Prerequisite: MATH99,orassessmentabove subsidies, monopolyandtaxation. problems includinggovernmentregulation, income andproducts.Analysisofcurrent of allocatingresourcesanddistributing Theory ofthemarketsystemsasamethod Principles ofEconomics:Micro(5) ECON 201(F,W,Sp,Su) MATH 99. Prerequisite: MATH99,orassessmentabove international trade. the moneysupply,andeffectsof government taxingandspending,controlof States economy,includingeffectsof History anddevelopmentoftheUnited Principles ofEconomics:Macro(5) ECON 200(F,W,Sp,Su) Economics Course Descriptions 99 EDP 290 Practicum (3) Supervised classroom experience in the early childhood education setting. Provides the opportunity for skills development and application of theory learned in educational courses. Education (Continuing Education) EDU 102 Introduction to Learning Disabilities (2) Provides educators and counselors with an awareness of learning disabilities, how learning disabled students approach lan- guage-based tasks, and resources to better serve students. Emphasis on determining what constitutes learning disabilities, how to identify and refer at-risk individuals to diagnosticians, identify how learning dis- abilities impact academic success, and cat- egorization and accommodation. (Clock- hour credits available.) EDP 202 and Health, Nutrition Family Safety (3) of health, safety, and Practical study paraeducator students. nutrition for emergency Includes prevention, and family-centered services management, model. utilizing a wellness EDP 203 Family Systems and Support Services (3) systems and An introduction to family relate to working family dynamics as they in the early with children and families includes childhood education setting; community exploration of available support resources. EDP 204 Effective Communication with Families (3) Explores effective communication techniques for interacting with children and families in the early childhood education setting; includes an introduction to small group facilitation, and crisis intervention. Development and planning of curriculum for early childhood programs; includes emergent curriculum and inclusion of family culture and ideas. EDP 130 Individual and Cultural Diversity (2) An exploration of diversity issues and their application to children and early childhood education programming. (multicultural content) EDP 106 Essentials III (3) Explores ways of advancing physical and intellectual competence of children, establishing positive and productive relationships with families and ensuring a well-run and purposeful program responsive to participant needs. EDP 112 Curriculum Development (3) EDP 105 Essentials II (3) Development and planning of a safe, healthy environment that invites learning and provides positive ways to support children's social and emotional development. EDP 103 (2) Care Provider Training Basic Child to child growth Provides basic introduction health and and development, child guidance, Training and safety. Meets STARS (State of 20 hours Registry System) requirements care providers. basic training for all child EDP 104 Essentials I (3) characteristics, Exploration of the personal for individuals responsibilities and rewards and examines working with young children the basic concepts of development and normal development characteristics of children from birth through age 5 to be used as a foundation for planning appropriate activities and establishing appropriate expectations of children at various ages. EDP 102 II (3) Instruction Effective to effective teaching An introduction early curriculum planning for strategies and childhood classrooms. For current information contact: The Students are reminded that successful Teacher Education candidates should Teacher Education candidates Provides an introduction to the elements of learning in young children, including room arrangement, scheduling and materials. EDP 101 Effective Instruction I (3) An overview of the early childhood field from personal and historical perspectives. Also includes current issues, trends, and best practice. EDP 100 Introduction to Early Childhood Education (3) Educational Parapro- fessional Education Coordinator at 253.566.5010. completion of recommended coursework does not guarantee admission to a university college of education. Additional criteria, such as grade point average, community service, leadership activites and prior classroom experience (e.g. volunteer tutoring), may also be used by a college of education in making admission decisions. keep in close contact with their designated keep in close contact with be aware of transfer school so they will to work changes. Students are advised Coordinator to closely with the Education they will be plan their programs whether Childhood pursuing a Paraeducator-Early whether they will be Emphasis Certificate or degree requirements fulfilling the associate’s for transfer to a four-year school to complete a degree in Elementary or Secondary Education. TCC is currently developing articulation agreements with selected four-year schools, and specific course recommendations will be forthcoming. Watch the quaraterly schedules under the Education section for new course offerings. The field of Teacher Education is undergoing Education of Teacher The field in the will continue to change changes and in If students are interested near future. can most current information teaching, the www.teachwashington.org. be found at of College's Teachers Tacoma Community students planning Tomorrow Club welcomes to enter the teaching profession. Education 100 Course Descriptions techniques. Rectifiers,transistors,SCRs and employed. Electronictrouble-shooting devices andthecircuitsinwhichthey are Working knowledgeofmodernelectronic Electronic DevicesandSystems(5) ELEC 106(F) Prerequisite: Oneyearofhighschoolalgebra. phase resonanceandcircuittransients. capacitors, seriesandparallelcircuits, current, power,Ohm'sLaw,inductors, instruments. Coversvoltage,resistance, components andelectricalmeasurement recognition, anduseofelectrical electrical circuitsincludingcircuitanalysis, Basic knowledgeandskillsofDCAC and Electronics(5) Fundamentals ofElectricity ELEC 104(F) Electronics preparation ofthephysicalenvironment. observation, assessmentandthe practices inguidance,curriculum, implementing developmentallyappropriate children inECEclassrooms,learningand will providetheopportunitytoworkwith (Introduction toEarlyChildhoodExperience) This classtakenconcurrentlywithEDP100 Early ChildhoodFieldExperience(2) EDUC 299(F,Sp) opportunities topracticelearnedconcepts. required labexperiencethatgivesstudents issues andtrendsineducation.Includes economic pressuresthatinfluencecurrent explore thesocial,political,cultural,and curriculum development.Thecoursewillalso theories, contemporarystudents,and foundations ofAmericaneducation,learning examine historicalandphilosophical teaching asaprofession,thecoursewill Designed forstudentswhoareconsidering Introduction toEducation(5) EDUC 201(F,W,Sp) in thefamily;observationofyoungchildren. development; meetingtheneedsofchildren their mental,emotional,physicalandsocial Growth andguidanceofyoungchildren, Child Development(5) EDUC 135(varies) (Transfer) Education noise reduction,andcathoderaytubes. amplifier circuits,operationalamplifiers, triacs, vacuumandgaseoustubes,filters, broadband technologies. techniques usedinthecellularandfixed software firewallandencryption methods. Anintroductiontohardwareand as theypertaintoappliedtransmission A studyofradiofrequencyvulnerabilities Security Fundamentals(5) Wireless (RadioFrequency) ELEC 214 tower andantennausagefundamentals. usage, transmitterrange,FCClicensing, transmission methodologies,equipment include cellularandfixedbroadband, A studyofwirelessfrequencyusageto Wireless (RadioFrequency)Theory(5) ELEC 212 communication devicesandthecomputer. relationships betweenperipheraland Acquaints studentswiththeintegral Peripherals andCommunications(5) ELEC 110(Sp) interfacing. operation, computerarithmeticand covering microprocessortheoryand A comprehensive,microprocessorcourse Microprocessors (5) ELEC 109(Sp) and analyzedigitalschematicdiagrams. with anemphasisonlearninghowtoread A studyofdigitallogicdevicesandcircuits Schematics (5) ELEC 108(W) digital design. registers, combinationallogiccircuitry,and circuits, Booleanalgebra,flip-flops, Fundamentals ofdigitaltechniques,logic Digital Techniques(5) ELEC 107(W) Prerequisite: Oneyearofhighschoolalgebra. broadband andcellularnetworks. development andapplicationofwireless wireless technologiesandequipmentinthe An introductiontotheincorporationof Principles ofWirelessNetworks(5) ELEC 216 Health Services Medical and Emergency secure systems. isolated andopportunitiespresentedto methods demonstrated,vulnerabilities methods inawirelessenvironment.Various Application ofsecurityandencryption Fundamentals (5) Wireless SecurityandEncryption ELEC 220 power, topography,andatmosphericeffect. as itpertainstofrequency,transmitter frequency transmission,signalpropagation modulating anddemodulatingradio A studyofthevariousmethodsusedfor Signal Propagation(5) Radio WaveModulationand ELEC 218 permission. EMT-Basic. CertificationandProgramChair Prerequisite: CurrentstateorNationalRegistry Registry requirementsforre-certification. needs tofulfillstateand/orNational For thecurrentlycertifiedEMT-Basic who Technician Recertification(4) Emergency Medical EMC 112(F,W,Sp) not obtainstatecertificationwithoutsponsor. be takenwithoutaffiliation;however,studentswill agency isrequiredforstatecertification.Classmay NOTE: ActiveaffiliationwithanEMSprovider limited enrollmentandprerequisites. screening arenecessarypriortocourse,due Training andvaliddriver'slicense.Application graduation orGED,CPRcard,StandardFirstAid Prerequisites: Atleast18yearsold,highschool Social andHealthServicesstandards. and theWashingtonStateDepartmentof Department ofTransportationguidelines program. ProgramadherestotheU.S. the prerequisitesforParamedic observation. Classalsomeetsaportionof practical class-worktime,andsomeclinical injury. Includes112hoursoflectureand transportation forvictimsofillnessand EMT-Bs providebasiclifesupportand EMS forpre-hospitalcareproviders. an EMT-Basic,theentrylevelpositionin Registry requirementsforcertificationas are preparedtofulfillstateand/orNational Upon completionofthiscoursestudents Technician Basic(8) Emergency Medical EMC 110(F,W,Sp) Course Descriptions 101 Prerequisite: MATH 115 (may be taken concurrently). ENGR 124 Introduction to Computer Aided Drafting (5) A practical course in the use of computer aided design and drafting (AutoCAD software) as well as basic drafting instruments to solve engineering graphics problems. Design and analysis team will operate workstations and become familiar with sheet layout, geometric construction, multiview, auxiliary views, dimensioning and pictorals. Prerequisite: MATH 99 (may be taken concur- rently). ENGR 140 (F, Sp) Computer Applications to Engineering Problems (5) Flowcharts, algorithms, and programming fundamentals such as data types, operators, decision structures, loops and arrays are used to create computer programs in Visual Basic. Course will prepare students for advanced computer programming topics. This course is the same as CS 140. Students may receive credit for ENGR 140 or CS 140, but not both. ENGR 100 (F, W) Introduction to (5) Engineering and Design profession Introduction to the engineering building group and its design process by effects of skills, understanding the producing different learning styles, and fostering strategies for innovation, creativity in problem solving. Includes design projects, journal keeping, professionalism and ethical issues, and oral presentations. Acquaints students with disciplines and oportunities in engineering. degree with an Engineering Specialization. with an Engineering degree for are available advisors Engineering establishing a degree plan. assistance in courses for general Students seeking skills, or college-level interest, upgrading 124, consider ENGR 100, electives should chapter TCC supports a local 140, and 231. (American Society of of the ASME encourages Mechanical Engineers) and student involvement. Prerequisites: Certified Paramedic or instructor permission. Engineering The engineering transfer program is designed to offer students the same courses as the first two years at a baccalaureate institution. Students have the option of pursuing an Associate in Arts and Sciences degree Option B or an Associate of Science Prerequisite: Recommendation of County Medical Director and instructor permission. EMC 200 Contemporary Issues in Pre-hospital Care (2) This is a dynamic seminar-style course that focuses on the various aspects of quality Emergency Medical Service. The course utilizes assorted current readings in conjunction with small group work that promotes critical thinking and a global understanding of what comprises state of the art out-of-hospital care. EMC 132 (Sp) (9) Paramedic Clinical III Continuation of EMC 131. Primary emphasis is on extensive field experience and attainment of entry level competencies. Prerequisites: Completion of EMC 121, EMC 131 and enrollment in EMC 122. EMC 140, 150 Supplemental Education for EMC Programs (2-10, 2-10) This course offers individualized instruction to assist previously educated and/or certified personnel in meeting state, county, local or national certification or re-certification requirements. Prerequisite: Enrollment in EMC 120. Prerequisite: Enrollment EMC 131 (W) (7) Paramedic Clinical II field experience Second-quarter clinical and taken in conjunction for Paramedic students will have assigned with EMC 121. Students clinical and in-field rotations. EMC 120, EMC 130 Prerequisite: Completion of 121. and current enrollment in EMC EMC 130 (F) EMC 130 I (4) Clinical Paramedic clinical and in-field experience First-quarter students taken in conjunction for paramedic clinical includes supervised with EMC 120; hospital and in-field rotations. experience in Prerequisites: Successful completion of EMC 121, EMC 131 and PE 200. Third in the three-quarter course. Reviews the entire didactic content utilizing case studies. Requires application of the material covered in EMC 120 and EMC 121. EMC 122 (Sp) Paramedic III (5) Prerequisites: Successful completion of EMC 120, EMC 130 and PE 100. EMC 121 (W) Paramedic II (12) Second in the three-quarter paramedic course. Covers Assessment and management of the trauma victim; soft tissue injuries; respiratory emergencies; musculoskeletal injuries; medical, pediatric, psychiatric, obstetric and geriatric emergencies. Pre-hospital trauma life support (PHTLS-Provider) as well as the P.E.P.P. provider course included. Prerequisite: HT 130, BIOL 118, EMC 118 and acceptance into the Paramedic program. Paramedic I (12) First of three courses of the Paramedic education program. Covers advanced concepts and skills in patient Assessment, airway management, shock management and I. V. therapy, pharmacology and drug administration, Advanced Cardiac Life Support (ACLS) provider course included. EMC 120 (F) This course will explore the various factors This course will explore and mental that impact the physical A wide range of wellbeing of the paramedic. will be health and prevention concepts presented to enhance personal wellness. The students will also learn the function of paramedics as role models, coaches, and educators in the community. EMC 118 (F) (4) EMS Wellness and Prevention Pre-Hospital Trauma Life Support (PHTLS) is Trauma Life Support (PHTLS) Pre-Hospital recognized course that focuses a nationally the care rendered to the on improving in the out-of-hospital victims of trauma of course features a blend setting. The coupled focused classroom presentations experiences to help with extensive hands-on of quality turn the theories and concepts application. trauma care into practical EMC 115 Support Life Trauma Pre-Hospital (PHTLS) (2) 102 Course Descriptions concurrently), PHYS 121 recommended. Prerequisite: MATH125(maybetaken Includes designproject. of mass,inertia,beams,andfriction. couples, resultants,trusses,frames, center notation, equilibrium,sheer,moments, Topics coveredinthiscourseinclude:vector develop engineeringproblemsolvingskills. mathematics andthephysicalsciencesto stationary orstaticobjects.Combines study andanalysisofthereactionson Problem solutionorganizationwillaidinthe Engineering Mechanics:Statics(4) ENGR 210(F) Prerequisite: CHEM150andMATH124. cal properties. ence uponmechanical,electricalandchemi- are consideredwithrespecttotheirinflu- radiation, andthermalchemicalchanges Mechanical stress,electromagneticfields,ir- atomic, molecularandcrystallinestructure. organic andmaterialsasrelatedto practice ofengineering.Thepropertiesin- ture andpropertiesofmaterialsusedinthe Elementary principlesunderlyingthestruc- Fundamentals ofMaterialScience(4) ENGR 170 Prerequisite: ENGR142orCS142. 143 orCS143,butnotboth. 143. StudentsmayreceivecreditforENGR tradeoffs. ThiscourseisthesameasCS performance analysisandimplementation data structures,andanintroductionto polymorphism, exceptionhandling,recursion, will includeclasses,interfaces,inheritance, Java, thatfollowsENGR/CS142.Topics An intermediateprogrammingcourse,using and ScientistsII(5) Java ProgrammingforEngineers ENGR 143(Sp) computer programmingcourseandMATH115. Prerequisite: ENGR140(CS140)orstructured but notboth. may receivecreditforENGR142orCS142, course isthesameasCS142.Students collections, events,andinterfaces.This decision structures,iteration,arrays, classes, objects,messages,expressions, debug computerprograms.Topicsinclude design, implement,document,test,and oriented programming,includinghowto students learngeneralprinciplesofobject- Using theJavaprogramminglanguage, and Scientists(5) Java ProgrammingforEngineers ENGR 142 Engineering (4) Fundamentals ofElectrical ENGR 215 Introduction toTechnicalWriting(3) ENGR 231(W,Sp) 126 (maybetakenconcurrently). Prerequisite: ENGR210orPHYS121,andMATH motion. Includesdesignproject. rotation, absolutemotionandrelative momentum, impact,steadymassflow, curvilinear motion,work,energy,impulse, tangent coordinates,polar rectangular coordinates,normaland in thiscourseinclude:kinematics,kinetics, using thevectornotation.Topicscovered Dynamics ofparticlesandrigidbodies, Engineering Mechanics:Dynamics(4) ENGR 230(W) taken concurrently). Prerequisite: ENGR210andMATH126(maybe gauges, deflections,andcolumns. sheer flow,stresstransformation,strain indeterminate techniques,flexureformula, concentrations, thermalstress,statically members, Poisson'sratio,stress torsion. Topicsincludedeformationof in tension,compression,bending,and behavior ofstructuralandmachineelements solid materials.Developmentofelastic strain, deformation,andfailuretheoryin Introduction totheconceptsofstress, Materials (4) Introduction toMechanicsof ENGR 220(Sp) Prerequisite: MATH238andPHYS122. associated withbasiccircuitforms. second orderlineardifferentialequations operational amplifiers.Solutionoffirstand sources, capacitors,inductors,and circuit andsystemsconcepts.Resistors, Introduction toElectricalEngineering.Basic of "C"orhigher. Prerequisite: ENGL101andREAD93withagrade course asENGL105. headings, illustrations,styleandtone.Same technical writingconventions,including scientific andtechnicaldisciplines patterns andreportformatscommonto reports. Attentiongiventoorganizational and writingtechnicalinformation,including A practicalcourseinorganizing,developing Prerequisite: Instructorpermission. project ortopic. analysis, andreportingofanengineering Independent design,observation, Independent Study(1-5) ENGR 299 taken concurrently). instructor permission;andMATH126(maybe Prerequisite: PHYS121andCHEM150or and applicationstodevicessystems. materials, controlvolumeanalysis,entropy, gasses, specificheat,incompressible Topics includework,heat,energy,ideal state changesinengineeringproblems. application toenergytransformationand the basiclawsofthermodynamicsandtheir macroscopic pointofview.Development thermodynamics fromapredominantly Introduction tobasicprinciplesof Thermodynamics (4) ENGR 260(Sp) the firstthreeweeksofquarter. upon aninstructor'srecommendation,during may enrollduringscheduledregistration,and competency testsforeachlesson.Students explanations andexercisesincludes utilizes aworkbookwithgrammar grammatical errors.Thisreviewcourse Emphasis isonpartsofspeechandcommon who lacksunderstandinginbasicgrammar. A laboratorycoursetoassistthestudent Grammar Review(1) ENGL 80(F,W,Sp) Center, Bldg.7,room4. quarter. ThesecoursesmeetintheWriting may enrollaslatethethirdweekof courses, notnecessarilyinsequence,and Students maytakeuptothreeofthese one hourinclassandlaboratory. laboratory courses.Eachcourseincludes All Englishcoursesnumberedinthe80’sare English 80's designed fornativespeakers. before attemptingtheEnglishprogram strongly advisedtocompletetheprogram Students enrolledintheESLProgramare Composition English: Course Descriptions 103 ENGL 103 (F, W, Sp) Argument and Persuasion (5) The application and further development of writing principles covered in ENGL 101. ENGL 103 is a composition course designed to develop the student's ability to write sound and cogent arguments in several academic disciplines. Coursework focuses on strategies for developing convincing evidence, with emphasis on critical thinking and library research skills. This course may not be taken "S/U." Prerequisite: A grade of "C" or higher in ENGL 101. ENGL 105 (F, W) Technical and Report Writing (3) A practical course in organizing, developing, and writing technical information, including reports. Attention given to (1) organizational patterns and report formats common to scientific and technical disciplines and (2) technical writing conventions, including heading, illustrations, style and tone. Same course as ENGR 231. Prerequisite: ENGL 101 and READ 93 with a grade of "C" or higher or ENGL 100 with a "C" or higher. ENGL 101 (F, W, Sp) 101 (F, W, ENGL (5) Composition Freshman College of of the principles Study and application and Students read, analyze, college writing. descriptive, and write expository, to essays, as well as learn argumentative fully, organize them develop ideas ENGL express them clearly. effectively, and essay. Literature 101 readings focus on the This course may is the focus in ENGL 102. not be taken "S/U." college-level Prerequisite: Scores at or above of "C" or higher in reading and writing or a grade ENGL 91 and READ 93. ENGL 102 (F, W, Sp) (5) College Freshman Composition development of The application and further in ENGL 101. The writing principles covered writing-primarily analytical-is based on the reading and discussion of literature. This course may not be taken "S/U." Prerequisite: A grade of "C" or higher in ENGL 101. ENGL 100/BUS 100 (F, W, Sp) Business English (5) An introduction to current business writing practices with particular attention to mechanics, punctuation and grammar. Students may take either ENGL 100 or BUS 100, but not both. Prerequisite: Assessment at college-level English and reading or a grade of "C" or higher in ENGL 91 and READ 93. ENGL 96 (F, W, Sp) Writing Center Tutorials (1) Laboratory course offers students one-on- one tutorial help with assignments for classes where writing is required, as well as help with independent writing projects. Course also includes computer-assisted tutorials and on-site drafting time. No outside work is assigned. Ten half-hour tutorial sessions per quarter must be completed for credit, but students are not limited to ten. Course can be added up to mid-term. May be taken a total of 4 times and is graded as "S/U" only. ENGL 91 (F, W, Sp) Composition (5) A course designed to improve the student's writing ability for entrance into ENGL 101. Coursework focuses on critical reading and analytic writing in response to readings, with emphasis on organization, unity, coherence, and adequate development; an introduction to the expository essays; and a review of the rules and conventions of standard written English. This course may not be taken "S/U." Prerequisite: Assessment at or above ENGL 91 and READ 93 or a grade of "C" or higher in ENGL 90 and READ 92. Prerequisite: Assessment at or above ENGL 90 and Prerequisite: Assessment at READ 92. ENGL 90 (F, W, Sp) ENGL (5) Writing Beginning basic is designed to introduce This course writing and to develop basic reading skills from emphasizes writing skills. Coursework as well as writing in response observation The focus is on writing to readings. of demonstrate a grasp sentences which and writing sound basic syntax and usage, a main idea paragraphs which express with a minimum clearly and develop it fully of errors in sentence structure, This course may punctuation, and spelling. not be taken "S/U." Paragraph Writing (2) A review of basic paragraph construction. This course provides extensive practice in writing unified, coherent, and well- developed paragraphs. ENGL 85 (F, W, Sp) Spelling (2) Course is designed to assist students lacking in spelling skills. The course concentrates on learning general rules and concepts of spelling as well as common exceptions and troublesome words. The class utilizes a spelling workbook with explanations and exercises accompanied by competency tests. Students may enroll during scheduled registration, and upon an instructor's recommendation, during the first three weeks of the quarter. ENGL 84 (F, W, Sp) ENGL 83 (F, W, Sp) Vocabulary Development (1) Self-paced course provides student with strategies and skills to develop vocabulary necessary to meet college demands. Student will develop vocabulary through context, pronunciation, structural analysis, and dictionary usage. Punctuation Review (1) Punctuation Review to review A laboratory course designed fundamentals. punctuation and other English rules, Workbook lessons provide explanations and practice exercises. Students may enroll during scheduled registration, and upon an instructor's recommendation, during the first three weeks of the quarter. ENGL 82 (F, W, Sp) A laboratory course designed to review A laboratory patterns and sentence basic sentence Workbook lessons provide construction. and practice in developing explanations patterns, including various sentence clauses and phrases. subordinate each lesson. Competency tests follow scheduled Students may enroll during instructor's registration, and upon an the first three recommendation, during weeks of the quarter. ENGL 81 (F, W, Sp) ENGL (1) Review Structure Sentence 104 Course Descriptions of "C"orhigher. Prerequisite: CompletionofENGL101withagrade intensive) meet needsofindividualstudents.(writing contemporary authors.Courseisflexibleto particular attentiontotechniquesusedby Writing offiction(shortstory,novel),with Creative Writing-Fiction(3,3) ENGL 276,277(F,W,Sp) "S" inENGL141. "B" orhigherinENGL101and102103an Prerequisite: Instructorpermission,andagradeof May betakenatotaloffourtimes. in theWritingCenterthroughoutquarter. Students applytrainingbytutoringstudents assisted tutoringande-mailtutoring. New topicsofstudyincludecomputer- training andexperienceaswritingtutors. Provides qualifiedstudentscontinued Writing CenterTutorPracticumIII(2) ENGL 145(F,W,Sp) 140. in aseries.Satisfactorycompletion("S")ENGL Prerequisite: Instructorpermission.Secondcourse quarter. supervised sessionsbytheendof opportunity toapplytrainingandskillsin technical assignments.Studentshavethe disabilities, anddiscipline-specific tutoring, tutoringstudentswithlearning Writing Centertheoriesandoperations,ESL study includetutoringandlearningstyles, settings intheWritingCenter.Topicsof experience intutoringstudentsone-on-one Provides qualifiedstudentswithtrainingand Writing CenterTutorPracticumII(2) ENGL 141(F,W,Sp) series. Prerequisite: Instructorpermission.Firstcourseina supervised sessionsbyendofthequarter. opportunity toapplytrainingandskillsin technical assignments.Studentshavethe disabilities, anddiscipline-specific tutoring, tutoringstudentswithlearning Writing Centertheoriesandoperations,ESL study includetutoringandlearningstyles, settings intheWritingCenter.Topicsof experience intutoringstudentsone-on-one Provides qualifiedstudentswithtrainingand Writing CenterTutorPracticumI(2) ENGL 140(F,W,Sp) individual students.(writingintensive) Instruction isflexibletomeettheneedsof the studyandanalysisofpoetrytechniques. A workshopforthewritingofpoetry,and Creative Writing-Poetry(2,2) ENGL 278,279(F,W,Sp) World Literature:1500toPresent(5) ENGL 241(varies) content) (writingintensive) of mythsandfolklore.(multicultural western culturesandontheliteraryvalue expressed bybothwesternandnon- commonality ofconcernsandvalues throughout theworld.Emphasisison A comparativestudyofmythandfolklore Stories (5) Introduction toMythologyandFolk ENGL 234(varies) content) (writingintensive) adventure, andromance.(multicultural the westernsciencefiction,fantasy, fiction. Representativecategoriesinclude understand thenatureandappealofpopular categories ofpopularfictiontobetter representative selectionsfromvarious developed overthepastcentury.Focusison A surveyofpopularfictionasithas Popular Fiction(5) ENGL 232(varies) and Sciencesdegree. multicultural requirementfortheAssociateinArts Courses designatedasmulticulturalmeet Completion ofENGL102isstronglyadvised. or higherisaprerequisiteforallliteraturecourses. Note: CompletionofENGL101withagrade"C" Literature English: of "C"orhigher. Prerequisite: CompletionofENGL101withagrade (writing intensive) to quarter.(multiculturalcontent) themes willbestudiedfromquarter literature. Variousculturalandhistorical A surveyofcontemporarynon-Western Literature (5) Contemporary Non-Western ENGL 242(varies) (writing intensive) of theworld.(multiculturalcontent) major literaryworksfromvariousparts The courseexaminesanumberof (multicultural content) literary devices.(writingintensive) such ascharacter,plot,theme,andother Study ofdramaanditsvariouselements Introduction toDrama(5) ENGL 259(varies) (writing intensive) of view.(multiculturalcontent) character, plot,theme,setting,andpoint various elementsoffictionsuchas Study ofshortstoriesandnovelsthe Introduction toFiction(5) ENGL 258(varies) content) (writingintensive) language, andsounddevices.(multicultural structure, diction,imagery,figurative Study ofpoetryandpoeticelementssuchas Introduction toPoetry(5) ENGL 257(varies) comedies, andsonnets.(writingintensive) of severalhistragedies,histories, Introduction toShakespearethroughastudy Introduction toShakespeare(5) ENGL 250(varies) (multicultural content) (writingintensive) beginnings throughtheCivilWar. Survey ofAmericanliteraturefromthe Beginnings to1860(5) American Literature:Fromthe ENGL 267(varies) 1780s). (writingintensive) (1630s) throughBlake(earlyRomantics, Survey ofEnglishliteraturefromtheDonne Through Blake(5) English Literature:FromDonne ENGL 265(varies) (writing intensive) (1100-1500), andtheEnglishRenaissance. English (500-1100),Middle major periodsofEnglishliterature:Old Survey ofEnglishliteraturefromthree Through Shakespeare(5) English Literature:FromBeowulf ENGL 264(varies) (multicultural content)(writingintensive) issues coveredaredifferenteachoffering. quarter. Maybetakentwiceasthemesand or issueswillbestudiedfromquarterto pertinent topresentsociety.Variousthemes A surveyofpopularthemesorsocialissues Drama/Poetry (5) Themes orSocialIssuesinFiction/ ENGL 260(varies) Course Descriptions 105 Prerequisite: ESL placement exam. ESL 96 Reading and Writing II (10) The second in a series of five reading and writing courses for non-native speakers of English at the high-beginning level. Students are introduced to the process of writing (planning, writing, editing, rewriting), as they progress from sentences to one-paragraph essays. Writing mechanics and spelling are also stressed. Reading assignments provide support for the writing projects while enabling students to improve their reading comprehension, speed, and vocabulary. Prerequisite: ESL 95 or ESL placement exam. ESL 93 III (5) Grammar and a series of five grammar The third in of for non-native speakers speaking classes The low-intermediate level. English at the on the usage with work focus is on grammar of spoken English. comprehension 92 or ESL placement exam. Prerequisite: ESL ESL 94 Grammar IV (5) five grammar and The fourth in a series of speakers of speaking classes for non-native level. The class English at the intermediate classroom focuses on grammar plus discussion and reports. placement exam. Prerequisite: ESL 93 or ESL ESL 95 Reading and Writing I (10) The first in a series of five reading and writing courses for non-native speakers of English at the beginning level. Students learn the basics of writing English sentences and are also introduced to the basics of the writing process (planning, writing, editing, rewriting) as they progress from sentences to single paragraphs, written in narrative style. Writing mechanics and spelling are also stressed. Reading assignments provide support for the writing projects while enabling students to develop their reading comprehension and expand their vocabulary. Prerequisite: ESL placement exam. ESL 92 Grammar II (5) The second in a series of five grammar and speaking courses for non-native speakers of English at the advanced-beginner level. This course is designed to give students a strong grammatical basis in English and to improve their speaking and listening skills. At least one oral report is required. Prerequisite: ESL 91 or ESL placement exam. Prerequisite: ESL 89 or placement exam. ESL 91 Grammar I (5) The first in a series of five grammar and speaking courses for non-native speakers of English at the beginning level. The course is designed to introduce students to basic English grammar and pronunciation. Prerequisite: ESL placement exam. ESL 90 Conversation and Pronunciation II (2) A course in conversation and pronunciation for students of English as a Second Language at the advanced-beginning to low- intermediate level. While developing conversational fluency, students improve their pronunciation of both the specific sounds and the intonation patterns of English. Some practice in note-taking is also included. Supplementary work in the language laboratory provides additional listening and speaking practice. Students enrolled in the ESL Program are in the ESL Program Students enrolled to complete the program strongly advised the English or Reading before attempting speakers. programs designed for native ESL 89 I (3) Conversation and Pronunciation in conversation and A beginning-level course of English as a pronunciation for students are introduced Second Language. Students English to the pronunciation of specific patterns, sounds and basic intonation in conversation. contexualized and practiced supplement Language laboratory lessons classroom work. English as a as English Second Language Independent Study (5) Individual study, project-oriented. Instructor permission required and the successful completion of ENGL 101 and 102. Note: Writers of the Pacific Rim offered Spring quarter. ENGL 299 (varies) Literatures of Diversity (5) An introduction to the literatures of various cultures. Includes a study of historical and cultural context within which the literature evolved. Various single authors or a combination of authors will be studied from quarter to quarter. May be taken twice as cultures or authors covered are different each offering. (multi-cultural content) (writing intensive) ENGL 280 (varies) Contemporary American Fiction (5) Contemporary American written since Study of American fiction on the major writers 1960 with an emphasis fiction. and themes of contemporary (multicultural content) (writing intensive) ENGL 271 (varies) Survey of American literature from Survey of American literature content) 1910-1960. (multicultural (writing intensive) ENGL 269 (varies) American Literature: From 1910 to 1960 (5) Survey of American literature from the Civil literature from the Survey of American of World War I. (multicultural War to the eve intensive) content) (writing ENGL 268 (varies) ENGL Literature: American to 1910 (5) From 1860 106 Course Descriptions emphasis oneditingandpolishingskills. process isstressed,withparticular transitions, andconclusions.Thewriting paragraph essayswithintroductions, speakers. Focusesonavarietyof5- students forcompositionclasseswith native English, designedtoprepareadvanced and writingfornon-nativespeakersof Last inaseriesoffivecoursesreading Reading andWritingV(7) ESL 159 Prerequisite: ESL94orplacementexam. vocabulary developmentarealsoincluded. comprehension, speakingskills,and advanced studentsofthelanguage;aural grammar thatpresentdifficultiesto course focusesonareasofEnglish of Englishattheadvancedlevel.The speaking coursesfornon-nativespeakers The lastinaseriesoffivegrammarand Grammar V(3) ESL 155 Prerequisite: ESL97orplacementexam. velop readingcomprehensionandretention. abling studentstobuildvocabularyandde- sary backgroundforcompositionswhileen- and expository.Readingsprovidetheneces- graphs: persuasive,descriptive,narrative, ing) withafocusonthesetypesofpara- erating ideas,organizing,writing,andrevis- tinuing workontheprocessofwriting(gen- multiple-paragraph compositionswhilecon- Students progressfromone-paragraphto of Englishatthehigh-intermediatelevel. reading andwritingfornon-nativespeakers The fourthinaseriesoffivecourses Reading andWritingIV(8) ESL 98 Prerequisite: ESL96orplacementexam. oral andwrittenreportsrequired. vocabulary. Outside-of-classreadingswith reading comprehension,retention,and writing activitiesandadditionallybuild assignments. Readinglessonssupport be practicedinthecontextofwriting Grammatical structuresandmechanicswill include narrative,descriptive,andsummary. short compositions.Typesofcompositions writing, editing,rewriting)inthecontextof practice theprocessofwriting(planning, at thelow-intermediatelevel.Students courses fornon-nativespeakersofEnglish The thirdinaseriesofreadingandwriting Reading andWritingIII(10) ESL 97 and vocabularybuilding. placed oncomprehension,speed,retention, component ofthecourse,withemphasis Readings providebackgroundforthewriting (multicultural content) conversation. Maybetakentwiceforcredit. American lifethroughreadings,videos,and English. Studentsexplorecurrentissuesin also appropriatefornativespeakersof intermediate oradvancedlevel.Theclassis on contemporaryAmericanatthehigh- A courseinconversationalEnglishfocusing and Conversation(3) American Culture ESL 190 developing vocabulary. of organizationandtransitions, main ideasanddetails,lookingatpatterns focuses onreadingskillsincludingfinding native speakersofEnglish.Thecourse An advancedcourseinreadingfornon- Advanced Reading(5) ESL 162 Prerequisite: PlacementintoESL159orhigher. three timesforcredit. American collegesetting.Maybetaken information necessaryforsuccessinan and speakingskills,studycultural providing practicewithvocabulary,listening presented inacollege-levelcontentclassby comprehension andretentionofmaterial of Englishtoincreasestudents' A coursedesignedfornon-nativespeakers Content StudySkills(2) ESL 161 instructor permission. Prerequisite: SuccessfulcompletionofESL159or sophistication ofsentencesandparagraphs. increase theaccurateness,variety,and to critiquetheirownworkinorder and paragraphstructure,allowingstudents assessment andimprovementofsentence speakers ofEnglish.Thecoursefocuseson An advancedcourseinwritingfornon-native Advanced Writing(5) ESL 160 Prerequisite: ESL98orplacementexam. courses: ENVSC106,146. should considerthefollowingnon-major in ArtsandSciences,GeneralStudies, distribution requirementsfortheAssociate general interestornaturalsciences department. Studentsseekingcoursesfor and consultwithanadvisorinthebiology with anEnvironmentalSciencespecialization towards anAssociateofSciencedegree baccalaureate institutionshouldwork science orenvironmentalstudiesata Students intendingtomajorinenvironmental Science Environmental successful completionofESL160and162. Prerequisite: Instructorpermissionandthe May betakenaspass/fail. Project-oriented individualstudyorwork. Individual Study(2) ESL 199 Prerequisite: ESL94orplacementexam. poetry reading,roleplaying,debate. variety ofspeechactivities:giving, advanced level.Studentsparticipateina intonation levelsatthehighintermediate- American Englishandofwordaccent production ofindividualphonemes Instruction andpracticeinrecognition Conversation andPronunciationIII(2) ESL 191 field-trip. involve weekendandpossibleovernight analysis, libraryresearch,andwriting. May experiments. Willinvolvesomecomputer local ecosystems,fieldwork,andlab habitat alterations).Strongemphasis on nutrient cycles,populationdynamics, and theirenvironments(eg.symbioses, Study ofthefactorsaffectingorganisms Introductory Ecology(5) ENVSC 145 Prerequisite: ENGL91orhigher. and fieldtripsincluded. national andlocalperspectives.Laboratories economic, andpoliticalissuesfromglobal, identified andrelatedtorelevantethical, covered. Underlyingscientificprinciplesare forest resources,energy,andpollutionare students. Topicssuchasoverpopulation, non-science majorsandbeginningscience An interdisciplinarysciencecourseforboth Environmental Science(5) ENVSC 106(F,W,Sp) Course Descriptions 107 GEOL 101 (F, W) Physical Geology (5) Provides students with an introduction to the materials and landscapes of the earth, and the diverse geological processes that produce and change them. Subjects such as volcanoes, glaciers, rivers, and earthquakes will be studied. The laboratory consists of diverse activities, including examination of rocks and minerals. Includes local fieldtrips. GEOL 105 (F, W, Sp) Earth Systems Science (5) Provides an introduction to earth systems by studying the lithosphere, biosphere, hydrosphere, and atmosphere, and how these realms interact to produce the dynamic earth that we inhabit. Hands-on exercises will involve work with rock samples, weather gauges, and maps and diagrams. This course is taught online via the Internet. GEOG 210 GEOG (5) Environment GIS and the Maps, of to the elements Introduces students systems (GIS) geographic information map data structure, including cartography, spatial analysis. Applications overlays, and to issues relating of GIS to environmental soil watershed management, hydrology and and science, land-use planning, in a hands-on conservation are explored field activities and style, incorporating both is the same GIS software. This course Students may course as ENVSC 210. GEOG 210 or receive credit for either ENVSC 210 but not both. Geology for general Students seeking courses interest or degree distribution requirements may consider GEOL 101, GEOL 108, and GEOL 125 (and GEOL 105 for general elective categories) for the Associate in Arts and Sciences, General Studies, Applied Sciences and Technical Arts degrees. Students intending to major in Geology at a baccalaureate institution should work towards an Associate of Science degree with an Earth Sciences Specialization and consult with the earth sciences advisor. Prerequisite: Familiarity with Windows. GEOG 205 Physical Geography (5) Study of the formation and evolution of the physical features of the earth, including the atmosphere, climate, and weather; rocks, minerals, vegetation, and soils; erosion and modification of the earth's surfaces; and human impact and modification. Laboratory included. GEOG 200 Introduction to ArcView GIS Provides students with an introduction to the principles of geographic information systems, uses of the technology, and hands-on experience with ArcView software. Practical skills will be learned through tutorials and an independent project in which the student develops a GIS. The independent project will focus on gathering geographic data, assembling the GIS, performing analyses, and presenting the results. Prerequisite: 8th grade level basic skills Prerequisite: 8th grade level recommended. Geography GEOG 110 (varies) Geography of the Pacific Rim (5) Students will study the geographical elements of the Pacific Rim area. The physical and cultural attributes of each country will be compared. Problems related to the physical environment, ethnic composition, and resources will be emphasized. (multicultural content) ABE 05/06 General Education Development to prepare for For the student who wishes test (GED). the high school equivalency subject and skill Emphasis is on the five include: areas of the GED test, which II - social Test I - writing skills; Test Test IV - reading studies; Test III - science; Students may skills; Test V - mathematics. quarter. enroll any time during the General Education Development (GED) Prerequisite: FREN 101 or equivalent with a grade of "C" or higher for 102; FREN 102 or equivalent with a "C" or higher for 103. An introduction to the basic elements of contemporary French language and culture with emphasis on developing students' listening, speaking, reading and writing skills. (FREN 103 multicultural content) FREN 101, 102, 103 (F) (W) (Sp) Beginning French (5, 5, 5) French Placement of students with previous foreign language training will be made by the course instructor. Foreign language challenge credit will not be awarded for native languages. Introduces students to the elements of Introduces students to systems (GIS) geographic information structure, map including cartography, data Applications overlays, and spatial analysis. of GIS to environmental issues relating to hydrology and watershed management, soil science, land-use planning, and conservation are explored in a hands-on style, incorporating both field activities and GIS software. This course is the same course as GEOG 210. Students may receive credit for either ENVSC 210 or GEOG 210 but not both. ENVSC 210 (5) Maps, GIS and the Environment Specific environmental topics will be Specific environmental which a variety of methods explored using seminars, lectures, research may include all- field work, and projects, presentations, on the field trips depending day or overnight topics for any one quarter offered. Example Toxins and quarter may include Biodiversity, Invasives, Human Health, Non-Native Wetlands, etc. ENVSC 179 ENVSC Topics in Special Science (2) Environmental 108 Course Descriptions comprehension skills. work assistsstudentswithspeaking and hension andgrammarusage.Laboratory proper pronunciation,auditorycompre- of thelanguage.Emphasisisplaced on in speaking,writingandcomprehension foundation foranelementaryproficiency culture andconversationtoprovidea expose studentstoGermangrammar, The firstcourseinaseriesdesignedto German I GERM 101(F) German Prerequisite: GEOL101andInstructorpermission. individual basis. Study ofselectedgeologictopicsonan Individual StudyinGeology(1-5) GEOL 299 Prerequisite: Instructorpermission. component oftheseminars. program. Fieldtripswillbeanimportant interest ofstudentsintheearthscience but mayalsoreflecttheexpressedneedor generally bedeterminedbytheinstructor study ofselectedgeologictopics.Topicswill students withanopportunityforadvanced Seminars designedtoprovidegeology Special TopicSeminars(2) GEOL 179 itinerary forthetripvariesquarterly. study thegeologyfirsthand.Theexact travel tospectaculargeologiclocalities extended fieldtripportioninwhichstudents of geologyarecovered,followedbyan segment inwhichthefundamentalprinciples introductory geology.Includesaninitial Geology intheFieldisanintensivecourse Geology intheField(5-12) GEOL 125(Su) GEOL 108butnotboth. Students mayreceivecreditforBIOL105or This courseisthesameasBIOL105. fossil specimensandincludeslocalfieldtrips. The laboratoryfocusesonstudyingrockand evolution, andasurveyofthehistorylife. fossilization processes,principlesof such asplatetectonics,rockidentification, record oflifeonthisplanet.Coverstopics processes thatcreatedtheastounding Introduction tothegeologicalandbiological Fossils andtheHistoryofLife(5) GEOL 108(W,Sp) speaking andcomprehensionskills. Laboratory workassistsstudentswith comprehension andgrammarusage. proper pronunciation,auditory the language.Emphasisisplacedon in speaking,writingandcomprehensionof foundation foranelementaryproficiency culture andconversationtoprovidea expose studentstoGermangrammar, The secondcourseinaseriesdesignedto German II GERM 102(W) (multicultural content) negotiation strategiesandpractices. including protocolandetiquette, behavior inglobalbusinesssettings, guidelines foreffectiveinterpersonal countries, andregions.Identifiessuggested communication differencesacrosscultures, systems; customs,historical,religious,and political, social,economicandlegal on globalbusinessoperations.Examines Study ofculturalfactorsandtheirimpact Global Business(5) Cultural Aspectsof GBUS 210 Global Business instructor permission. Prerequisite: GERM102witha"C"orhigher speaking andcomprehensionskills. Laboratory workassistsstudentswith comprehension andgrammarusage. proper pronunciation,auditory the language.Emphasisisplacedon in speaking,writingandcomprehensionof foundation foranelementaryproficiency culture andconversationtoprovidea expose studentstoGermangrammar, The thirdcourseinaseriesdesignedto German III GERM 103(Sp) instructor permission. Prerequisite: GERM101witha"C"orhigher intensive) (multiculturalcontent) issues ofthe21stcentury.(writing international cultures,thePacificRim, and and production.Emphasiswillbeplaced on business management,marketing,finance multinational corporations,international international worldofbusiness: This courseprovidesanoverviewofthe Introduction toGlobalBusiness(5) GBUS 220 introduced intheGlobalBusinessProgram. cover anyoftherelatedbusinesssubjects public- sectororganization.Internshipscan experience andtraininginaprivate-or earn collegecreditsforhands-onwork During onequarteroftheyear,studentscan Work Internship(5) GBUS 290 products domesticallyarealsoconsidered. importing goodsintotheU.S.andmarketing process andgeneralrequirementsof conducting businessabroad.Theimport company seekingpracticalhelpin exporting thatshouldbeconsideredbya This coursefocusesonissuesrelatingto Global TradeandTransportation(5) GBUS 240 companies. (multiculturalcontent) Emphasis oncasestypicalofvarious-sized marketing productsandservicesglobally. as processes,issues,andopportunitiesfor global marketingtheoriesandtrends;aswell and differencesbetweendomestic A comparativeanalysisofthesimilarities Global Marketing(5) GBUS 230 permission. Prerequisite: HT130orCU105,instructor tion. (4hourslecture,2labperweek). confidentiality andreleaseofhealthinforma- other ancillaryservicedepartments,patient dures; functionsoftheadmittingdepartment, methods ofrecordstorageandretrieval proce- record completionsystemsandrequirements, record, includingin-depthstudyofphysicians ments; development,contentandformatofthe use ofcomputersinhealthinformationdepart- health informationpractitioners;functionsand ethics oftheprofessionalorganizationfor records; astudyoftheobjectivesandcodes Survey ofdevelopmentandcontenthealth Management (5) Intro toHealthRecord HIM 180(F,Sp) Technology Information Health Prerequisite: ProgramChairpermission. Study onanindividualbasis. Projects (1-5) Independent Study&Special GBUS 299 Prerequisite: ProgramChairpermission. Course Descriptions 109 Prerequisite: Assessment at college-level reading and English. HT 120 (W) Medical/Dental Office Management (5) This course is designed to instruct the student in basic business practices and procedures as they relate to the medical practice and dental office; including professional intra-relationships, basic medical practice issues, patient management, professional referral, legal issues, scheduling, coding, billing, correspondence and forms, insurance billing, collecting and posting of accounts receivable and accounts payable, financial issues and budgeting, and internal practice marketing. The student will also become familiar with various functions of the "back office," to include patient interactions and common clinical procedures, and equipment and supplies used in a medical practice. Prerequisites: HT 130, HT 110, IT 235 or CU 105 (or concurrent enrollment) or instructor permission. HIM 299 in HIM (1-5) Study Individual in of an aspect of HIM Individual study of with the interest and ability accordance and the approval of the the student the to be arranged on instructor. Credits nature and extent of the basis of the project undertaken. Prerequisite: Instructor permission. Health Technology HT 110 (F) Systems (4) Health Care Delivery concepts of health Interdisciplinary course: and delivery in care organization, finance, among the United States; interrelationships facilities, agencies and health organizations; interrelationships between health personnel and the medical staff in the delivery of health care; professional ethics; accreditation, licensing and certification standards. Classroom instruction and field visit. Prerequisite: HT 110, HIM 220, HT 216, or instructor permission. Prerequisite: HIM 241 or concurrent enrollment or instructor permission. HIM 252 Medical Reimbursement Management (3) Course is designed to provide students with skills in medical reimbursement management for use in a variety of health care settings with emphasis on outpatient settings. Includes advanced applications of ICD-9-CM and CPT Coding practice and principles in case mix analysis, DRGs, RBRVS, and APGs, as these impact the financial reimbursement and marketing issues for health care facilities. Emphasis is on the advantages of computerized systems in the tracking and statistical analysis of these functions. Prerequisite: BUS 110, HIM 180, CU 110, HIM 220, and HIM 230. HIM 242 (Sp) Health Information Management (3) Development of management and supervi- sory skills, including planning, organizing, directing and controlling. Special emphasis in systems management. Prerequisite: HIM 222 (or concurrent enrollment), Prerequisite: HIM 222 (or concurrent HIM 231, or instructor permission. HIM 241 (W) Data Quality and Care (5) Statistics for Health of the pur- Study and practical application function of continu- pose, organization, and utilization man- ous quality improvement, hospital accredita- agement, standards for tion and licensure, and calculation and pre- sentation of statistical data. This course addresses the role of the Joint Commis- sion, Government agencies, and the United States Vital and Public Health Statistic. HIM 232 (Sp) HIM 232 III (6) Applications Clinical performing health Practical experience management duties in seminar information health facilities to give the and in local opportunity to actively perform student the on- Fifteen hours per week technical duties. total care facilities for a site in specialized of 150 hours per quarter. Prerequisite: HIM 220, 230, 241, HIT 216 or concurrent enrollment and instructor permission. Practical experience performing health information duties in seminar and in local health facilities to provide the opportunity to actively perform technical duties. 120 hours total per quarter on-site in hospitals. HIM 231 (W) Clinical Applications II (5) Prerequisite: HIM 180, HIM 190, or instructor permission. HIM Clinical Lab (3) Practical experience performing health information duties in the campus laboratory including physicians' incomplete chart system, organizing and maintaining automated disease and operations indices, tumor registry, vital records, writing of policies, procedures, flow charts, and job descriptions in preparation for acute care hospital clinical experience (HIM 231). Special emphasis is placed on computer applications of these functions. Prerequisite: HIM 241, HIM 232, current enrollment or instructor permission. HIM 230 (F) Continued study of health record systems for ambulatory care, psychiatric, long- term care, home health care and mental retardation facilities, including licensure and accreditation standards. (2 hours lec- ture, 2 hours lab per week.) HIM 222 (Sp) Health Records in Alternate Care Settings (3) Prerequisite: HIM 180, HIM 190, HT 210 (or concurrent enrollment) or instructor permission. HIM 220 (F) ICD-9-CM Coding (5) according Coding of diseases and operations of Dis- to the International Classification Course covers eases, Clinical Modification. systems with an coding of all major body Groups emphasis on Diagnosis Related (DRGs), including computerized encoders. Prerequisite: Concurrent enrollment in HIM 180 or Prerequisite: Concurrent enrollment instructor permission. Students spend one hour in seminar on cam- one hour in seminar Students spend of plus a total of 30 hours pus per week, infor- performing health practical experience care fa- duties in local health mation clerical man- health information cilities to introduce the to practitioners and agement students health care environment. HIM 190 (F, Sp) HIM 190 I (2) Applications Clinical 110 Course Descriptions and issues. placed onunderstandingculturaldifferences writing inSpanish.Specialemphasiswillbe speaking, listening,comprehendingand related professionsasolidfoundationin the coursewillprovidestudentsinhealth- As acontinuationofMedicalSpanishLevelI, Introduction -LevelII(2) Medical Spanish, HT 135 related situations. how touseSpanishinbasicmedically pronunciation andabasicunderstandingof basic vocabulary,commonphrases, Spanish. Classwillacquaintstudentswith Designed forstudentswhodonotspeak Introduction -LevelI(2) Medical Spanish, HT 134 Prerequisite: HT130orinstructorpermission. medicine, andmentalhealth. pathology, therapeuticradiology,nuclear oncology, anesthesiology,pharmacology, spelling termsrelatedtosystemicdisorders, terminology. Identifying,definingand clinical laboratoryandradiology medical abbreviations,selectedeponyms, pronunciation ofallmedicalterms;study emphasis onaccuratespellingand symptomatic termsofbodysystemswith study ofdiagnostic,operative,and and suffixes;principlesofwordbuilding; Continuing studyofselectedroots,prefixes Medical TerminologyII(5) HT 131(F,W,Sp,Su) and English. Prerequisite: Assessmentatcollege-levelreading laboratory andradiologyterminology. abbreviations, selectedeponyms,clinical medical terms;studyof accurate spellingandpronunciationofall terms ofbodysystemswithemphasison of diagnostic,operative,andsymptomatic suffixes; principlesofwordbuilding;study Study ofselectedroots,prefixesand Medical TerminologyI(3) HT 130(F,W,Sp) Terminology (5) Comprehensive Medical HT 137(F,W,Sp,S) and operations. procedures forapplicationincodingdiseases information onlaboratoryandradiology treatment ofspecificdiseaseswithgeneral the cause,signs,symptoms,diagnosis,and Introduction tohumandiseaseintermsof Introduction toDiseaseProcess(3) HT 139(varies) book content.Onlinecourse. also becoveredwhichwillcompletethetext ters ofPharmacologyandPsychiatrywill tion willbestressedandrequired.Thechap- reports andphysiciangenerateddocumenta- stand, andinterpretvarioustypesofmedical ment modalities.Theabilitytoread,under- symbology, systemicdiseases,andtreat- tic procedures,advancedabbreviationsand Studies willincludediagnosticandtherapeu- emphasis onspecializedclinicalapplications. studies inthesystemsofbodywithan base throughcontinuedmedicalterminology pand andenhancethestudent'sknowledge ogy (HT137).Theclassisdesignedtoex- course -ComprehensiveMedicalTerminol- This coursebuildsontheprerequisite Advanced MedicalTerminology(3) HT 138(F,W,Sp,S) each bodysystem.Onlinecourse. procedures withassociatedterminologyfor clinical laboratoryproceduresandradiology medical abbreviations,selectedeponyms, nent ofthecourseisrelatedtocommon ciation ofallmedicalterms.Astrongcompo- Emphasis onaccuratespellingandpronun- terms ofthevarioussystemsbody. of diagnostic,operativeandsymptomatic fixes, principlesofwordbuilding,andstudy A studyofselectedroots,prefixesandsuf- permission. or CU105(orconcurrentenrollment);instructor of 45wpm(orwordprocessingskills);and IT235 Prerequisites: ENGL100,HT130andtyping speed of medicalreferences. terminology, medicalreportformatand use with academicstudyofselected operative reportsanddischargesummaries examinations, consultations,x-rayreports, actual physiciandictationinhistory/physical physicians offices;includingtranscriptionof medical reportsforhospitals,clinicsand processing andmachinetranscriptionof A sequentialcourseinvolvingskillsinword Medical TranscriptionI/II/III(3,3,3) HT 140,141,142(F,W,Sp,S) permission. Prerequisites: BIO118,HT130,orinstructor instructional techniques. include lectureandcomputer-assisted treatment ofdiseases.Thiscoursewill clinical applicationsofpharmacologyin classification, andusage,emphasizing Pharmacology toincludeterminology,drug This isanintroductorycoursein Health Professionals(2) Pharmacology for HT 150(F,W,Sp) permission. Prerequisite: HT140,160,orinstructor privacy, confidentialityanddocumentation. software technology,stressmanagement, assurance practices,equipmentand including productivityrequirements,quality transcription andhealthinformation, overview ofissuesandtrendsinmedical This courseprovidesstudentswithan Professional Development(2) Medical Transcription HT 143(F,W,Sp) word processingskills);orinstructorpermission enrollment inHT140,typingspeedof45wpm(or Prerequisites: ENGL100,HT130,concurrent lab perweek). offices usingawordprocessor.(4hours reports forhospitals,clinics,andphysician transcription skillsintranscribingmedical A beginningcoursedevelopingmachine Medical TranscriptionLabI(2) HT 160(F,W,Sp,S) is onCPTambulatoryservicescoding. procedure codingandCPTcoding.Emphasis and applicationsforICD-9-CMdisease Familiarization withbasiccodingconcepts and medicalclinicsservingoutpatients. coding usedinhospitals,physiciansoffices Introduction todiagnosisandprocedural Ambulatory Services(3) Introduction toMedicalCodingfor HT 159(varies) Course Descriptions 111 Prerequisite: Instructor permission. Prerequisite: Instructor permission required. HT 250 Clinical Applications for Health Information Coding Specialists (3) This course provides skill practice for HICS students in their final quarter of the program. The course consists of a professional seminar and medical record coding practice (two credits or 40 hours). Coding practice includes in-patient, out- patient and emergency coding. This is the final capstone experience prior to completion of the program in readiness for employment as a coding specialist. HT 299 (F, W, Sp) Individual Study in Medical Secretary/Transcription (1 - 5) An independent learning activity, designed jointly by student and instructor, to improve and/or increase the knowledge and skill of the medical secretary or transcription student. HT 240 for Medical Applications Clinical (3) Billing Specialists for the Medical Billing Work internships the provide students Specialist program skills. to apply their training and opportunity a total of 90 hours in Students spend experiences in health supervised practical should be the care facilities. Internship Students must culmination of course work. provide their own transportation. required. Prerequisite: Instructor permission HT 241 (varies) for Medical Clinical Applications Medical Office Professional and Transcriptionist (5) (formerly Medical Secretary) Medical Office Work internships for the Professional and Medical Transcriptionist programs provide students the opportunity to apply their training and skills. Students spend a total of 150 hours in supervised practical experience in health care facilities. Internship should be the culmination of course work. Students must provide their own transportation. Prerequisite: HIM 180 or instructor permission. HT 225 (F) Legal Concepts for the Health Field (3) Principles of law including case studies as applied to health care professionals. The course surveys the U.S. Court System, legal proceedings and terminology, conduct of witnesses and rights and responsibilities of patients and health care professionals. The course gives particular reference to all phases of medical documentation, including release of medical information and professional ethics. HT 216 (W, Sp) CPT Coding (5) Instruction in basic, comprehensive, and more advanced aspects of coding with Current Procedural Terminology (CPT-4) for use in various health care settings. Designed to provide the student with a comprehensive understanding of CPT coding guidelines, rules, and regulations; a basic understanding of HCPCS Level II Coding; a basic working knowledge of E/M coding methods; and a thorough working knowledge of CPT-4. Prerequisite: HT 130, HT 131, BIOL 118; or instructor permission. Prerequisite: HT 130 and 131; or instructor Prerequisite: HT 130 and 131; permission. HT 215 (Sp) Advanced ICD-9-CM and CPT Coding for Health Personnel (2) An advanced course for experienced coders. Instruction on the more difficult sections of the coding system, coding exercises, and advanced practice using abstracted medical records. Prerequisite: HT 214 (or HIM 220), HT 216; or instructor permission. Prerequisite: BIOL 118, HT 130, HT 131. Prerequisite: BIOL HT 214 (F, Sp) Basic Principles of ICD-9-CM Coding (2) principles of Instruction on the basic operative coding of diseases and an introductory procedures. Designed as well as a review course for beginners, as course for practitioners. HT 210 (Sp) HT 210 (5) of Disease Principles and medical conditions Selected general specific body systems, including diseases of symptoms, diagnostic etiology, signs, and clinical course, therapy procedures, course. prognosis. Lecture Prerequisite: HT 130 or concurrent enrollment. Introduces common knowledge of patient care including venipuncture and EKG placement. Observation, communication, and basic nursing technical skills are taught; legal-ethical issues and seven hours study of communicable diseases/AIDS are included. Provides basic knowledge regarding the initiation and maintenance of intravenous access, as well as basic introduction to EKG's, including placement of leads. Recognition that the patient's health problems, including evaluation of patient responses during procedures, are the foci of activities for the health care team will be emphasized. Lecture and lab course. Same course as RS 170. HT 170 (W) Introduction to Fundamentals of Patient Care (5) Prerequisites: HT 141, HT 161, concurrent enrollment in HT 142; or instructor permission An advanced lab course using word processing and machine transcription of medical reports for hospitals, clinics, and physician offices including transcription of actual physician dictation in history and physical examinations, consultations, radiology reports, operative reports, and discharge summaries with academic study of selected terminology, medical report format and technological advances. (4 hours lab per week). HT 162 (F, W, Sp, S) Lab III (2) Medical Transcription Prerequisites: HT 140, HT 160, concurrent Prerequisites: HT 140, HT 160, permission enrollment in HT 141; or instructor An intermediate lab course developing word lab course developing An intermediate skills machine transcription processing and medical reports for in transcribing and physician offices. hospitals, clinics, of actual physician dictation Transcription procedure notes, history/ in clinic notes, consultations, physical examinations, reports, and radiology reports, pathology continuing study discharge summaries with medical report of selected terminology, references. (4 format, and use of medical hours lab per week). HT 161 (F, W, Sp, S) (F, W, Sp, HT 161 II (2) Lab Transcription Medical 112 Course Descriptions modular format. history tothepresent.Self-paced,lab-style History ofthePacificNorthwestfrompre- Washington StateHistory(5) HSC 94(F,W,Sp,Su) modular format. citizen responsibility.Self-paced,lab-style lobby andpressuregroups,voting the taxsystem,two-party government structure,service, Fundamental conceptsoffederalandstate Government (5) Introduction toAmerican HSC 93(F,W,Sp,Su) Self-paced, lab-stylemodularformat. States historyfrom1865tothepresent. Major areasandbasiceventsinUnited U.S. HistoryII(1865toPresent)(5) HSC 92(F,W,Sp,Su) modular format. Reconstruction. Self-paced,lab-style to about1830,theCivilWar,and development ofslaveryfromColonialdays between the1820sand1860s, Revolution, democraticandsocialreforms expansion, theWarof1812,Industrial Confederation, theConstitution,westward the UnitedStates,Articlesof beginnings, RevolutionaryWar,thebirthof America beforetheEuropeans,colonial U. S.HistoryI(Pre-Colonial-1900)(5) HSC 91(F,W,Sp,Su) modular format. affairs, andterrorism.Self-paced,lab-style metropolitan areas,theenvironment,world minorities, criminaljusticeanddissent, youth andthefamily,economy,health, Areas ofsocialproblemswhichinclude Contemporary Problems(5) HSC 90(F,W,Sp,Su) Completion High School World Civilization(5) HIST 111(F) History (3) The JapaneseAmericanExperience HIST 147(varies) (multicultural content) Asian countriesduringthisperiodoftime. dramatic changesthatoccurredtotheEast 1800 topresent.Thefocuswillbeonthe students totheEastAsiancivilizationfrom This courseisdesignedtointroduce East AsianCivilizationII(5) HIST 121(varies) (multicultural content) political systemsandtheintellectualworld. the coursewillbeonevolutionof the pre-historicalerato1800.Thefocusof students totheEastAsiancivilizationfrom This courseisdesignedtointroduce East AsianCivilizationI(5) HIST 120(varies) political ideologies. the world,conflictofeconomicand present; impactofindustrializationon Modern civilizationfrom1815tothe World Civilization(5) HIST 113(Sp) the world. expansion ofEuropeaninfluencethroughout commerce, industry,cultureandscience; Renaissance to1815;revolutionsin Rise ofmodernnationsfromtheEuropean World Civilization(5) HIST 112(W) political, culturalandeconomicaspects. to the14thCentury,includingsocial, Development ofmanfromprehistoricdays present. (multiculturalcontent) Shang Dynasty(c.1751-1123B.C.) tothe social andeconomicdevelopmentsfromthe cultural traditions,politicalchangesand Study ofChinesephilosophies,religions, Chinese Civilization(5) HIST 211(varies) the present.(multiculturalcontent) the JapaneseAmericansfrom1880sto An historicoverviewofthecontributions (writing intensive) prominence inEuropeanandworldaffairs. British Empire,andGreatBritain'sriseto Industrial Revolution,thedevelopmentof relations, thecausesandeffectsof emphasizing Irish,Welsh,Scots,andEnglish the Britishnationbetween1785and1914, This courseexaminesthedevelopmentof Nineteenth Century(5) History oftheBritishIslesII: HIST 222(varies) Revolution. (writingintensive) and thecauseseffectsofAmerican establishment oftheFirstBritishEmpire, War andtheGloriousRevolution, causes andconsequencesoftheEnglishCivil politics duringtheTudor/Stuartera, dynasty, theintertwiningofreligionand relations, theestablishmentofTudor emphasizing Irish,Welsh,Scots,andEnglish the Britishnationbetween1485and1785, This courseexaminesthedevelopmentof 1485-1785 (5) History oftheBritishIslesI: HIST 221(varies) (multicultural content)(writingintensive) in theformationofJapanesecivilization. social, religiousandphilosophicalinfluences Historical studyofJapan,withemphasis on Japanese Civilization(5) HIST 230(varies) (multicultural content)(writingintensive) twentieth-century worldleader. separatism, andCanada'sroleasa relations, nationalismandQuebec intercultural relations,U.S.-Canadian Topics include:Europeanimperialism, foundation ofNewFrancetothepresent. aspects ofCanadianhistoryfromthe Examines thepolitical,economic,andsocial History ofCanada(5) HIST 225(varies) content) (writingintensive) development oftheEEC.(multicultural British CommonwealthofNationsandthe transformation oftheBritishEmpireinto world orEuropeanpowerviathe the changeinGreatBritain'sstatusasa relations, WorldWarIandII, present day,emphasizingmulticultural the Britishnationbetween1901and This courseexaminesthedevelopmentof History oftheBritishIsles,III(5) HIST 223(varies) Course Descriptions 113 HFL 95 The Consumer and the Market Place (5) Selecting goods and services, comparing costs, availability and quality of goods; using credit, consumer agencies, and consumer information. HIST 290 (varies) Introduction to Historical Reasoning (5) The nature of historical reasoning for first- year college students. "What is history?" and "Why is history an important first step in understanding the humanities?" Course presents historical-mindedness as a necessary check against anti- intellectualism, pre-sentism, narcissism, and radical doctrines of discontinuity. Home and Family Life Education HFL 91 Nutrition for the Family (3) Covers nutritional needs of adults and children, the effects of good nutrition and planning meals to meet needs of all ages and stages of development. HIST 255 (varies) HIST (5) Movement Civil Rights traces the struggle by African- This course of acquire the basic rights Americans to By and equal rights. humanity, freedom, to the men and women central focusing on the the course touches on the movement, left gains achieved, and areas methods used, to be accomplished. HIST 260 (varies) Russian History (5) as revealed in Russia's material civilization political, the arts, literature and history; institutions and economic, social and legal to the thoughts are studied in relation Russian development of 20th Century society. (multicultural content) HIST 264 (varies) History of Washington and the Pacific Northwest (5) Exploration, settlement and growth of the Northwest with emphasis on Washington, including growth of govern- ment and social institutions. This course is an integral component of U.S. history that focuses on African Americans. It traces their roots in the Old World and their experiences in the new one. Although the course focuses on African Americans, it examines how they shaped the people around them and how the people, in turn, shaped them. In this way, it is also a study in intellectual relationship. (multicultural content) HIST 251 (varies) Native American History (5) This course will examine the history of Native American cultures in the United States. Through readings, lectures, and class discussions, students will explore the unique histories of several specific Native cultures, as well as the impact that these cultures had in shaping the course of American history. HIST 254 (varies) Introduction to African-American History HIST 250 (varies) The War in Vietnam (5) Study of the origin and development of the war in Vietnam from 1940 to 1975. Special emphasis will be devoted to Vietnamese nationalism, French imperialism and its defeat, American involvement from Presidents Roosevelt, Truman, Eisenhower, Kennedy, Johnson, Nixon, and Ford. The course will conclude with an examination of the impact of the Vietnam War on America and on the world. HIST 249 (varies) American Diplomatic 20th Century History (5) States' rise to Course will survey the United to the present, with world power from 1898 to the causes and particular attention given U.S. participation consequences of increased initial reluctance in world affairs, America's of the and ultimate acceptance (writing responsibility of world leadership. intensive) Particular attention will be paid to the will be paid attention Particular as a such of traditions, development a belief in American tradition of violence, a moral imperative, a exceptionalism, (writing intensive) heritage of success. The Diplomacy of the United States to 1898 (5) A survey of the American diplomatic history from the American revolution to the war with Spain. It will examine the issues and events, which shaped the foreign relations of America's first century of independence. HIST 248 (varies) A Decade: Revolving Time Periods (5) This course will examine key political, social, cultural, economic and diplomatic events with a specific decade. Time periods covered will vary. HIST 244 (varies) The United States during the time of the Populist-Progressive movement, the prosperous Twenties, the Depression Thirties, World War II and the Cold War. (multicultural content) (writing intensive) HIST 243 (Sp) United States History: 20th Century (5) United States History: 19th Century (5) The United States during the time of the early Republic: the developing sectional tensions over land acquisitions, social reform and slavery; the Civil War and Reconstruction, and the rise of large industrial corporations after the war. (multicultural content) (writing intensive) HIST 242 (W) The development of America in the 17th and The development of America and English 18th Centuries: European and influences on religion, politics nationalism and economics; the growth of and the problems the American Revolution; content) of the new nation. (multicultural (writing intensive) HIST 241 (F) United States History: (5) 17th, 18th Centuries Examines U.S. History, society and culture Examines U.S. the lens of Hollywood since 1929 through Topics include: the Great feature films. the Cold War at home and Depression, roles and the American abroad, gender civil rights movement. family, and the intensive) (multicultural content) (writing HIST 231 (varies) HIST Film (5) American History, American 114 Course Descriptions insurance; andtaxes. savings; creditandinstallmentbuying; energy; purchasinggoodsandservices; Planning andbudgetingmoney,time and Consumer andFamilyEconomics(3) HFL 115 expectations. course shouldmeethighschool-level every child.Studentsparticipatinginthis and materialsthatdevelopthetalentsof emphasis ontechniques,activities,books enthusiastic, self-motivatedlearnerswith children. Helpingchildrenbecome intellectual, physicalandcreativeskillsin students withskillstohelpfoster focusing onlearningdevelopment.Provides An introductiontoparentingskillsseries Learning Development(1) Child &FamilyStudiesI: HFL 99(Sp) school-level expectations. in thiscourseshouldmeethigh solving techniques.Studentsparticipating expectations andlimits,problem self-esteem, positivelycommunicating various ages,learningthelanguagetobuild Understanding whatbehaviorstoexpectat communication andguidancetechniques. of socialskills,valuesandgoalsthrough series withemphasisonthedevelopment An introductiontotheparentingskills Child Development(1) Child &FamilyStudiesI: HFL 98(W) school-level expectations. participating inthiscourseshouldmeethigh environment forfamilymembers.Students emotionally andphysicallyhealthyhome course willfocusonprovidingan safety needs,andasenseofbelonging.The shelter, healthcare,personalandphysical survival needs,includingadequatenutrition, parenting resources.Topicsincludebasic An introductiontoparentingskillsand Health, Safety,andNutrition(1) Child &FamilyStudiesI: HFL 97(F) to parentingpractices. relationship ofchilddevelopmentprinciples and managingbehavior.Examinesthe Methods ofcommunicatingwithchildren Parenting Skills(1) HFL 96 classroom onaregularbasis. credit forparticipatingintheirchild's TCC Children'sCentermayreceiveoneextra Parents whosechildrenareenrolledatthe parent-child interactionwillbeexplored. solving andgoalsetting.Leadingtheorieson management, individualandfamilyproblem include methodsofcommunication,behavior Developing andrefiningparentingskillsto Positive Parenting(3-4) HFL 132 should meetcollege-levelexpectations. child. Studentsparticipatinginthiscourse materials thatdevelopthetalentsofevery emphasis ontechniqueactivities,booksand enthusiastic, self-motivatedlearnerswith children. Helpingchildrenbecome intellectual, physicalandcreativeskillsin students withskillstohelpfoster focusing onlearningdevelopment.Provides An introductiontoparentingskillsseries Development (1) Child &FamilyStudiesII:Learning HFL 142(Sp) meet college-levelexpectations. dents participatinginthiscourseshould limits, andproblemsolvingtechniques.Stu- positively communicatingexpectationsand learning thelanguagetobuildself-esteem, what behaviorstoexpectatvariousages, tion andguidancetechniques.Understanding skills, valuesandgoalsthroughcommunica- with emphasisonthedevelopmentofsocial An introductiontoparentingskillsseries Child Development(1) Child &FamilyStudiesII: HFL 141(W) level expectations. pating inthiscourseshouldmeetcollege- ment forfamilymembers.Studentspartici- ally andphysicallyhealthyhomeenviron- course willfocusonprovidinganemotion- safety needsandasenseofbelonging.The shelter, healthcare,personalandphysical survival needs,includingadequatenutrition, parenting resources.Topicsincludebasic Introduction toparentingskillsand Health SafetyandNutrition(1) Child &FamilyStudiesII: HFL 140(F) See descriptiononpage100. (previously HFL135) Child Development(5) EDUC 135 study skills. emphasize academicsuccessandeffective college resources.Thecoursewillalso American culture,thelocalcommunity,and international/immigrant studentsunderstand section ofHD101isdesignedtohelp to meetspecificprogramneeds.Onespecial development ofthemoderncollegestudent. other issuesthatareimportanttothe students willexploreculturaldiversityand available. Inagroup-buildingenvironment, campus resourcesandsupportservices goals ofhighereducationandthemany taking skills.Studentswilldiscoverthe developing study,note-takingandtest- for asuccessfulcollegeexperienceby This courseisdesignedtopreparestudents Student SuccessSeminar(2) HD 101(F,W,Sp) MATH 88(4credits)classisrequired. Prerequisite: Concurrentregistrationinthelinked and mathassertiveness. understanding problemsolvingtechniques learn math.Anemphasisisplacedon anxiety managementtoolsandstrategiesto attitudes canactuallyhelpustolearn math anxietyandanappreciationofourown Increasing ourawarenessofwhywehave Managing MathAnxiety(1) HD 98(F,Sp) Development Human (multicultural content) positive relationshipswithothers. expression, withthegoalofpromoting awareness, self-esteem,andself- facilitate learningandgrowthinself- Primarily anexperientialcourse,designedto through interpersonalcommunication. Introductory courseinpersonalgrowth Human Relations(3) HD 110(F,W,Sp) search skillsareincluded. assessment, careerdecision-making,andjob Vocational testing,careerresearch,self- to theirinterests,abilitiesandlifestyles. and establishtheirindividualgoalsasrelated career. Opportunitiesforstudentstoexplore Provides studentswithhelpselectinga Career andLifePlanning(3) HD 105(F,W,Sp,Su) Other sectionsareoccasionallydesigned Course Descriptions 115 HSP 191, 192, 193 (F, W, Sp, Su) Supervised Clinical Practicum I, II, III (4, 5, 5) These practicum courses provide the student with supervised experience in the Human Services field. Students develop a learning contract with specific objectives to guide their progress in the workplace. A weekly seminar is also required to receive supervision and assessment of their progress. Prerequisite for HSP 191: HSP 100, 103, 105, completion of HSP 191 learning contract, and Program Coordinator/Instructor permission. Prerequisite for HSP 192: successful completion of HSP 191 and completion of HSP 192 learning contract. Prerequisite for HSP 193: successful completion of HSP 192 and completion of HSP 193 learning contract. HSP 200 (F, W, Sp) Pharmacology and Survey of Chemical Dependency (5) Introduction to the physiological, psychological, and socio-cultural aspects of alcohol and drug related problems. The course also provides an overview of the pharmacology of alcohol and other psychoactive drugs including an explanation of how brain chemistry changes result in compulsive use. The impact of historical developments such as the "war on drugs" will also be discussed. HSP 112 (F, W, Sp) (F, W, HSP 112 (5) and Services Management Case fundamental roles and Examines the case management in a variety functions of Will explore methods of of systems. and data, documentation, acquiring client adult ASAM criteria for file management. assessment and treatment and adolescent planning will also be covered. and complete Prerequisites: ENGL 101 ready program admission. HSP 170-179 and/or Special Topic Seminars Workshops (1 - 2) designed to provide Seminars or workshops members of the HSP students and interested information and/or community with specific skills. Topic and development of specific skills to be determined by expressed need of students in HSP program, former HSP students, faculty and/or people working in the community in the human services field. Prerequisites: HSP 103 Prerequisite: HSP 100 and HSP 103. HSP 106 Advanced Helping Strategies (5) This course explores the role of group, family, and treatment systems. Course will present strategies for helping in these areas and examine relevant issues in the Human Service field. Principles, concepts and processes related to counseling are presented. Role and function of the helping person is examined. Counseling skills are demonstrated and practiced in class. Prerequisite: HSP 100. HSP 105 (F, W, Sp) Leadership, Ethics, and Development (5) Students will examine personal belief systems, ethical dimensions, and laws in the human service field. Uses critical thinking skills to explore central work-related issues and for developing leadership skills while preparing for entry into the field training portion of the human service program. The course prepares students for Human Services, internships, and careers. Overview of the history, philosophy and Overview of the history, human service present status of the major delivery systems. Examines the roles of practitioners as well as occupational and educational alternatives for graduates. Also explores services provided by local human service agencies. Prerequisite: ENGL 101 ready and complete program admission. HSP 103 (F, W, Sp) Therapeutic Approaches and Techniques (5) HD 299 Study (1 - 5) Independent observation, analysis and Independent a selected problem in career reporting of and life planning. chairperson. Prerequisite: Permission of department Human Services HSP 100 (F, W, Sp) Services (5) Introduction to Human educational and everyday environment of environment and everyday educational be examined. needs will with special people content) (multicultural The course presents an overview of both existing and emerging assistive technolo- gies that may be adapted to the unique needs of persons with physical, sensory and cognitive disabilities. The interaction between assistive technologies and the HD 250 Assistive Technology in Education and Life (3) Special Topic Seminars and/or Workshops (1 - 2) Seminars or workshops designed to provide students and interested members of the community with specific information and/or development of specific skills. Topics and skills are based on the needs of the campus community (examples are: diversity, differ- ence, dialogue, community empowerment). Prerequisite: Instructor permission. HD 170 - 179 Access Technology (1 - 5) This class is tailored to individual student needs and is offered as an independent study. Students explore topics related to disability and working with adaptive equip- ment and technology. The class is offered on a credit/no credit basis. HD 150 (F, W, Sp) Students will increase their self-awareness and learn skills in decision making and handling the process of transition. Adult development and the impact of societal and family values will also be explored. HD 116 (Sp) Life Choices (3) This course helps students discover and This course helps students Students develop their individual potential. how to set explore who they are and own terms. We meaningful goals in their our individual identify ways to unlock to establish an potential and learn how action plan for positive change. HD 114 (3) Exploring Human Potential Increasing assertiveness in everyday ac- in everyday Increasing assertiveness oneself honestly without tions, expressing own and exercising one's undue anxiety, others. denying the rights of rights without is placed on the unique- Special emphasis self- individual and enhancing ness of each esteem. (multicultural content) HD 112 (F, W, Sp) HD 112 (3) Skills Assertive 116 Course Descriptions will presentinformationnecessaryto that confrontthecasemanager.This course the uniquedifiiculties,concerns,and issues populations. Studentswillbeintroduced to of casemanagementwithspecialneeds Examines theuniqueproblemsandconcerns Advanced CaseManagement(5) HSP 212 propriate levelsofcarefortheagingclient. dents willlearntoassessandaccessap- network arepresentedanddiscussed.Stu- Housing, healthcare,andsupportservices sues ofagingandrelatedsocialservices. This courseexaminesthedevelopmentalis- Aging &AdultServices(5) HSP 209(Sp) development, andprojectdevelopment. areas includegrantwriting,proposal service programsandprojects.Subject acquire fundingforavarietyofhuman Students willlearnhowtodevelopand Grant Writing(5) Program Planningand HSP 208 HSP 207butnotforboth. degree willbegrantedforeitherPSYCH207or Note: SamecourseasPSYCH207;creditfor covered includingbriefriskintervention. counselor andCDPregistrationwillalsobe stress. HIV/AIDSinformationrequiredfor technique andcopingstrategiestoreduce learning approachisusedtolearnrelaxation for wellnessandselfcare.Alifelong This courseexplorestheoriesandstrategies Behavioral HealthandWellness(5) HSP 207(F,W,Sp,Su) of preventionevaluation. analysis oftheroleandpracticalapplication prevention. Thecoursewillalsoincludean research theoryandpracticalapplicationsof ist". Thecoursecontentincludesanalysisof for certificationasa"PreventionSpecial- This coursemeetspartoftherequirements Advanced PreventionStrategies(5) HSP 206 gram modelsandevaluationmethodology. vention planning,theroleofmedia,pro- view ofprevention,currentresearch,pre- ist". Thecoursecontentincludesanover- for certificationasa"PreventionSpecial- This coursemeetspartoftherequiremetns Substance AbusePrevention(5) HSP 205 may arise. plans andtohandlecrisissituationsthat develop andimplementeffectiveservice ideas andbeliefswiththeirexpressions. 1400. Thecoursewillfocusonconnecting architecture fromtheancientworldto drama, music,painting,sculpture,and the studyofsixmajorartforms:literature, An introductiontothehumanitiesthrough Intro toHumanities:Ancient1400 HUMAN 101(varies) these samearts. community performance/demonstrationsof with terminologyoftheartsand community. Studentswillbecomefamiliar on-location fieldtripstositesinthe enhanced byattendingperformancesand drama, film,musicanddance-willbe arts -painting,sculpture,architecture, offered bylocalcommunities.Studyofthe investigation ofcurrentculturalevents An introductiontothehumanitiesthrough Intro toHumanities(5) HUMAN 100(varies) prerequisite toanother. Note: ThesecoursesareNOTsequential.Norisone Humanities program admission. Prerequisites: ENGL101readyandcomplete dividers ofpeople. gender issueswillbeexaminedaspotential lifestyles, religion,disabilities,age,and creates thedifference.Culture,ethnicity, people whoare"different,"despitewhat that willleadtoabetterunderstandingof expose learnerstoavarietyofculturalideas differences withinsociety.Thiscoursewill Online willexaminetheelementsthatcreate This onlinecoursethroughWashington Understanding Diversity(5) HSP 261 Prerequisites: HSP112orinstructorpermission. with theirexpressions. will focusonconnectingideasandbeliefs architecture from1400to1800.The course drama, music,painting,sculpture,and the studyofsixmajorartforms:literature, An introductiontothehumanitiesthrough Intro toHumanities:1400-1800 HUMAN 102(varies) (multicultural content) American, HispanicandNative-Americans. specifically, African-American,Asian- and musicbyAmericanethniccultures; contribution toAmericanart,theater,dance An introductiontothespecialandunique Experience (5) The AmericanMulticulturalArts HUMAN 120(varies) (multicultural content) arts, politics,economy,andsociety. emphasizing history,language,literature, Korea, MexicoorCentralAmerica) culture (SoutheastAsia,China,Japan, A generalintroductiontoaPacificRim Pacific RimCultures(5) Introduction to HUMAN 110(Sp) ideas andbeliefswiththeirexpressions. present. Thecoursewillfocusonconnecting sculpture, andarchitecturefrom1800tothe literature, drama,music,film,painting, the studyofsevenmajorartforms: An introductiontothehumanitiesthrough Intro toHumanities:1800-Present HUMAN 103(varies) American history. cultures hadinshapingthecourseof cutures, aswelltheimpactthatthese unique historiesofseveralspecificNative class discussions,studentswillexplorethe States. Throughreadings,lectures,and Native AmericanculturesintheUnited This coursewillexaminethehistoryof (Revolving Topics)(5) Theme orTopicinHumanities HUMAN 260(varies) (multicultural content) an emphasisoninternationalfilm. development ofcinemaasanartformwith Study inmotionpicturetechniquesandthe Introduction toInternationalFilm(5) HUMAN 131(varies) and English. Prerequisite: Assessmentatcollege-levelreading (multicultural content) development ofcinemaasanartform. Study inmotionpicturetechniquesandthe Introduction toFilm(5) HUMAN 130(varies) Course Descriptions 117 Visual Basic (5) Building on the concepts learned in IT 201, Introduction to Programming, students will develop more advanced Visual Basic Programs. Emphasis will be on advanced controls, file access, data validation, the use of arrays, and error handling. Prerequisite: IT 201 with a grade of "C" or higher or instructor permission. Prerequisite: IT 110 with a grade of "C" or higher. IT 222 (W) Desktop Publishing Principles and Practice (5) Students learn principles of typography and publication design using PageMaker software to create publications for print and online distribution. This is the same class as JOUR 222. Students may take JOUR 222 or IT 222 but not both. Prerequisite: CU 100 or equivalent experience with personal computers. IT 235 (F, W, Sp, Su) Introduction to Information Technology (5) Introduction to the business use of computers. Covers theory, terminology, and business application of computer systems. Students learn how to use a word processor, spreadsheet, presentation and database software. Includes modules on the use of personal computers, Internet essentials and Windows. IT 238 (F) IT 205 (F) IT 205 Multimedia to Introduction Graphics (5) design to basic publication An introduction will become familiar principles. Students Illustrator and Photoshop with PageMaker, use the software with software. They input cameras, and other scanners, digital projects devices to create personal and type into incorporating digital images communicate simple publications that Microsoft effectively. Familiarity with class is the same Windows is assumed. This may take JOUR 205 as JOUR 205. Students or IT 205, but not both. IT 210 (W, Su) (5) Operating Systems II skills learned in This course extends the IT 110 to more advanced desktop operating systems. Microsoft Windows NT Workstation, Microsoft Windows 2000 Professional, and Linux are installed, configured and maintained. Using the skills gained in IT 102, this course extends those skills to various mo- bile computing platforms. Notebook, laptop, and handheld computers and infor- mation devices are studied. System require- ments of mobile users and the hardware and software available to meet those re- quirements are identified. Networking of these devices from remote locations is a major element of the course. Prerequisite: IT 102 with a grade of "C" or higher. IT 201 (W, Sp, Su) Introduction to Programming (5) An introduction to programming and programming concepts. Students will analyze various types of problems, use flowcharting and pseudocode as preliminary design tools, and then will design, code, test, and debug programs using the Visual Basic programming language. Prerequisite: IT 235 with a grade of "B" or higher or instructor permission. IT 202 Mobile Computing Fundamentals (5) IT 122 (Sp) Advanced Web Graphics (3) This is the third course in a series of three courses which focuses on Web Graphics software and its applications. The course content will reflect current web graphic trends. This is the same class as ART 122. Students may take either ART 122 or IT 122, but not both. Prerequisite: IT 120 or ART 120. IT 121 (Sp) (5) Flash: Intermediate class on web This is an intermediate interactive animation that focuses on use web animation design. The student will to organize tools while learning how systems information and create navigational through that help the viewer navigate class as ART 121. content. This is the same 121 or IT 121, but Students may take ART not both. 120 or instructor Prerequisite: ART 120 or IT permission. from historical to current periods, including current periods, to from historical is This software. computer animation use of may as ART 120. Students the same class or IT 120, but not both. take ART 120 IT 120 (W) Introduction to Animation (5) An introductory course for traditional and computer animation history and techniques. Students will learn key points in history of American animation, animation techniques Prerequisite: IT 235 with a grade of "B" or higher and instructor permission. (formerly IT 250, Operating Systems) The student is introduced to operating systems used on desktop microcomputers. The course covers installation and configuration, memory and storage management, batch and script files, device drivers, troubleshooting and maintenance tools, and virus protection. Emphasis is on current operating systems in the Windows family. The objectives of the course are based on those of the A+ Operating System (OS) Technologies Certification Exam. Students are encouraged to sit for the exam upon completion of the class. IT 110 (F, W, Sp, Su) Operating Systems I (5) Prerequisite: IT 235 with a grade of "B" or higher and instructor permission. Microcomputer Fundamentals (5) Microcomputer Fundamentals and hands- This course provides concepts and on experience in understanding microcomputer. supporting a PC-compatible Topics include microprocessors, system architecture, system boards, expansion cards, memory, input/output devices, and peripherals. The student learns how to build, configure, and troubleshoot a personal computer, its operating system, and an application. The objectives of the course are based on those of the A+ Hardware Core Certification Exam. Students are encouraged to sit for the exam upon completion of the class. IT 102 (F, W, Sp, Su) Prerequisite: ENGL 101. Information Technology An in-depth study covering history, An in-depth and art, architecture philosophy, religion, A a culturally significant city. literature of studied time, and place will be different city, Humanities 285 is offered. each quarter (multicultural content) May be repeated. HUMAN 285 (varies) HUMAN (5) The City 118 Course Descriptions or CU105110. Prerequisite: IT235withagradeof"B"or higher, with amicrocomputerDBMSapplication. demonstration, andhandsonexperience input forms,andreports.Includesanalysis, designing adatabase,structuredqueries, Covers basicdatabaseconceptsincluding Database Systems(5) IT 244(F,W,Sp,Su) instructor permission. Prerequisite: IT242witha"B"orhigher with analyzingaprogramsefficiency. schemes oflargeamountsdata,along will alsousevarioussorting/searching basics ofvariousdatastructures.Students complex problemsolving,andunderstandthe design, userecursionindealingwith various typesofabstractiontoprogram series. Studentswillbeabletoimplement This isthesecondcourseinITJava Advanced Java(5) IT 243(W) or instructorpermission. Prerequisite: IT201withagradeof"C"orhigher design willbestressed. debugging techniques.Object-oriented types, andwillidentifyapplybasic nested structuresandarraysofbasicdata Java. Studentswilluseloops,selections, Introduction tothesyntaxandsemanticsof Java Programming(5) IT 242(F,W,Su) or instructorpermission. Prerequisite: IT240withagradeof"C"orhigher Active-X controls. include MicrosoftFoundationClassesand Visual conceptsofC++.Othertopics Advanced C++(5) IT 241(Sp) Prerequisite: IT201withagradeof"C"orhigher. object-oriented programs. "C++". StudentsuseC++tocreate Introduction tothestructureanduseof C++ (5) IT 240(F,W) of "C"orhigherinstructorpermission. Prerequisite: IT238and244bothwithagrade server environment. and theuseofVisualBasicinaclient- access, classmodules,active-xcontrols, development withemphasisondatabase Advanced VisualBasicapplication Advanced VisualBasic(5) IT 239(W) security issues. also ondatabaseadministrationand server-based DBMSarestressed.Focuses Systems. Datamodelingandtheuseofa Builds ontheconceptslearnedinDatabase Advanced DatabaseSystems(5) IT 245(Sp) Advanced WebDevelopment(5) IT 255(W) or instructorpermission. Prerequisite: IT201withagradeof"C"orhigher web pageswillalsobediscussed. composition andtheuseofmultimediain and anintroductiontoscripting.Webpage development usingHTML,dynamic An introductiontoclient-sidewebpage Web Development(5) IT 254(F) or instructorpermission. Prerequisite: IT235withagradeof"B"orhigher software willbepresented. focus ofthisclass.Avarietymultimedia their incorporationintowebsitesarethe Development ofmultimediaapplicationsand Web GraphicsApplications(5) IT 251(F,Sp) 105. grade of"B"orhigher,BUS164,ENG100/101/ Prerequisite: BUS101orACCT140,IT235witha are stressed. solving andworkinginateamenvironment project management.Creativeproblem techniques, processanddatamodeling, problem solving,informationgathering depth. Topicsincludeproblemidentification, Examines thesystem-developmentcyclein and Design) (formerly ComputerInformationSystemsSelection System AnalysisandDesign(5) IT 247(F,W,Sp,Su) Prerequisite: IT244withagradeof"C"orhigher. or instructorpermission. Prerequisite: IT254withagradeof"C"orhigher data sources. incorporates graphicsandaccessesstatic an advancedwebapplicationthat and server-sidescripting.Studentswillbuild Advanced webdevelopmentincludingclient Network the Network+andretiredMicrosoft objectives arebasedontheof internetworking, andLANservices.Course protocol stacksespeciallyTCP/IP,simple Communication Model,transmissionmedia, environments. TopicsincludetheOSI computer systemstocommunicateinlocal protocols usedtoallownetworked includes traininginthemethodsand Area Network(LAN)environment.It concepts ofdatacommunicationinaLocal This courseintroducesthestudentto Distributed Processing) (formerly IT253,DataCommunicationand Client/Server TechnologyI-LANs(5) IT 260(F,Sp) of "C"orhigherinstructorpermission. Prerequisite: IT255and244bothwithagrade are theprimaryconceptsofcourse. technology andrelationaldatabaseaccess updating serverdata.Active-serverpage page developmentincludingaccessingand Students willdevelopadvancedskillsinweb Server DataAccess(5) IT 257(Sp) of "C"orhigher,BUS164. Prerequisite: IT102and110bothwithagrade platform forthiscourse. Windows 2000Serverisusedasthe environments arestudied.Microsoft expandable localareanetwork implementing, andmaintainingasecure, Methods andtoolsfordesigning, configuration offileandprintservices. networks (LANs).Thestudentfocuseson applied courseintheconceptsoflocalarea administration techniques.Thisisan and toadetailedstudyofnetwork The studentisintroducedtonetworking (formerly namedNetworkAdministration) Windows Networks(5) Administration of IT 261(F,Sp) Prerequisite: IT235withagradeof"B"orhigher. Essentials certificationexams. Course Descriptions 119 Prerequisite: JAPAN 111 with a grade of "C" or higher for JAPAN 112; JAPAN 112 with a "C" or higher for JAPAN 113; or equivalents. Prerequisite: Program Chair permission. IT 291 Employability Skills for the IT Industry (1) This course is taken in the second year of the program. Stresses job search and interviewing skills, job retention, the need for continuing education, and IT certifi- cations. Industry representatives will share valuable insights. Prerequisite: Program Chair permission. Japanese Foreign language challenge credit will not be awarded for native languages. JAPAN 111, 112, 113 (F) (W) (Sp) Elementary Japanese (5, 5, 5) Elementary sequential course that enables students to learn Japanese characters (Kanji) grammar and sentence structure. The correct pronunciation of Japanese will be equally emphasized with lab work. (JAPAN 113 multicultural content) IT 279 (W) IT 279 Hardware Network Advanced (5) Technologies AAS - course for the This is the capstone It Support track. Network Hardware concepts for understanding focuses on the today's and future and supporting and internetworking devices. networking of vendors, Topics include a comparison LAN/WAN configuration of a simulated project, new near- and far-term education. technologies, and life-long resources Students will access online technologies, needed to discuss emerging issues in a products, and management in writing. seminar environment and grade of "C" or higher, Prerequisite: IT 271 with a SPCH 100, ENGL 105. IT 290 Work Internship (5) During one quarter of the sophomore year, students can receive college credits for hands-on computer related work experience and training in a private or public sector organization. The skills learned in IT 270 are extended to networking hardware. Equipment, such as client computers, servers, bridges, hubs, switches, routers, and DSU/CSU units, are installed and configured. While the course is not specific to one vendor, many objectives parallel those of the Cisco Certified Network Associate (CCNA) Certification. Prerequisite: IT 270 with a grade of "C" or higher. Prerequisite: IT 260 and IT 261 both with a grade of "C" or higher, ENGL 105. IT 271 (F) Network Hardware Service and Support (5) Prerequisite: IT 262 and IT 267 both with a grade Prerequisite: IT 262 and IT of "C" or higher, SPCH 100, ENGL 105. IT 270 (Sp) Service and Support Fundamentals (5) (formerly IT 263, Network Fault Isolation Techniques) This course is an introduction to the metho- dologies and tools for personal computer and Local Area Network (LAN) trouble- shooting from a proactive viewpoint. The student studies the methods to identify and repair the most likely causes of network faults caused by user, hardware, and soft- ware problems. Disaster Plans, including a Backup Plan, are developed. Quality cus- tomer service, journaling and documen- tation are emphasized. Configuration man- agement and patch/service release installa- tion is learned. Server performance moni- toring is discussed. (formerly IT 264, Advanced Network Services) (formerly IT 264, - course for the AAS This is the capstone It degree track. Network Administrator concepts for understanding focuses on the today's and future Network and supporting Topics include a Operating Systems (NOSs). systems comparison of network operating the configuration including UNIX and Linux, and management of Novell/Microsoft/UNIX network hybrid networks, advanced Students will services, and life-long learning. needed to discuss access online resources products, emerging network technologies, in a seminar and management issues environment and in writing. IT 269 (Su) IT 269 OS Networking Advanced (5) Technologies Prerequisite: IT 260 and IT 261 both with a grade of "C" or higher. This course introduces the student to the concepts of data communication within a Wide Area Network (WAN) environment. It includes training in the methods and protocols used to allow networked computer systems to communicate in relatively distant environments using technologies available through common carriers. Topics include a review of the OSI Communication Model, transmission media, available protocol stacks, carrier rate structures, connecting to the Internet, and internetworking hardware and services. IT 267 (Sp) Client/Server Technology II - WANs (5) Prerequisite: IT 260 and IT 261 both with a grade of "C" or higher. IT 265 Administration of Novell Networks (5) The student focuses on configuration of file and print services in a Novell environment. Methods and tools for designing, implementing, and maintaining a secure, expandable local area network (LAN) environments using Novell products are studied. The comparison of network administration using products by Novell and Microsoft is an objective of the course. Prerequisite: IT 260 and IT 261 both with a grade Prerequisite: IT 260 and IT of "C" or higher. (formerly named Network Engineering) (formerly named in the installation, A practical course of maintenance, and support configuration, (LANs) using the Local Area Networks Operating Systems Windows Network the hardware and (NOSs). Students explore network cabling for a secure, expandable Windows 2000 environment. A Microsoft for secure Server is installed and configured application and efficient file, print and and functionality services. The architecture OS are studied. of the Windows 2000 Server and configured. Desktop clients are installed IT 262 (W) IT 262 of Windows Support Technical (5) Networks 120 Course Descriptions Prerequisite: JOUR101orinstructorpermission. as partofthecampusnewspaperteam. ment skills,andpracticingnewsdecisions deadlines, improvingwritingandnews judg- ing storiesorphotoassignments,meeting for credit.Coversdevelopingandcomplet- chance toproducethecampusnewspaper perience approvedbytheinstructorgeta taken Journalism101orhavehadotherex- (6 creditsmaximum)Studentswhohave Newspaper Workshop(2) JOUR 150(F,W,Sp) Prerequisite: ENGL101 (writing intensive) cover writingforthefreelancemarket. specialty publications,thiscoursealsowill newspaper, communitynewspapersor to TheChallenge,TCC'sstudent journalists whowishtocontributearticles compelling fashion.Intendedfornovice gathering materials,andwritinginclear, with emphasisondevelopingstoryideas, explore thebasicsofnewsfeaturewriting, In thishands-oncourse,studentswill News FeatureWriting(3) JOUR 106(Su) use ofphotosinpublications. concept ofvisualliteracyandtheintelligent ethics ofphotojournalism.Exploresthe introduction tothehistory,principlesand Photojournalism fornon-photographers.An Introduction toPhotojournalism(3) JOUR 103(W) Word processingskillshelpful. Prerequisite: JOUR101orinstructorpermission. for concisenessandclarity. headline writing,copyeditingandrewriting grammar, newseditingusingAPstyle, This courseinvolvestraininginEnglish News Editing(3) JOUR 102(W) Prerequisite: ENGL101. newspaper. (writingintensive) publication inTheChallenge,TCC'sstudent write atleastfourstoriessuitablefor methods, ethicsandlibellaw.Students reporting andwritingskills,research journalism inAmericansociety,news writing. Topicsincludetheroleof An introductiontonewsreportingand Reporting (5) Introduction toNewsWritingand JOUR 101(F,Sp) Journalism their own35mmcameraequipment. newspaper, duringthequarter.Studentsuse each issueofTheChallenge,TCC'sstudent essay, andcontributeatleastonephototo picture assignmentsandonestoryor caption writing.Studentsdogradedsingle- meeting deadlines,pictureeditingand Training innewsphotographytechniques, Advanced Photojournalism(5) JOUR 203(Sp) 222, butnotboth. IT 222.StudentsmaytakeJOUR222or online distribution.Thisisthesameclassas software tocreatepublicationsforprintand publication designusingPageMaker Students learnprinciplesoftypographyand Practice (5) Desktop Publishing:Principlesand JOUR 222 (reading andwritingintensive) speakers areanintegralpartofthiscourse. play inourlives.Tours,films,andguest radio andnewspapers,therolethey Survey ofmassmedia,includingtelevision, Mass MediaandSociety(5) JOUR 209(W,Sp) IT 205,butnotboth. as IT205.StudentsmaytakeJOUR205or Windows isassumed.Thisclassthesame effectively. FamiliaritywithMicrosoft simple publicationsthatcommunicate incorporating digitalimagesandtypeinto devices tocreatepersonalprojects scanners, digitalcameras,andotherinput software. Theyusethesoftwarewith with PageMaker,IllustratorandPhotoshop principles. Studentswillbecomefamiliar An introductiontobasicpublicationdesign Graphics (5) Introduction toMultimedia JOUR 205 permission. Prerequisite: ART146orportfolioandInstructor or ascholarlyresearchpaper. Final productmaybeeithernewsreportage reporting onselectedtopicsorproblems. Independent observation,analysisand Independent Study(1-5) JOUR 299(F,W,Sp) research projectinanotherclass. who havefirst-timeresponsibilitiesfora emphasized. Recommendedforstudents resources andpropercitationwillbe including theInternet.Evaluationof using abroadrangeofresearchtools, needs bydevelopingresearchstrategiesand Learn tomeetcourse-relatedinformation Research Methods(2) LS 102(varies) quality information. Internet togatherandproperlycitehigh collection, magazinedatabasesandthe features ofthelibrarycatalog,reference choose aresearchtopicandusethebasic library's electronicresources.Learnhowto basic computerskillsneededtousethe Tame yourfearoflibraries!Acquirethe Basic Research(1) LS 101 Science Library typically taughtonlineviatheInternet. information willbeexplored,Thiscourseis issues suchascensorshipandfreedomof information resources.Informationpolicy locating, evaluating,andapplying students willexaminevariousstrategiesfor Through aquarter-longresearchproject, Build skillsforsuccessfullifelonglearning. Learning inthe21stCentury(5) LS 105 college-level researchproject. completed LS101and/oratleastone for studentswhohavesuccessfully databases andtheInternet.Recommended library catalogs,periodicalsandother evaluate andproperlycitematerialsfrom ability toefficientlylocate,critically production anddissemination.Improveyour Learn aboutthenatureofinformation Research Problems(1) LS 103(varies) Prerequisite: Instructorpermission. permits. health sciencefocusmaybeadmittedasspace TCC nursingprogram;otherswillingtoworkwitha NOTE: SectionslabeledNURareforstudentsinthe Course Descriptions 121 Algebraic operations and concepts, solving equations and inequalities including quadratic equations, algebraic fractions, exponents, roots and radicals, graphing of linear and quadratic functions, and introduction to logarithms. Scientific calculator required, TI-30xIIs recommended. Prerequisite: READ 92 and MATH 90 or assessment above MATH 90. MATH 90 (F, W, Sp, Su) Elementary Algebra (5) Topics include linear equations, polynomials, factoring, rational expressions, graphing, and systems of equations. Scientific calculator required, TI-30xIIs recommended. Prerequisite: READ 92 and MATH 88 or assessment above MATH 88. MATH 97 (F, W, Sp) Intermediate Algebra for the Liberal Arts (5) An alternative to MATH 99 for students going on to MATH 107 or MATH 108. Topics include linear, quadratic and exponential functions, systems of equations, radical expressions, scientific notation, variation and quadratic equations. Applications from the real world will be used with the above concepts. Scientific calculator required, TI-30xIIs recommended. Prerequisite: READ 92 and MATH 90 or assessment above MATH 90. MATH 99 (F, W, Sp, Su) Intermediate Algebra (5) MATH 86 (F, W, Sp, Su) 86 (F, W, MATH (5) Arithmetic Review mathematics including Review of basic whole numbers, fractions, arithmetic of ratios, proportions decimals, percentages, 4-function basic and plane geometry. calculator required. 92 and assessment above Prerequisite: READ MATH 80. MATH 88 (F, W, Sp, Su) Algebra Introduction to Elementary (4) designed for Beginning algebra specifically background. students with no algebra to variables; Topics include: introduction to linear signed numbers; solutions work with equations and inequalities; evaluation and positive integer exponents; manipulation of formulas; and emphasis on word problems. Scientific calculator required, TI-30xIIs recommended. Prerequisite: READ 92 and MATH 86 or assessment above MATH 86. A calculator is required in all math MATH 80 Fundamentals of Arithmetic (5) Comprehensive instruction in basic arithmetic including whole numbers, fractions, decimals, ratio, proportion and percentages. Prerequisite: College math assessment score below 25 and assessed into READ 92 or completed ABE reading. Prerequisite: A student has met a prerequisite if he or she has completed the required course earning a grade of "C-" or higher within the last two years. Mathematics math course their first enrolling in Before must take a mathematics at TCC, students a unless they have taken placement test the mathematics class within college-level TCC offers both college last two years. pre-college level courses. transfer and are available Most pre-college level classes classroom lecture/ in either of two modes: tutorial. discussion or independent an Associate in Students planning to earn will need to com- Arts and Sciences degree course from the plete a quantitative skills catalog under list shown earlier in this Students consid- Degrees and Graduation. engineering, ering a major in mathematics, will normally science or computer science 124, 125, 126, complete MATH 115, 116, 220, 224, and 238. Business and economics majors should complete MATH 111 and 112. classes. Students should consult with a math instructor before purchasing a new calculator. The use of computer applica- tions, including spreadsheets, is included in MATH 108, 111, and 112. For these classes, CU 103 and CU 203 are recom- mended as prerequisites if a student does not have spreadsheet experience. For addi- tional information and resources access the department's website at http:// www.tacoma.ctc.edu/inst_dept/math/ start.shtm. For students who graduated within the past year from either Tacoma or Peninsula high schools, there is an alter- nate placement for mathematics based upon your recent high school math work. See Advising for details. Prerequisite: MR 210 or MR 220 or MR 230; Registered Radiologic Technologist (ARRT). MR Registry Review (1) A review of patient care and MRI safety, MR imaging procedures, data acquisition and processing and the physical principles related to MR image formation. Prerequisite: Registered Radiologic Tehnologist (ARRT). MR 240 (Sp) MR 230 (Sp) MR Image Acquisition and Processing (3) An indepth knowledge of MR data acquisi- tion and procesing. The interrelationship of MR imaging pulse sequences and data ac- quisition and processing is explored. MR special procedures, such as MR angiogra- phy, are also discussed along with 2-D and 3-D imaging. Prerequisite: Registered Radiologic Technologist (ARRT). This class provides information concerning MR imaging protocols for the central nervous system, neck, thorax, abdomen, pelvis, and musculoskeletal system. These include procedure indications, patient education, preparation, orientation and positioning, patient history and assessment, MR contrast media usage, MR scan parameters, and filming and archiving of the images. MR 220 (W) MR Imaging Procedures (3) Prerequisite: Registered Radiologic Technologist Prerequisite: Registered Radiologic (ARRT). The principles of MR imaging will be The principles of MR imaging on magnetic fields discussed with emphasis gradient magnetic (i.e. main magnetic field, the fields), hydrogen atom precession, waves Larmor equation, radio frequency antennas, and and RF pulses, transmitting imaging planes (X-Y-Z gradients). such as Additionally, imaging parameters be presented. TR, T1, T2 and T2* will MR 210 (W) of MR Image Formation Principles (3) (MR Physics) Magnetic Resonance Imaging 122 Course Descriptions 203, previouslyorconcurrently. graphing (Excelrecommended);orCU103 knowledge ofanadvancedspreadsheetincluding Prerequisite: READ93andMATH111 TI-83 highlyrecommended. under curves.Graphingcalculatorrequired; maxima andminima,theintegralarea include thederivative,ratesofchange, quarter surveycourseincalculus.)Topics sciences andotherfieldsrequiringaone- (For studentsinbusiness,economics,social Elements ofCalculus(5) MATH 112(W,Sp,Su) 203, previouslyorconcurrently. graphing (Excelrecommended)orCU103 knowledge ofanadvancedspreadsheetincluding Prerequisite: READ93andMATH99 required; TI-83highlyrecommended. value ofmoney.Graphingcalculator functions, linearregression,andthetime methods, exponentialandlogarithmic linear programmingbygraphingandsimplex costs, matrixalgebra,systemsofequations, rational functions,marginalrevenueand Topics include:polynomials,inequalities, Pre-calculus courseforbusinessmajors. Economics (5) College AlgebraforBusinessand MATH 111(F,W,Sp) or assessmentaboveMATH99. Prerequisite: READ93andMATH97or99 Graphing calculatorrequired. testing, andlinearregression.TI-83 data, inferentialstatistics,hypothesis dispersion, graphingandorganizationof distribution ofevents,samplespaces, central tendency,frequencyand Topics includedescriptivestatisticsof Introduction toStatistics(5) MATH 108(F,W,Sp,Su) or assessmentaboveMATH99. Prerequisite: READ93andMATH97or99 interdisciplinary frameworkwillbestressed. modern society.Problemsolvingwithinan applications toproblemsencounteredin quantitative skillswillbeusedinpractical fields. Mathematicaltheorycombinedwith science, statistics,socialchoiceandother the useofmathematicsinmanagement A generaleducationcoursedemonstrating Math: APracticalArt(5) MATH 107(F,W,Sp,Su) TI-86 highlyrecommended. this course.Graphingcalculator ing andwritingareanimportantpartof assumed asaprerequisite.Technicalread- average symbolicmanipulationskillsare view towardthestudyofcalculus.Above finding andapplicationsoffunctionswitha absolute valueandrationalfunctions,root translation andcompositionoffunctions, and inversefunctions.Alsoincludedare values, especiallylogarithm,exponential words, equations,graphs,andtablesof An emphasisonfunctionsexpressedin Pre-Calculus I:CollegeAlgebra(5) MATH 115(F,W,Sp,Su) MATH 126(Sp,F) MATH 125(W,Sp,Su) MATH 124(F,W,Sp) Prerequisite: READ93andMATH99. Internet. Graphingcalculatorrequired. This courseistypicallytaughtonlineviathe money includingamortizationandannuities. logarithmic functionsandthetimevalueof probability andstatistics,exponential countered inmodernsociety.Topicsinclude: application ofthetopicstoproblemsen- cific mathematicsrequirement.Emphasizes students inprogramsthatdonothavespe- A generaleducationcollegemathcoursefor Math forNon-ScienceMajors(5) MATH 117(F,W,Sp) Prerequisite: READ93andMATH115. TI-86 highlyrecommended. ordinates. Graphingcalculatorrequired; triangles, complexnumbersandpolarco- metric functionsalongwithsolutionsof identities, equationsandinversetrigono- clude trigonometricfunctions,graphs, A continuationofPre-calculusI.Topicsin- Pre-Calculus II:Trigonometry(5) MATH 116(F,W,Sp,Su) assessment aboveMATH99. Prerequisite: READ93andMATH99or tiation includingderivativesofexponential 124 includeslimits;introductiontodifferen- in learningtothinkmathematically. MATH tors areusedastoolstoassistthestudent tensively. Computersandgraphingcalcula- Students shouldexpecttoreadand write ex- There isanemphasisonwritingtolearn. problem-solving andunderstandingconcepts. merically, andalgebraically.Emphasisison of calculusarepresentedgeometrically,nu- (Courses mustbetakensequentially)Topics Calculus I,II,III(5,5,5) required; highly recommended. tors. Graphingcalculatorrequired;TI-86 tions, infiniteseries,conicsectionsandvec- from polarcoordinates,parametricequa- proper integrals;MATH126includestopics tion andmethodsofintegrationincludingim- from applicationsofintegration,differentia- the derivative.MATH125includestopics and logarithmicfunctions;applicationsof MATH 224(Sp) Prerequisite: READ93andMATH126. recommended. calculator required;TI-86highly eigenvectors andapplications.Graphing vector spaces,lineartransformations, matrices, determinants,vectors,abstract Topics includelinearsystemsofequations, Linear Algebra(5) MATH 220(F) and MATH125for126. 116 forMATH124,124125, Prerequisite: READ93andMATH115 specifically toHealthSciencefields. involving variousalgebraicconcepts applied variation; biostatistics;andapplications roots; unitconversions,scientificnotation, exponential, andlogarithmicfunctions; cover graphingandgraphanalysis;linear, respiratory therapyprograms.Topicswill emergency medical,nursing,radiology,and students, satisfyingtherequirementsfor An algebra-basedcourseforHealthScience Mathematics fortheHealthSciences TMATH 100 Technical Math: Prerequisite: READ93andMATH126. recommended. calculator required;TI-86highly Initial valueproblemsareincluded.Graphing approximations andLaplacetransforms. differential equationsincludingnumerical differential equationsandhigher-orderlinear non-linear andsystemsoffirst-order A courseteachingmethodsofsolvinglinear, Elements ofDifferentialEquations(5) MATH 238(W) Prerequisite: READ93andMATH126. TI-86 highlyrecommended. coordinates. Graphingcalculatorrequired; integration, cylindricalandspherical differentiation, gradients,multiple Functions ofseveralvariables,partial Multivariable Calculus(3) Course Descriptions 123 Prerequisite: Audition or instructor permission. Three quarters of MUS 160 for 260. Prerequisite: MUS 125 or instructor permission. MUS 130 (F, W, Sp) Private Vocal or Instrumental Instruction (1) Additional variable fee ($150-$200). Private instruction for credit. Students are expected to pay a variable fee to the private instructor over and above the cost of course credit. May be taken three times on same instrument. Prerequisite: Music Dept. Chair permission. MUS 150 (F, W, Sp) Special Topics in Music (5) Study of the important contributions of a selected music genre, time period or culture to the world's music. Sample topics: American Music, Scandinavian Music, History of Jazz, The Symphony, History of Rock and Roll, etc. May be repeated twice (different topics). MUS 160, 260 (F, W, Sp) Chamber Orchestra (2) Preparation and performance of chamber orchestral literature. This group plays four concerts annually on campus. MUS 123 (F, W, Sp) 123 (F, W, MUS (1) Guitar Applied Music: Class in performance. Class instruction Intermediate sections Beginning and quarter. offered each W, Sp) MUS 124 (F, Music: Piano I (1) Class Applied beginning piano Class instruction for the physical skills student. Development of on keyboard required for performance emphasis on instruments as well as an of basic reading music and an understanding music theory. MUS 125 (F, W, Sp) Piano II (1) Class Applied Music: piano; the Class instruction in beginning of three. second course in a series Prerequisite: MUS 124 or instructor permission. MUS 126 (F, W, Sp) Class Applied Music: Piano III (1) Class instruction in beginning piano; the third course in a series of three. MUS 112 (varies) Opera Literature (3) Opera through the ages from the Baroque era to 20th century. Focus on operas in the text. MUS 121 (F, W, Sp) Class Applied Music: Voice (1) Designed to help students who enjoy singing. Course covers vocal exercises, breathing techniques and how to apply these in specific songs. Introduction to Music (5) (For the general college student; recom- mended for education majors.) A non-techni- cal basis for enjoyable listening to music with understanding; illustrated lectures with supplementary reading and listening experi- ences to foster understanding of common mu- sical forms, idioms, periods and styles. MUS 108 (varies) Style Periods I: The Baroque-Bach and Handel (3) Aspects of the Baroque style in music history (1600-1750). Emphasis on composers from Italy, England, France and Germany. Prerequisite: MUS 102 or instructor permission. MUS 106 (F) World Music (5) Introduction to music of various cultures of the world. Music as an expression of human values, identity, and way of life. (multicultural content) MUS 107 (F, W, Sp) Prerequisite: MUS 101 or instructor permission. Prerequisite: MUS 101 or instructor MUS 103 (Sp) Music Theory III (5) of study of Continuation and completion analysis and diatonic harmony through development composition exercises. Further sight- of aural skills through ear-training, Supplemental singing and keyboard practice. modes and the topics dealing with diatonic smaller formal archetypes. MUS 102 (W) MUS (5) Theory II Music to the study of diatonic Introduction century of 18th and 19th harmony. Analysis composition exercises harmonic usage; voice-leading and chord stressing correct aural Further development of succession. and ear-training, sight-singing skills through keyboard practice. MUS 101 (F) Music Theory I (5) Recommended for all music majors and minors, but open to all students who have some music experience. Introduction to the materials of music, including notation, scales, intervals, diatonic triads, and rhythm. Includes development of elementary ear- training, sight-singing, and keyboard skills. MUS 100 (varies) Fundamentals of Music (5) For students with very limited, or no music background. An introductory class covering music notation, terminology, the keyboard, intervals and scales. Music See Health Information Technology, page 108. Medical Records Technology Prerequisite: Registered Radiologic Technologist (ARRT). MI 205 (F) Computerized Imaging (1) This class describes the advent of computers and the evolution of medical imaging since the inception of computerized imaging. General computer hardware is discussed as it relates to imaging. Fundamental components of all imaging systems will be introduced. Prerequisite: Second year RS student or registered Prerequisite: Second year RS radiologic technologist (ARRT). Basic introduction to cross-sectional Basic introduction brain, neck, anatomy. Anatomy of the and the thorax, abdomen/pelvis, is presented in the musculoskeletal system and oblique transverse, sagittal, coronal, images are imaging places. CT and MR X-ray images to correlated with conventional anatomy emphasize cross-sectional placed in perspectives. Emphasis is basic pathology. identifying anatomy and MI 200 (F) Anatomy and Cross-Sectional (3) Pathology Medical Imaging 124 Course Descriptions Prerequisite: AdmittancetotheNursingProgram. complete assessmentonclients. develop basicskillsrelatedtoobtaininga Learning experiencesaredesignedto an introductiontowellnessconcepts. wellness settingsinthecommunity.Includes for clientsofanyageinavariety Didactic coursepreparesstudentstocare Well Client-Theory(5) Nursing I:Caringforthe NURS 111 Degree Associate Nursing, Prerequisite: Instructorpermission. advanced musicstudents. Individual study,project-orientedfor Independent Study(1-5) MUS 299(F,W,Sp) instrument) andMusicDept.Chairpermission. Prerequisite: 3quartersofMUS130(same instrument. credit. Maybetakenthreetimesonsame instructor overandabovethecostofcourse to payavariablefeetheprivate instruction forcredit.Studentsareexpected Additional VariableFee($150-200).Private Instruction (1) Private VocalorInstrumental MUS 230(F,W,Sp) 180 for280. enrollment inMUS170/270,threequartersof Prerequisite: Instructorpermissionandconcurrent times eachquarter. group singsbothonandoffcampusseveral versatility andpolishedperformances,this selected byaudition.Knownfortheir A smallvocalensemblewhosemembersare TCC Voices(1-3) MUS 180,280(F,W,Sp) Prerequisite: ThreequartersofMUS170for270. experience helpfulbutnotessential. quarter. Opentoallsingers;previouschoral choral music.Oneconcerton-campuseach a broadvarietyofbothsacredandsecular Mixed choruswhichrehearsesandperforms TCC Singers(1-3) MUS 170,270(F,W,Sp) Well Client-Clinical(5) Nursing I:Caringforthe NURS 112 Wellness -Clinical(5) Client withMinorDeviationsfrom Nursing II:Caringforthe NURS 122 and NURS141. Prerequisite: NURS111,112,113 throughout. caring andcommunicationareintegrated sensitivity, pharmacology,healthteaching, growth anddevelopment,nutrition,cultural The principlesofthenursingprocess, and gastrointestinaldisordersarediscussed. of thesurgicalclient,clientwithorthopedic wellness. Conceptsrelatedtonursingcare episodic and/orminordeviationsfrom experiences withclientsofallages Didactic courseprovideslearning Wellness -Theory(5) Client withMinorDeviationsfrom Nursing II:Caringforthe NURS 121 Prerequisite: AdmittancetotheNursingProgram. measures. hand washing,vitalsigns,andbasichygiene include physicalassessment,interviewing, technical skills.Technicalskillstaught offs undersimulatedconditionsfornursing Consists ofsupervisedpracticeandcheck- Assessment (1) Nursing InterventionsI: NURS 113 NURS 111ifnottakingconcurrently. Prerequisite: AdmittancetotheNursingProgram; obtaining acompleteassessmentonclients. designed todevelopbasicskillsrelated wellness concepts.Learningexperiencesare community. Includesanintroductionto age inavarietyofwellnesssettingsthe Prepares studentstocareforclientsofany NURS 141;121(ortakenconcurrently). Prerequisite: NURS111,112, 113& throughout. caring andcommunicationareintegrated sensitivity, pharmacology,healthteaching, growth anddevelopment,nutrition,cultural The principlesofthenursingprocess, and gastrointestinaldisordersarediscussed. of thesurgicalclient,clientwithorthopedic wellness. Conceptsrelatedtonursingcare episodic and/orminordeviationsfrom experiences withclientsofallages Clinical courseprovideslearning conditions. ethnic concerns,andselectedmedical NANDA diagnosticcategories,culturaland history andphysicalassessmentbasedon calculations, fluidandelectrolytebalance, behaviors, preventionconcepts,dosage continuum; nursingprocess,caring discussed: roletransition,wellness-illness quarter. Thefollowingconceptsare entering theADNprogramatthird Articulation (bridge)courseforLPN's LPN -ADNArticulation(Bridge)(3) NURS 130 NURS 141orinstructorpermission. Prerequisite: NURS111,112,113, administration ofmedications. sterile technique,dressingchange, ambulatory andhospitalsettingssuchas: procedures commonlyencounteredin simulated conditionsfornursingskillsand Supervised practiceandcheckoffsunder Basic Skills(1) Nursing InterventionsII: NURS 123 and NURS142. Prerequisites: NURS121,122, 123, integratd throughout. teaching, caringandcommunication are cultural sensitivity,pharmacology,health principles ofthenursingprocess,nutrition, these clientswillbeexpanded.The care settings.Growthanddevelopmentof reproductive disorders,primarilyinacute with thechildbearingfamilyandclients Clinical courseprovideslearningexperiences Childbearing Family-Clinical(5) Nursing III:Caringforthe NURS 132 & NURS142. Prerequisites: NURS121,122,123, communication areintegratedthroughout. pharmacology, healthteaching,caringand process, nutrition,culturalsensitivity, expanded. Theprinciplesofthenursing development oftheseclientswillbe in acutecaresettings.Growthand clients withreproductivedisorders,primarily experiences withthechildbearingfamilyand Didactic courseprovideslearning Childbearing Family-Theory(5) Nursing III:Caringforthe NURS 131 Nursing Program. Prerequisite: LPNLicenseandacceptanceintothe Course Descriptions 125 Prerequisites: NURS 211, NURS 212 & NURS 241 or instructor permission. NURS 233 Preparation for RN Licensure (1) A seminar to prepare students for the National Council Licensing Exam-RN (NCLEX- RN). The course includes assessment of both nursing knowledge and critical thinking skills. Prerequisite: NURS 221, NURS 222 & NURS 242 or instructor permission. NURS 241 Nursing Focus IV: Leadership and Management (2) Leadership skills associated with patient care management are introduced. Concepts discussed will include: supervision, delegation, conflict resolution, leadership styles, quality assurance, responsibility, accountability, and collaboration. Prerequisites: NURS 131, NURS 132, NURS 133 & NURS 143 or instructor permission. NURS 242 Nursing Focus V: End of Life Care (2) This course provides learning experiences for the client at the end of life. Course will include both 'high tech' and 'high touch' situations and the ethical dilemmas associated with each. The principles of communication, ethics, legal aspects, symptom management, cultural and spiritual competence regarding death are integrated. NURS 231 NURS in Care Seminar Nursing (1) Management 232, students taking Nursing A seminar for Course provides Nursing Preceptorship. opportunity to share students an with the and feelings associated experiences experience. The instructor preceptorship to incorporate facilitates the discussion especially previously taught concepts, leadership. 222 & NURS 242 Prerequisites: NURS 221, NURS or instructor permission. NURS 232 Nursing Preceptorship: Manager of Care (8) experience with a This course includes an or preceptor in a staff nurse as a mentor selected clinical area for the student's final clinical experience. Prerequisites: NURS 221, NURS 222 & NURS 242, or instructor permission. Prerequisites: NURS 211, NURS 212, NURS 241 or instructor permission. NURS 222 Nursing V: Caring for the Client With Chronic Problems - Clinical (5) Clinical course provides learning experiences for the client with chronic physical and mental disorders across the lifespan. Emphasis is on self-awareness and respect for the dignity of the individual. Principles of the nursing process, growth, and development, nutrition, cultural sensitivity, pharmacology, health teaching, caring and communication are integrated throughout. Nursing V: Caring for the Client With Chronic Problems - Theory (5) Didactic course provides experiences for the client with chronic physical and mental disorders across the lifespan. Emphasis is on self-awareness and a respect for the dignity of the individual. Principles of the nursing process, growth and development, nutrition, cultural sensitivity, pharmacology, health teaching, caring and communication are integrated throughout. Prerequisites: NURS 211, NURS 212, NURS 241 or instructor permission. Clinical course provides learning experiences Clinical course provides with adult clients with acute, complex problems. Concepts related to care of the client with major injuries and illness or system failure are discussed. Principles of the nursing process, growth and development, nutrition, cultural sensitivity, pharmacology, health teaching, caring and communication are integrated throughout. Prerequisite: NURS 131, NURS 132, NURS 133 & NURS 143 or instructor permission. NURS 221 Didactic course provides learning Didactic course with adult clients with acute, experiences to care Concepts related complex problems. illness with major injuries and of the client of are discussed. Principles or system failure and the nursing process, growth sensitivity, development, nutrition, cultural caring and pharmacology, health teaching, throughout. communication are integrated 132, NURS 133, Prerequisites: NURS 131, NURS NURS 143 or instructor permission NURS 212 the Client With Nursing IV: Caring for (5) Acute Problems - Clinical NURS 211 NURS Client With for the IV: Caring Nursing - Theory (5) Acute Problems Prerequisite: LPN Licensure, Mobility testing indicating 4th qtr. entry, and admission to the Nursing Program. Articulation (bridge) course for LPNs entering the ADN program at the fourth quarter. The following concepts are discussed: role transition, wellness - illness continuum, nursing process, caring behaviors, prevention concepts, dosage calculations, intravenous administration, fluid and electrolyte balance, history and physical assessment based upon NANDA diagnostic categories, cultural and ethnic concerns, and selected medical conditions. NURS 210 LPN - ADN Articulation II (Bridge) (3) Prerequisites: NURS 121, NURS 122, NURS 123, NURS 142 or instructor permission. This course is a continuation of NURS 142, Pharmacology I. The basics of clinical pharmacology are expanded. Information will be presented on respiration, circulation, neurosensory and food/fluid drugs. NURS 143 Nursing Focus III: Pharmacology II (1) Prerequisites: NURS 111, NURS 112, NURS 113, NURS 141 or instructor permission. NURS 142 Nursing Focus II: Pharmacology I (1) This course will introduce nursing students to the basics of clinical pharmacology including dosage calculations, pharmacokinetics, drug classifications and references. Information will be presented on: anti-infectives, neurosensory, pain/comfort, and food/fluid drugs. Prerequisite: Admittance to the Nursing Program. Concepts of gerontological nursing care are Concepts of gerontological Emphasis is on the presented in this course. social, and physical, psychological, occur with developmental changes that aging. NURS 141 Nursing Focus I: (1) Gerontological Nursing Prerequisites: NURS 121, NURS 122, NURS 123, Prerequisites: NURS 121, NURS NURS 142 or instructor permission. Supervised practice and check-off under Supervised practice and for nursing skills simulated conditions the encountered in procedures commonly such as: intravenous hospital setting central lines, medication administration, administration. tracheostomy care and blood NURS 133 NURS III: Interventions Nursing Skills (1) Advanced 126 Course Descriptions Prerequisite: Instructor permission. the learner. and/or increasetheknowledgeandskill of jointly bystudentandinstructortoimprove Independent learningactivitydesigned Individualized StudiesinNursing (1-5) NURS 299(F,W,Sp) mended. Prerequisite: CompletionofMATH86recom- sytringes andmedicationcups. labels aswellmeasuremedicationsin covered. Studentwilllearnhowtoreaddrug from othermeasurementsystems,is administration. Metricconversion,toand subcutaneous, andintravenous dosages fororal,enteral,intramuscular, course ispreparationofadultandpediatric and dimensionalanalysis.Includedinthis calculation usingformulas,ratioproportion, medical fields,coveringdrugdosage This isanonlinecourseforstudentsinthe Dosage Calculations(2) NURS 262 permission. Prerequisite: NURS251,272orinstructor system. selected clinicalareaofahealthcare staff nurseasamentororpreceptorin This courseincludesanexperiencewitha Summer NursingInternship(5) NURS 261 Prerequisites: NURS252orinstructorpermission. and healthteachingareintegrated. and development,nutrition,pharmacology Principles ofthenursingprocess,growth implanted portdevicesarediscussed. infection control,managingcathetersand complications, legal/ethicalconsiderations, selecting solutions,managingcommon intravenous fluids.Conceptsrelatedto related tothecareofclientsreceiving This courseprovidesadvancedcontent Advanced IVTherapySkills(1) NURS 260 or instructorpermission. Prerequisites: NURS211,212&241 members willbetheprimarytopics. collaboration withhealthcareteam globally, politicalawarenessand health caretrendsbothnationallyand the disciplineofnursing.Ethico-legalissues, concepts necessarytobecomeamemberof This coursewillincludeapresentationof Trends andIssues(2) Nursing FocusVI: NURS 243 advisor. should consultwiththeEarthSciences Oceanography atabaccalaureateinstitution degrees. Studentsintendingtomajorin Applied SciencesandTechnicalArts in ArtsandSciences,GeneralStudies, may considerOCEAN101fortheAssociate interest ordegreedistributionrequirements Students seekingcoursesforgeneral Oceanography Specialist Computer User Office permission. Prerequisite: OCEAN101andInstructor an individualbasis. Study ofselectedoceanographictopicson Oceanography (1-5) Individual Studyin OCEAN 299 Prerequisite: Instructorpermission. the seminars. Field tripswillbeanimportantcomponentto oceanography andearthscienceprograms. expressed needorinterestofstudentsinthe instructor butmayalsoreflectthe Topics willgenerallybedeterminedbythe study ofselectedoceanographictopics. students withanopportunityforadvanced Seminars designedtoprovideoceanography Special TopicSeminars(2) OCEAN 179 phenomena andincludeslocalfieldtrips. centers oninvestigationsofoceanographic and marineecosystems.Thelaboratory atmospheric andoceaniccirculation,waves, ocean basins,seawaterchemistry, Focuses ontopicssuchastheoriginof Survey ofOceanography(5) OCEAN 101(F,Sp) See page58forprogramrequirements. memos, letters,reports,andtables. including masteryofthekeyboardbytouch, Typing fundamentalsonthecomputer Typing I(4) OFFCE 103(F,W,Sp) Prerequisite: AssessmentatoraboveREAD92. dictionary. Reference Manual,phonebook,and information byusingwebsites,TheGregg Learn tolocatevaluableoffice-related Office ReferenceResources(1) OFFCE 101(F) workers. effectively, andhowtoworkwithco- machines andfaxmachines,howtowork etiquette, workethic,operationofcopy worker. Topicsincludedaretelephone A basiccoursefortheprospectiveoffice General OfficeProcedures(2) OFFCE 100(F,W,Sp) Education Office Prerequisite: READ92andknowledgeofWindows. manual andelectronicrecordsstorage. numeric, andsubjectfilingsystems using Principles ofalphabetic,geographic, Management (3) Records andDatabase OFFCE 116 touch. Prerequisite: Minimumtypingspeedof25wpmby improve accuracyandspeed. diagnostic testsandtakecorrectivestepsto keyboard bytouch.Studentscompleteself- Designed forstudentswhoalreadyknowthe Development (2) Typing-Speed andAccuracy OFFCE 106(F,W,Sp) CU 102orequivalent. Prerequisite: ENGL100,OFFCE103orCU91 campus softwareusedisnecessary. proofreading. Basicknowledgeofcurrent correspondence: editing,formatting,and to producemailable,realisticbusiness Course presentsthefollowingskillsneeded Documents (2) Editing andProofreadingBusiness OFFCE 105(F,W,Sp) or equivalent. Prerequisite: READ92orequivalentandENGL90 Course Descriptions 127 Prerequisite: MATH 99 or MATH 97. PHIL 190 (varies) World Philosophy (5) This course will introduce students to the major philosophical traditions of the world. The course will explore different views on ethics, political philosophy, philosophy of education and other areas of inquiry, comparing and contrasting them with one another. (multicultural content) PHIL 200 (varies) Asian Philosophy (5) Examination of major philosophies and philosophers that have shaped the mind of the Oriental. Special attention is given to Confucianism, Legalism, Taoism, and Buddhism. (multicultural content) PHIL 215 (varies) Introduction to Ethics (5) Explores efforts of the humanities to discover moral principles to guide conduct; covers systematic ethical theories; examines the relationship between religion and morals; and includes contemporary ethical issues. Philosophy W, Sp) PHIL 100 (F, to Philosophy (5) Introduction for greater understanding; The human quest among efforts to understand connections the nature of knowledge; the universe; concerning human perennial questions nature and values. PHIL 119 (varies) (5) Introduction to Logic enables Emphasizes inductive argument; evaluate complex students to perceive and skills in lines of reasoning; develops reasoning detecting weak and faulty language. through exercises in natural PHIL 120 (varies) Symbolic Logic (5) Focuses on deductive symbolic reasoning; includes propositional and predicate logic; emphasizes natural deduction and translation into propositional and predicate symbolism. Provides the student with supervised clinical practice experience, performing the tasks of a pharmacy assistant in the inpatient setting and outpatient pharmacy. Prerequisite: Admittance into Pharmacy Technician Program. PHARM 130 (W) Pharmacy Calculations (2) Reviews mathematical calculations and introduces students to application in performance of Pharmacy Assistant tasks. Common conversions, proportions, millequivalents, ratios and percentages are included. Prerequisite: Admittance into Pharmacy Technician Program. PHARM 140 (Sp), 141 (Su) Pharmacy Technician Practicum I, II (4, 12) Prerequisite: Admittance into Pharmacy Technician Prerequisite: Admittance into Program. PHARM 121, 122 Drug Orientation and Pharmacology I, II (8, 3) Orients the student to therapeutic classes of drugs, glossary of terms, brand names and generic drugs. Pharmacological information for all prescription drug classifications is provided. Over-the-counter drugs are also described. Prerequisite: Admittance into Pharmacy Technician Program. PHARM 110 (W), 111 (Sp), 112 (Su) PHARM 110 Technology and Pharmacy II, III (8, 7, 1) Practice I, and with the knowledge Provides students both inpatient and skills needed to perform tasks. Sterile outpatient technical pharmacy are taught. products and aseptic techniques as it pertains to Work safety and security is also included. the Pharmacy Department pharmacy Introduces the student to including history, technology as a career, regulations ethics, pharmacy law and Technicians. pertaining to Pharmacy Pharmacy Technician See Emergency Medical and Health Services, page 100. Paramedic Training Paraeducator See Educational Paraprofessional, page 99. Supervised experience in office-related positions. Prerequisite: Program Chair permission. OFFCE 290 (F, W, Sp) Work Internship (5) Prerequisite: ENGL 100, OFFCE 106 and CU 105 or instructor permission. Learn the use and capabilities of word processing software, and apply these skills to create, proofread and edit business documents. Particular emphasis on editing skills, mail merge, sorting, and tables. OFFCE 234 (Sp) Word Processing: Professional Skills II (5) Prerequisite: BUS 225 and CU 105 or equivalent. Creating Business Publications Using Desktop Publishing (3) Design and produce professional-quality publications including newsletters, flyers, brochures, bulletins, and certificates. Prerequisite: Keyboarding skills, assessment at Prerequisite: Keyboarding skills, READ 92 and MATH 86. OFFCE 231 Topics include effectively working with co- Topics include effectively grammar and workers; reviewing basic formatted punctuation; creating properly understanding business documents; and concepts. Basic ergonomics and other office are introducted. concepts of Microsoft Word OFFCE 127 (F) OFFCE 127 (3) Today's Office Environment Transcribing mailable business-related Transcribing from prepared materials. correspondence ENGL 234, OFFCE 105 and Prerequisite: OFFCE 100. OFFCE 117 OFFCE (3) Transcription Machine 128 Course Descriptions classes. ENGL 091withagradeof"C"orhigherin both and ENGL101orcompletionofREAD093 and Prerequisite: Assessmentatcollege-level reading Same asPOLSC201. crime, equalityandotherswillbeexamined. such aslibertyandcoercion,victimless Locke, Rousseau,Humeandothers.Topics present, includingAristotle,Macchiavelli, philosophers fromancientGreecetothe This classwillcovermajorpolitical Political PhisolophyandIdeology(5) PHIL 290(varies) Aristotle, HumeandRussellwillbestudied. Representative figuressuchasPlato, science havehadonphilosophy. which historicalforcessuchasreligionand the presentcentury.Examinesimpact pre-Socratic Greekphilosophyandendsin Survey ofWesternphilosophy.Startswith World (5) Great ThinkersoftheWestern PHIL 270(varies) morality. experience, andtheeffectofreligionon other gods,evil,immortality,religious such asexistenceoftheChristianGodand Analysis ofproblemsinreligiousthought Problems inPhilosophyofReligion(5) PHIL 267(varies) science. awareness ofphilosophicalissuesin course willfocusondevelopingacritical objectivity, andvaluesofscience.The laws ofnatures,andtherolerationality, theoretic reductionoftheories,thestatus debate overrealismandanti-realism,the falsification ofscientifichypotheses,the Among thesearethevalidationand issues currentinthephilosophyofscience. the natureofscientificprogressandother A conceptualandhistoricalintroductionto Philosophy ofScience(5) PHIL 260(varies) A. J.AyerandW.V.O.Quine. will includeRussell,Sartre,Camus,Dewey, philosophy. Representativefigurescovered social forcesaffectingandbeingaffectedby philosophy. Coverstheintellectualand Century, examiningthedominantschoolsof Focuses onWesternphilosophyinthe20th Contemporary Philosophy(5) PHIL 230(varies) Education Physical 208 (F, W, Sp) Intermediate Weight Intermediate 208 (F,W,Sp) Specific Sport 201 (W) (2) Fitness Total Advanced 200 (F,W,Sp) IndependentFitnessLabII(1) 171 (F, W, Sp) IndependentFitnessLabI(1) 170 (F, W, Sp) (1) Fitness Fast 155 (F,W,Sp) (1) Fitness Cardio (1) Walking 140 (W,Sp) 111 (Sp) (1) Toning 109 (F,W,Sp) SelfDefenseforWomen(1) (1) Training Weight Beginning 108 (F,W,Sp) 103 (F) (1) Fitness Aerobic 105 (W,Sp) (2) Fitness Total 100 (F,W,Sp) Fitness Activities:1-2Creditseach check theirrequirements.) to transferotherinstitutionsshould needed forthedegrees.(Studentsplanning credits canbeincludedinthe90 physical educationactivitycredits.These degrees, itisnecessarytoobtainthree Studies orAssociateinArtsandSciences In ordertoreceivetheAssociateinGeneral 118 (F, W, Sp) Modern Jazz Dance Jazz Modern 118 (F,W,Sp) LifeGuarding(2credits) Dance: 1Crediteach 115 (Sp) Swimming Advanced 114 (F,W,Sp) IntermediateSwimming 113 (F,W,Sp) Backpacking(1-5) Swimming Beginning 112 (F,W,Sp) Hiking(1) Aquatics: 1Crediteach 288 175 1 -5Creditseach Lifetime RecreationalActivities military service. medical problemorastudenthasprevious may requestwaiversonlyifthereisa education departmentchairman.Students be waivedonlywithapprovalofthephysical level maynotberepeatedforcredit. by theinstructor.Anactivityatsame courses. Advancedplacementmaybemade courses areprerequisitestoadvanced intermediate courses,and The physicaleducationrequirementmay Most activitiesrequireextrafees. Beginning coursesareprerequisitesto Training (1) Conditioning (2) 3 AdvancedVolleyball 237 AdvancedSoccerTechniques Volleyball Intermediate 236 (F,W,Sp) Volleyball 136 (F,W,Sp) Soccer Beginning 235 Softball 135 (Sp) Basketball Advanced 134 (Sp) Basketball Beginning 233 (F) Techniques Baseball 133 (F,W) 241 (F) Team Sports:1Crediteach and Tennis Beginning 129 (F,Sp) and Badminton Beginning 126 (F,W,Sp) Skiing Intermediate Dual Sports:1Crediteach Skiing Beginning 225 (W) 125 (W) Racquetball Intermediate 231 (F,W,Sp) Racquetball Beginning 131 (F,W,Sp) IntermediateGolf Tennis Beginning BeginningGolf 128 (F,Sp) 223 Bowling Intermediate 123 Bowling Beginning 222 (F,W) 122 (F,W) Individual Sports:1Crediteach and techniquesbyindividualclassmembers. speakers, andactualperformanceof skills Includes lectures,groupdiscussions, guest techniques andstrategiesforbaseball. with thebasicteachingandcoachingskills, Provides thebeginneroradvancedcoach Coaching Skills(2) PE 285(W) high schoolorcollege. Prerequisite: Experienceinorganizedbaseball-either play conceptsandrulesofthegame. conditioning, basicskills,strategies,team- The fundamentalsofbaseball.Includes Baseball Techniques(1) PE 241(F) Courses Professional Education Physical Pickleball Pickleball (Student furnishesracquet) (Student furnishesracquet) Course Descriptions 129 refraction, reflection, optical reflection, refraction, heat, specific systems,fluids, gasses, and ideal temperature, Introduces states of matter. techniques and problem solving to real world applications included. situations. Laboratory POLSC 203 (varies) International Relations (5) Study of interrelationships among nations: power, structure, decision-making; conflicts and compromise. POLSC 201 (varies) Political Phisolophy ahd Ideology The class will cover major political philosophers from ancient Greece to the present, including Aristotle, Macchiavelli, Locke, Rousseau, Hume and others. Topics such as liberty and coercion, victimless crime, equality and others will be examined. (Same as PHIL 290). Prerequisite: Assessment at college-level reading and ENGL 101 or completion of READ 093 and ENGL 091 with a grade of "C" or higher in both classes. POLSC 202 (F, W, Sp) American National Government and Politics (5) Survey of the Constitution, the three branches of government, and processes through which public policy is formulated, enacted into law and executed. Prerequisite: MATH 124 for PHYS 121; PHYS 121 124 for PHYS 121; PHYS Prerequisite: MATH 121 for 123. for 122, PHYS PHYS 299 Independent Study (1-5) analysis, and Independent observation, topic. reporting of a physics-related Prerequisite: Instructor permission. Political Science POLSC 101 (F, W, Sp) Introduction to Political Science This course is intended to serve as a comparative introduction to the concepts, methods, and subject areas of the discipline of political science. Students will explore various forms of political beliefs, behaviors, institutions, and processes at the individual, group, national, and international levels. Strongly recommended for those students with no prior coursework in political science. cuses of motion, conservation of energy, momentum and angular momentum, gravitation, center of mass, and torques. include Coulomb's Law, Gauss' Laws, circuits and circuit theory, electrical devices, Ampere's Law, electric and magnetic flux, and induction. thermodynamics. Topics include oscillations, damping, wave propagation, interference, Prerequisite: MATH 97 or 99; MATH 115 recommended. PHYS 121 (F, W, Sp), 122 (W), 123 (F, Sp) Engineering Physics (5, 5, 5) Calculus based physics for engineering or those majoring in certain sciences. 121 - Study of mechanics: motions and 122 - Electricity and magnetism. Topics 123 - Waves, sound, light and An advisor should be consulted to determine An advisor should be consulted physics course for the appropriate level of your degree goal. Students intending to major in Physics at a baccalaureate institution should work toward an Associate of Science degree with a Physics Specialization. PHYS 114 (F, Sp), 115 (W), 116 (Sp) General Physics (5, 5, 5) Algebra-based physics for liberal arts students and certain professions. 114 - Study of basic mechanics including position, velocity, acceleration, forces, momentum, and energy. 115 - Study of thermodynamics, oscillations, waves, capacitance, and electric forces/fields/potential/potential energy. 116 - Study of DC circuits, magnetism, geometrical optics, wave optics, and modern physics. Laboratory included. PHYSN 100 (F, W, Sp) PHYSN 100 and Technology Physical Science and physical principles Studies underlying in topics like motion, energy, interactions etc., and how they light, sound, electricity, A hands- are applied and used in technology. conceptual on approach is used to develop between reasoning, interrelationships and effective concept and applications, included. communication skills. Laboratory Physics Physical Science PE 292 (F, W, Sp) Advanced First Aid (5) The student will satisfy the requirements for Responding to Emergencies American Red Cross first aid and CPR (Cardiopulmonary Resuscitation) certification. Emphasis is placed on the relationship between course content and lifestyle choices to foster a better understanding of health issues today. Current issues include, but are not limited to, physical fitness and nutrition; weight management; stress and emotional health; chemical use and abuse; issues in contemporary human sexuality; communicable and non-communicable disease; health-smart consumerism; the contemporary healthcare system; aging and dying; and environmental health issues. PE 191 (F, W, Sp) WAOL Contemporary Health and Wellness (5) A course for students to learn how to take A course for students to control of their personal health and lifestyle habits so they can make a constant and deliberate effort to stay healthy and achieve the highest potential for well-being. Encompasses a total wellness concept of one's physical, mental, emotional and social well being. Students will examine major health issues of contemporary society, with emphasis on identifying risk factors. PE 190 (F, W, Sp) (3) Health and Wellness Physical Education Non-Activity Courses Designed to introduce the student to the introduce the student to Designed to sports officiating. Topics avocation of of officiating, include philosophy rules, to become an official, requirements societal influences and mechanics and sports officials. attitudes towards PE 290 (W) PE 290 (3) Officiating Sports 130 Course Descriptions READ 093orequivalentassessment. Prerequisite: A"C"orbetterinENGL091 and interventions. (canberepeated.) and courts,racialpoliticsmilitary include: electionsandthepresidency, law viewed inthecourse.Rotatingthemes as abackgroundforananalysisofthefilms will readrelevantpoliticalscienceliterature portrayal incontemporarycinema.Students political andlegalissuesthroughtheir This coursewillexamineavarietyof Politics andFilm(5) POLSC 231(varies) 113 recommended. Prerequisite: CompletionofPOLSC203orHIST which stillsmolderinCongoandSomalia. Israelis andPalestinians,pastwars continuing difficultrelationsbetween such asthewarinYugoslavia, they areresolved.Wewillexamineconflicts international conflictsgetstartedandhow The coursewillfocusonhowvarious Seminar (5) Advanced InternationalRelations POLSC 230(varies) Prerequisite: POLSC202orinstructorpermission. intensive) social, andeconomiccontext.(writing will beexaminedinabroaderpolitical, protection. Courtdecisionsintheseareas rights andeconomicliberty,equal institutional powersofgovernment,property around threesubstantiveareasoflaw: U.S. SupremeCourt.Thecourseisorganized the U.S.,withparticularemphasison process ofconstitutionaldecisionmakingin This coursewillintroducestudentstothe Introduction toConstitutionalLaw(5) POLSC 220(varies) respective positions.(multiculturalcontent) a seriesofshortpapersanalyzingthe on bothsidesofthepolicydebateandwrite weekly basis.Studentswillreadarguments controversial publicpolicyissuesona This coursewillexamineavarietyofcurrent American Politics(3) Contemporary Issuesin POLSC 210(varies) confronting theselocalpoliticalunits. including anexaminationoftheproblems of state,countyandcitygovernments, Study ofthenature,functionandproblems Government andPolitics(5) State andLocal POLSC 205(varies) content) (writingintensive) will alsobeaddressed.(multicultural and ethnicityinunitingdividingwomen women. Theroleofrace,class,sexuality various policydecisionsuponthelivesof women's politicalactivismandtheimpactof American politics.Studentswilllearnabout This coursewillexploretheroleofgenderin Women inPolitics(5) POLSC 240(varies) PSYCH 140 reading andwriting. with a"C"orhigherassessmentatcollege-level Prerequisite: CompletionofENGL91andREAD93 thinking andpersonalitywillbeexamined. intelligence, learningandremembering, and attention,motivation,emotion, maturation, sensoryprocesses,perception discipline: thenervoussystem,heredityand Introduction topsychologyasanacademic General Psychology(5) PSYCH 100(F,W,Sp) Psychology Prerequisite: Instructorpermission. internship experience. readings andaresearchpaperbasedonthe with theinstructortodiscussassigned elected officialandwillmeetperiodically either apoliticalparty,interestgroup,oran Students willparticipateininternshipswith Political Internship(1-5) POLSC 298(F,W,Sp) and Sumner. Hobbes, Benthan,Jefferson,Montesquieu Madison, Rousseau,Marx,Machiavelli, following writers:Aquinas,Locke,Mill, A studyofthepoliticalideas Political PhilosophyandIdeology(5) POLSC 290(varies) organic disorders, and theprocessof psychosomatic disorders,sexualdeviation, anxiety disorders,personality include schizophrenia,mooddisorders, of mentalhealthdisorders.Topicscovered A studyofthedevelopmentandsymptoms Abnormal Psychology(5) PSYCH 204 Paraeducator Programonly.) communication. (thisclassisusedforthe emphasis onpositiveself-imageand behavior managementtechniqueswith An explorationofpreventiveandeffective Behavioral Management(3) their roleinmentalhealth. biosocial, cognitive,andculturalfactorsan adjustment tostress.Attentionisgiven Behavioral Health&Wellness(5) PSYCH 207(F,W,Sp) Prerequisite: PSYCH100. (multicultural content) the humanfromconceptiontodeath. emotional, andintellectualdevelopmentof An examinationofthephysical,social, Life Span(5) Developmental Psychology: PSYCH 206(F,W,Sp) personality willbestudied. techniques ofmeasuringaspects differences, personalitychangeand of personality,thecausesindividual Introduction todevelopmentanddynamics Introduction toPersonality(5) PSYCH 205 Prerequisite: PSYCH100. Sciences Program. Prerequisite: Acceptance intotheRadiologic certification andinitiatetheirHIVeducation. have theopportunitytoearntheirCPR available tothem.Inaddition,students will the on-campusstudentsupportservices necessary forsuccessaswelllearning of professional requirements,andcommitment the program'smissionandgoals, educational experience.Studentslearnof Science program,forasuccessful students, acceptedintotheRadiologic This courseisdesignedtohelpprepare Radiologic ScienceOrientation(3) RS 100(F) Sciences Radiologic Prerequisite: Instructorpermission. reporting ofaselectedproblem. Independent observation,analysisand Individual StudyinPsychology(1-5) PSYCH 299 but notforboth. granted foreitherPSYCH207orHSP as HSP207;creditfordegreewillbe chemical abuse(alcohol-drug).Samecourse ways suchaschronictension,illnessand stress whichcanmanifestitselfinvarious mental healthandtheabilitytocopewith managing interrelationshipsofphysicaland Covers theoriginsofstress,ways (For non-majors) Course Descriptions 131 Prerequisite: HT 130 or concurrent enrollment. Radiographic Film Critique and Technique III (1) A review and evaluation of radiographs is conducted to determine their quality as diagnostic images. Emphasis is placed on determining what adjustments in technical factors are necessary to correct non- diagnostic radiographs due to incorrect exposure factors. Radiographs will also be evaluated to insure proper positioning, lack of motion, lack of distortion and optimum recorded detail. Prerequisite: RS 151 or instructor permission. RS 170 (F) Introduction to Fundamentals of Patient Care (5) Introduces common knowledge of patient care including venipuncture and EKG placement. Observation, communication, and basic nursing technical skills are taught; legal-ethical issues and seven hours study of communicable diseases/AIDS are included. Provides basic knowledge regarding the initiation and maintenance of intravenous access, as well as basic introduction to EKG's, including placement of leads. Recognition that the patient's health problems, including evaluation of patient responses during procedures, are the foci of activities for the health care team will be emphasized. Lecture and lab course. Same course as HT 170. RS 150 (F) RS 150 and Critique Film Radiographic I (1) Technique and (detail, density, contrast Prime factors other factors influencing distortion) and of technique for production radiographic quality radiographs. acceptance into RS program, Prerequisite: Official or instructor permission. RS 151 (W) and Radiographic Film Critique Technique II (1) of radiographs is A review and evaluation their quality as conducted to determine is placed on diagnostic images. Emphasis and developing the critique method radiographs for successfully evaluating density and proper positioning, correct contrast, lack of motion, lack of distortion, and optimum recorded detail. Prerequisite: RS 150 or instructor permission. RS 152 (Sp) Prerequisite: RS 141 or instructor permission. Prerequisite: RS 140 or instructor permission. RS 142 (Sp) Radiographic Positioning III (5) Overview of special radiographic procedures including myelography, angiography, ERCP's and cholecystography. A study of the contrast media employed with these examinations is also conducted. Demonstration and laboratory experience in positioning and related anatomy of the skull, facial bones, sinuses and mandible. Projections studied will include information for pediatric and trauma patients. RS 141 (W) Radiographic Positioning II (5) Provides demonstration and laboratory experience in radiography of the pelvis, hip, sacroiliac joints, cervical spine, thoracic spine, lumbar spine, sacrum , and coccyx. Visceral studies which include the upper gastrointestinal series, intravenous pyelography, and colon. Projections studied will include information for performing examinations on the pediatric and trauma patient. Prerequisites: RS 121, instructor permission, and Prerequisites: RS 121, instructor background check, medical health clearance, WSP current CPR card. proof of medical insurance, RS 140 (F) Radiographic Positioning I (5) Studies basic positioning principles and terminology. Demonstration and lab experience in positioning and related anatomy of the chest, abdomen, upper and lower extremities. Projections studied will include information on performing cross- table examinations for minor trauma cases. Prerequisite: Official acceptance into RS program. Prerequisite: RS 120, medical health clearance, Prerequisite: RS insurance, check, proof of medical WSP background and instructor permission. current CPR card, RS 122 (12) Clinical Education III a series of This is a continuation of education competency based clinical an assigned clinical classes. Students attend instruction, education center and by acquire the observation, and experience, image necessary skills to successfully patients utilizing X-ray energy. education center and by instruction, center and education the acquire and experience, observation, to successfully image necessary skills X-ray energy. patients utilizing Clinical Education II (5) This is a continuation of a series of competency based clinical education classes. Students attend an assigned clinical RS 121 (Sp) Prerequisites: RS 101, RS 140, medical health clearance, WSP background check, proof of medical insurance, current CPR card, and instructor permission. Clinical Education I (5) Initial course in competency based radiography clinical education. Students orient to an assigned clinical education center and by instruction, observation, and experience, acquire the necessary skills to successfully image patients utilizing X-ray energy. RS 120 (W) Prerequisites: Math 99, RS 108, or instructor permission RS 109 (Sp) Radiation Physics II (5) A continuation of Radiation Physics I. Emphasis will be placed on radiographic film and its response to exposure, fluoroscopic and digital imaging, CR, tomography, mammography, imaging equipment and accessory imaging equipment used in radiography. Radiation biology and protection considerations for patients and staff relative to radiation interactions with living tissue is also presented. Prerequisite: MATH 99, RS 101, and instructor permission. RS 108 (W) Radiation Physics I (5) Introduces concepts of electromagnetic of developing a radiation from the aspect basic understanding of the production and control of X-radiation. Deals with components of X-ray circuits, tubes, X-ray equipment, design and application. Prerequisite: Math 99, official acceptance into the Prerequisite: Math 99, official RS program, or instructor permission. Content is designed to provide a foundation Content is designed in practices and policies of the principles, The radiology specifically. healthcare and of be introduced to the history student will ethics and radiology, medicolegal An introductory professional associations. and basic orientation to X-ray equipment exposure will be principles of radiographic covered. RS 101 (F) RS 101 Science Radiologic of Fundamentals Care (4) and Health 132 Course Descriptions thinking skillsandcorrelateitwithprevious examinations. Studentsincorporate critical maintaining proficiencyinpreviously learned acquire newskillswhilerefiningand observation, andexperience,continue to clinical educationcenterandbyinstruction, based clinicalinstructionrotatetoanother Students inthesecondyearofcompetency Clinical EducationV(7) RS 226(W) current CPRcard,orinstructorpermission. WSP backgroundcheck,proofofmedicalinsurance, Prerequisite: RS122,medicalhealthclearance, independently. enhance theirabilitytofunctionmore correlate itwithpreviousexperiencesto incorporate criticalthinkingskillsand previously learnedexaminations.Students continue toacquirenewskillswhilerefining by instruction,observation,andexperience, assigned toaclinicaleducationcenterand competency basedclinicalinstructionare Students beginningtheirsecondyearof Clinical EducationIV(7) RS 225(F) Prerequisites: RS170orinstructorpermission. common dosagesandphysiology. the RadiologyDepartment,ACLSdrugs, Course willincludecommonmedicationsin the appropriateinterventionalresponse. contrast mediareactionsanddetermining performing venipuncture,identifying identifying commonsitesforvenipuncture, An overviewofthecirculatorysystem, Pharmacology andIVTherapy(3) RS 216(F) permission. Prerequisite: RS243,BIOL220/221,orinstructor radiographic quality. on radiographsanditseffect Emphasis onhowpathologyisdemonstrated skeletal, gastrointestinalandurinary. Systems coveredincluderespiratory, application toradiologictechnology. occurring indiseaseandinjury,their Acquaints thestudentwithcertainchanges Radiographic Pathology(3) RS 214(W) Prerequisite: Instructorpermission. presented attheconference. conference andattendeducationalsessions organization ofatwo-dayleadership First-year studentswillparticipateinthe Student LeadershipSeminar(1) RS 175(Sp) function moreindependently. experiences toenhancetheirability current CPRcard,orinstructorpermission. WSP backgroundcheck,proofofmedicalinsurance, Prerequisite: RS225,medicalhealthclearance, preparation. accountability, collaborationandresume styles, theworkenvironment,responsibility, delegation, conflictresolution,leadership discussed willinclude:supervision, patient careandmanagement.Concepts Studies leadershipskillsassociatedwith Leadership andManagement(1) RS 233(W) current CPRcard,orinstructorpermission. WSP backgroundcheck,proofofmedicalinsurance, Prerequisites: RS227,medicalhealthclearance, function moreindependently. experiences toenhancetheirability thinking skillsandcorrelateitwithprevious examinations. Studentsincorporatecritical proficiency inpreviouslylearned new skills,whilerefiningandmaintaining education centerandcontinuetoacquire instruction areassignedtoaclinical practice. Studentsinthesecondyearof class inpreparationforentrylevelclinical This isacapstonecompetencybasedclinical Clinical EducationVII(10) RS 228 current CPRcard,orinstructorpermission. WSP backgroundcheck,proofofmedicalinsurance, Prerequisite: RS226,medicalhealthclearance, function moreindependently. experiences toenhancetheirability thinking skillsandcorrelateitwithprevious examinations. Studentsincorporatecritical maintaining proficiencyinpreviouslylearned acquire newskillswhilerefiningand observation, andexperience,continueto clinical educationcenterandbyinstruction, based clinicalinstructionareassignedtoa Students inthesecondyearofcompetency Clinical EducationVI(7) RS 227(Sp) Prerequisite: RS142 orinstructorpermission. performing pediatric andtraumaprojections. assurance. Informationwillbeincluded for emphasis onbasicradiographicquality review ofradiographicimagingwith shoulder girdle,pelvis,andspinalcolumn. A upper andlowerextremities,thoracic cage, alternate andspecialpositioningofthe Demonstration andlabexperienceof Radiographic PositioningIV(3) RS 243(F) Prerequisite: RS175. dynamics oftheimagingenvironment. generate images,theequipmentandother will beonthevariousenergiesusedto advanced imagingmodalities.Theemphasis An overviewofCT,MRI,U/S,andother Advanced ImagingModalities(1) RS 255(Sp) imaging equipment. patient exposureandthemaintenanceof be presentedandrelatedtotheirimpacton factors, andmedicolegalconsiderationswill Radiology qualitycontrol,assurance organization withemphasisonradiology. An in-depthstudyofthehealthcare Advanced HealthcareOrganization(4) RS 250 Prerequisite: RS243orinstructorpermission. meet JCAHOrequirements. pediatric andpatientwithdisabilitiesto Includes informationforthegeriatric, pediatric and/orseveretraumapatient. emphasis onproceduresinvolvingthe Advanced patientcareskillswithspecial Radiographic PositioningV(3) RS 244(W) Prerequisite: ProgramChairpermission. skill ofthelearner. improve and/orincreasetheknowledge and jointly bythestudentandinstructor, to Independent learningactivity,designed Independent Study(1-5) RS 299(F,W,Sp) Prerequisite: Instructorpermission. a projectoressayisrequired. presented attheconference.Presentationof conference andattendeducationsessions the organizationofatwo-dayleadership The secondyearstudentswillparticipatein Student LeadershipSeminar(1) RS 275(Sp) Certified Practitioner. Prerequisite: SecondyearRSstudentorARRT requirements formammographytraining. Mammography; alsomeetstheFDA/MQSA ARRT AdvancedRegistryExaminationin students andpractitionerstoprepareforthe control measures.Coursewillassist emphasis onbasicpositioningandquality specialized traininginmammographywithan A lectureandlaboratorycoursefor Introduction toMammography(3) RS 270(Sp) student. Prerequisite: RS108,109,secondyearradiography Course Descriptions 133 REAL 175 Real Estate Appraising: Market Data Analysis (3) Analysis of income-producing properties utilizing cost, market data, and income correlative approach to value. Gross income estimates, expense analysis and capitalization techniques are also incorporated into the analysis. This course is approved by the Washington State Department of Licensing for 30 clock-hour credits. REAL 182 Report Writing of Residential Real Estate Appraising (3) Shows the students how to complete real estate appraisal reports. Students learn the steps for completing all written reports, as well as the steps for review appraising. This course is approved by the Washington State Department of Licensing for 30 clock- hour credits. Real Estate Real REAL 160 Law (3) Real Estate as to law and legal systems Introduction estate transactions. Major related to real forms of ownership; title, topics include and insurance; fraud, deceit transfers and law and misrepresentation; contract documents; documents; real estate security Approved duties and liabilities of licensees. Licensing Division by the Washington State Satisfies law for 30 clock-hour credits. Estate requirements for the Real Certificate Program. REAL 170 Principles of Real Estate Appraising (3) Principles and procedures used in determining the value of single-family residences. Students will apply cost, economic and market data approaches to determine value. Students will be required to successfully complete a Uniform Residential Appraisal Report (URAR). This course is approved by the Washington State Department of Licensing for 30 clock-hour credits. READ 100 (F, W, Sp) Advanced Vocabulary Development (2) Self-paced course provides student with skills to develop vocabulary necessary for college success. Course uses strategies in identification and use of context clues, pronunciation, word parts, word meaning and dictionary/thesaurus usage. Prerequisite: Assessment at college-level reading or a grade of "C" or higher in READ 93. READ 098 (F, W, Sp) Reading Lab (1) Reading lab activities reinforce basic reading skills introduced in reading class (READ 092 and 093). Self-paced program enables students to improve vocabulary and comprehension skills. Concurrent enrollment in READ 092 or READ 093 strongly recommended. May be repeated a total of three times and will graded S/U. READ 095 (F, W, Sp) Literature Circle (1) basic reading Reading lab activities reinforce award-winning, skills through exposure of Vocabulary and thought provoking literature. value of reading comprehension skills and level books, are heightened through course discussions. journal responses, and group May be repeated a total of three times and will be graded S/U. READ 94 (F, W, Sp) READ (3) Vocabulary College provide students with Designed to strategies, and skills to information, the vocabulary that build the necessary demands. Strategies college environment of vocabulary through include: increase of own context, dictionary, study and use and Latin Roots and knowledge of Greek and affixes. Prerequisite: Assessment in READ 93 or a grade of "C" or higher in READ 92. College Textbook Mastery The preparatory class for college success. Emphasis on text analysis for structure, inferring meaning, critical thinking and vocabulary development. Introduction to literary devices is included. A variety of expository excerpts from college textbooks are used for demonstration of skills. Lab application is used for practice. Instruction reading graphic materials (graphs, charts, diagrams) are included. Prerequisite: Assessment into READ 92. READ 93 (F, W, Sp) READ 92 (F, W, Sp) Textbook Mastery (5) This course enables students to work with essential text structure and to begin basic analysis of passages from a variety of texts. Identification of main points, details, implications are included, as well as skills in outlining and summarizing. Lab application is used for practice, and vocabulary development is included. READ 89 (F, W, Sp) Tutor (1) Self-paced course helps student develop tutoring skills with confidence and effectiveness. Student works with students, lab instructor, text and videotapes. Vocabulary Textbook 1) Comprehension (1, 1, students improve Self-paced courses help text. Student basic reading skills for college and learns to furthers vocabulary growth understanding read textbooks with greater works with lab and efficiency. Student software; instructor, text, and/or computer is necessary. no prior computer experience READ 80, 81, 82 (F, W, Sp) (F, W, Sp) 82 (F, W, Sp) (F, W, READ 80, 81, (F, W, Sp) Students enrolled in the ESL Program are in the ESL Program enrolled Students to complete the program strongly advised the Reading program before attempting native speakers. designed for Reading 134 Course Descriptions Prerequisite: RC160. online course. discussion, orstudentpresentations. Hybrid manner intheformoflecture,small group subject matterinanorganized,interesting will beacomprehensiveoverviewof the change indifferentdiseasestates.Included the lungsaswellhownormalvalues regarding thefunctionofgasexchangein gain knowledgeandinterpretationskills the respiratorysystem.Thestudentwill additional informationaboutthefunctionof Course isdesignedtoprovidestudentswith Arterial BloodGases(3) RC 161 physiology. Hybridonlinecourse. and mechanismsofcardiopulmonary anatomy andprogresstomajorconcepts topics include:respiratoryandcardiac of thefunctionstructures,therefore structure isessentialtotheunderstanding of therespiratorysystem.Knowledgea information aboutthestructureandfunction Course isdesignedtoprovidestudentswith Pathophysiology (4) Cardiopulmonary A&Pand RC 160 Therapy Respiratory clock-hour credits. Washington StateLicensingDivisionfor30 and objectivevalues.Approvedbythe rates, netoperatingincome,andsubjective property types,grossrentmultipliers,CAP discounted cashflows,analysesofdifferent develop investmentreturnsbycapitalization, course wherebystudentswillworkwithand estate analyses.Thisisanappliededucation cycles, feasibilitystudies,andvariousreal value-added concepts,markettrendsand understanding ofinvestmentprinciples, Course designedtoestablishabasic Real EstateInvestmentStrategy(3) REAL 250 estate fundamentals. to meetpre-licensingrequirementinreal State LicensingDivisionfor60clock-hours examination. ApprovedbytheWashington salesman/broker realestatelicensing Designed topreparestudentspassthe mentals astheyrelatetoWashingtonState. An in-depthstudyofrealestatefunda- Salesman Pre-license(6) Fundamentals ofRealEstate REAL 200 presentations. lecture, smallgroupdiscussion,orstudent orgnized, interestingmannerintheformof overview ofthediseaseprocessinan care. Includedwillbeacomprehensive to applyinthespecialtyareaofrespiratory a foundationofinformationforthestudent processes. Generalpathophysiologyprovides advanced informationaboutdisease Course isdesignedtoprovidestudentswith Advanced RCPathophysiology(3) RC 162 compliance issues. interfaces andpatientcomfort & Paykel-modes,pressuresettings, Respironics, Mallingckrodt,Sullivan,Fisher home care.Equipmentwillinclude: vs. pneumotachometerdevices,andofRC assessment, truevolumemeasuringdevices monitoring, bedsidepulmonaryfunction management, non-invasivepatient airway management,tracheostomy principles andtechnologiesofemergency students withabackgroundonthe Course isdesignedtoprovidefirst-yearRC Respiratory TherapyEquipmentII(3) RC 171 numerous, technicalfacetsofthefield. to RCisessentialassimilatingthe devices. Knowledgeofhistoryasitrelates positive- andnegative-pressurebreathing humidity andaerosolgenerators, compressed gasandliquidoxygensystems, regulators, oxygendeliverydevices, equipment: pressuregauges,flowmeters, technologies. Includedishands-onusageof development ofbasicRCprinciplesand historical backgroundondiscoveryand Course willprovidestudentswitha Respiratory TherapyEquipmentI(3) RC 170 group discussion,orstudentpresentations. subject matterintheformoflecture,small will beacomprehensiveoverviewofthe Testing, andtheirinterpretations.Included Pulmonary FunctionTesting,Exercise information necessaryforunderstanding Course willprovidestudentswith Pulmonary Functions(3) RC 163 Prerequisite: RC170. begin thefirstweekofNovember. Clinical rotationstothehospitalsiteswill weeks ofthequarterlabwillbeoncampus. and alab/clinicalrotation.Thefirstsix consists ofalecture/classroomcomponent patient assessmenttechniques.Thisclass hospital setting.Emphasisisplacedon respiratory therapeuticmodalitiesinthe Respiratory Carestudenttoperformbasic Course isdesignedtopreparethebeginning Respiratory TherapyClinicalI(8) RC 180 Prerequisite: RC171. have risen. sophistication towhichmodernventilators proficiency, andappreciatethelevelof types ofventilatorstogainconfidence, problems intheICUandutilizedifferent thinking requiredtotroubleshootventilator ventilation (CMV).Studentslearnlogical criteria fortreatingpatientsonmechanical and interrelatetechnicalphysiological technologies forthestudenttoassimilate Course willprovidetheprinciplesand Respiratory TherapyEquipmentIII(4) RC 172 Prerequisite: RC181. and alab/clinicalrotation. consists ofalecture/classroomcomponent and specialRCprocedures.Thisclass the patientreceivingmechanicalventilation covered willincludetheinitiationandcareof patients intheIntensiveCareUnit.Topics quarter RespiratoryCarestudenttocarefor Course isintendedtopreparethethird Respiratory TherapyClinicalIII(8) RC 182 Prerequisite: RC180. rotation. classroom componentandalab/clinical CPAP. Thisclassconsistsofalecture/ blood gases,non-invasiveventilationand on airwaymanagement,ECG's,arterial environment thisquarter.Emphasisisplaced be introducedtothecriticalcare quarter. TheRespiratoryCarestudentwill skills andknowledgebaseacquiredinfirst Course willcontinuetobuildontheclinical Respiratory TherapyClinicalII(8) RC 181 Course Descriptions 135 RC 282 Neonatal Clinical Rotation (2) Course will prepare the second year Respiratory Care student to perform advanced respiratory therapeutic modalities in a neonatal intensive care setting. Emphasis is placed on patient assessment techniques. This class consists of a five- week clinical rotation. RC 283 Specialty Clinical Rotation II (2) Course is designed to prepare the second year Respiratory Care student as an expert respiratory care practitioner. This five-week rotation is the last clinical rotation before graduation; therefore, students are encouraged to do their final rotation at their desired place of employment. This class consists of a clinical rotation only. RC 290 Ethics and Professionalism in Respiratory Care (2) While providing care and delivering therapies, RCP's must be continuously aware of the legal and ethical implications of the services they deliver and their actions while delivering them. This course will provide students with information necessary for understanding legal issues and for making ethical decisions in respiratory care. RC 280 (4) Rotation Clinical Specialty the second year Course will prepare Care student to perform Respiratory therapeutic modalities advanced respiratory placed seetings. Emphasis is in a variety of and assessment techniques on advanced of a This class consists patient education. will be clinical rotation only. Students or assigned to Tuesday, Wednesday, Thursday clinical days. RC 281 Clinical Advanced Critical Care Rotation (4) second year Course will prepare the to perform Respiratory Care student modalities advanced respiratory therapeutic Emphasis is placed in a variety of settings. on advanced assessment techniques and patient education. This class consists of a clinical rotation only. Students will be assigned to Tuesday, Wednesday, or Thursday clinical days. RC 272 Pulmonary Rehabilitation, Home Care, and Assistance in Specialty Procedures (3) Course will provide students with information about the alternate settings of pulmonary rehabilitation and home care. Additionally, students will study the special procedures they assist physicians with. RC 262 Review of Applications of Respiratory Care (4) Course will provide students with a review for the advanced level practitioner written and clinical simulation board examinations. Included will be comprehensive overviews of all respiratory subject matter, including: Analysis of Date, Equipment, and Therapies. RC 261 Pediatric and Neonatal Respiratory Care (4) Course will provide second year students with an overview of pediatric and neonatal diseases. The field of neonatology/pediatrics is highly dynamic and requires up to date knowledge of clinical and technical skills. A neonatal/pediatric RCP is expected to be able to perform as an integral part of the highly specialized health care team as well as develop critical thinking skills. Course will provide second year students Course will provide the necessary to care for with information Advanced assessment critically ill patient. covers trauma care, and diagnosis and assessing and managing Hemodynamics, care unit. the patient in the critical RC 251 Case Respiratory Pathophysiology Presentations (2) students with Course is designed to provide Included will introductory Pathophysiology. of the various be a comprehensive overview procedures, or disease processes, surgical students will new technology. Fellow interesting present topics, in an organized, manner in the form of lecture or small group discussion. RC 240 and Assessment Advanced (3) Diagnosis Subjects include the actions of various bron- chodilators and cardioactive drugs commonly used in respiratory care. Prerequisite: RC 220. RC 221 (W) Advanced Respiratory Pharmacology (2) Prerequisite: RC 191. Advanced Mechanical Ventilation (2) Course will provide students with information to master the knowledge of mechanical ventilation and its application to patients. Skills needed to best "interface" patient and ventilator is discussed; adult and pediatric/neonatal mechanical ventilation are introduced. RC 192 Respiratory Therapy Pharmacology (3) Course is designed to provide students with information about drugs used to treat the cardiopulmonary system. Emphasis is on mechanism of action, indication for, and proper administration of drugs, with particular emphasis on those delivered by Respiratory Care Practitioners. Introduction and discussion of other drugs used in critical care are included. RC 191 Course will provide application of the Course will provide application care. The sciences required in respiratory math skills used in students will review the performing calculations; relate chemistry concepts to clinical care; apply elements of biochemistry; understand physical laws, principles, and associated theories; and have an understanding of certain principles of microbiology as they relate to being a respiratory therapist. Same course as HT 188. RC 188 Survey of Allied Health Sciences: & Physics (5) Chemistry, Microbilogy, Prerequisite: RC 182. This is the final clinical course of the first clinical course of the This is the final respiratory program. Students year, of the clinical to use this time at the are expected their clinical skills, improve sites to polish skills and increase their time management the level and autonomy in their comfort be prepared for clinical setting in order to in the second the advanced clinical courses program year. RC 183 IV (9) Clinical Therapy Respiratory 136 Course Descriptions Prerequisite: SOC110orPSYCH100. attraction andaggression. attitude formationandchange,attribution, Focuses oncognitionandperception, behavior asafunctionofsocialstimuli. An introductiontothestudyofindividual Social Psychology(5) SOC 240 the groupaspectsofhumanbehavior. theories ofsociologywithanemphasison An introductiontothebasicconceptsand Introduction toSociology(5) SOC 110(F,W,Sp) Sociology Coordinator permission. SBM 149.EntrepreneurSucceedProgram(ESP) Prerequisite: CompletionofSBM147,148, basic outlinesleadingtobusinesssuccess. printed planandrelatedgraphsformthe customers, marketsandprofitability.The address relevantbusinessissuessuchas forecast. Thiscomprehensiveplanwill plan, break-evenanalysisandoperating marketing plan,financialproposal,operating executive summary,businessstructure, Administration guidelinesindevelopingyour plan. StudentsfollowFederalSmallBusiness the developmentofyourspecificbusiness Extensive one-on-oneconsultingtoassistin Formal BusinessPlan(5) SBM 299 establishment ofoverseascontracts. capital, customs,duties,useofbrokersand the principlesbehindprocedures.Covers importing/exporting forsmallbusiness,and A basiccourseontheday-to-daybusinessof Businesses (3) Import/Export forSmall SBM 150 Management Small Business Prerequisite: AdmissiontoRCprogram. skill. and/or increasethelearner'sknowledgeand jointly bystudentandinstructortoimprove Independent learningactivitydesigned Therapy Technology(1-5) Individual StudyinRespiratory RC 299(F,W,Sp) have onthepublic.(multiculturalcontent) messages, andtheimpactvariousmedia zation ofmassmedia,thecontentmedia Examines theeconomicandsocialorgani- focusing primarilyontheUnitedStates. production andconsumptionofmassmedia, Takes acriticalapproachtothestudyof Media, PoliticsandSociety(5) SOC 247 Deviant Behavior(5) SOC 271 contemporary humansocieties. religious, andothersystemsof economic, educational,family,political, the effectsofinstitutionalchangein of socialproblemswithspecialemphasison A macro-sociologicalapproachtothestudy Social Problems(5) SOC 270 and socialpolicy.(multiculturalcontent) ethnic inequalitythroughsocialmovements Explores howtoalterpatternsofracialand social progressofdifferentethnicgroups. discriminiation, aswelltheeconomicand country, manifestationsofracismand how immigrantgroupsadapttoanew American contemporarysociety.Focuseson understanding ofraceandethnicrelationsin Builds uponandexpandsthestudents' Race andEthnicRelations(5) SOC 262 and blendedfamilies.(multiculturalcontent) faction, childrearing,divorce,remarriage, mate selection,martialstabilityandsatis- of thesocialpsychologicalfactorsaffecting and alternativefamilyforms.Anexamination standing societalvariationinfamilypatterns The familyasasocialinstitution,under- Sociology oftheFamily(5) SOC 252(F,W,Sp) asking howgender identityisconstructed multidisciplinary categoryofanalysis, Introduces theconceptofgenderas a Sexuality (5) Sociology ofGenderand SOC 287 Prerequisite: SOC110orPSYCH100. and violenceinAmericansociety. mental disorders,substanceabuse,crime critical analysisofsocialtheoryrelatingto developing asociologicalunderstandingand theory andresearch.Emphasisison perspective ofsociologicaldescription, Analysis ofdeviantbehaviorfromthe forms ofsystematicsubordination. understandings ofsexualorientation,and social rolesofmenandwomen, and popularmedia.Topicswillincludethe by thesciences,socialhumanities, will notbeawardedfornativelanguages. placement. Foreignlanguagechallengecredit instructor forinformationconcerning intermediate level.Consultwiththecourse may begrantedtostudentsplacedatthe be madebythecourseinstructor.Credit language trainingatthesecondarylevelwill Placement ofstudentswithpreviousforeign Spanish work insociologyandinstructorpermission. Prerequisite: Completed15credit-hoursofcourse reporting ofaselectedprobleminsociology. Independent observation,analysisand Individual Study(1-5) SOC 299 100. Prerequisite: SOC110orPSYCH100ANTHRO placed byinstructor. Spanish registerfor101.Otherswill be classroom. Studentswithoutprevious discussions insmallgroupswithinthe students takepartinpresentationsand in Spanishisstressedfromthebeginning,as computer-generated exercises.Conversation Grammar drillsarepresentedthrough takes placeinthelanguagelaboratory. Drilling inpronunciationandlanguageusage are coveredinthesequence101,102,103. pronunciation, correctgrammar,andsyntax The foundationsofacceptable Elementary Spanish(5,5,5) SPAN 103(Sp) SPAN 102(F,W,Sp) SPAN 101(F,W,Sp) studying Spanish. like toacquireusefulstudyhabitsfor has littlegrammarbackgroundandwould Spanish. Recommendedforthestudentwho and structureasitpertainstolearning on theirunderstandingofEnglishgrammar rate. Thecourseallowsstudentstobrushup vocabulary andgrammaratanenjoyable 101. ThestudentisintroducedtoSpanish basic conversationalSpanish,priortoSPAN Designed asabeginningintroductionto Basic ConversationalSpanish(5) SPAN 100(varies) Course Descriptions 137 Course offers skills building in time management, study organization, test preparation, textbook mastery and notetaking for students enrolled in 90 level English, Reading, or Math courses. Prerequisite: Assessment at or above READ 92. STDSK 110 (F, W, Sp) College Study Skills (5) Development of techniques for effective study in college. Covers time management, note-taking systems, memory training, textbook analysis, exam preparation and test taking (both objective and essay exams), using the library and writing the research paper. Prerequisite: Assessment into college-level reading or a grade of "C" or higher in READ 93. Supervision and Management SMG 100 The New Supervisor (3) Explores the transition into supervision, attitudes toward the job and boss, supervisor-employee relationship, productivity, human relations, problem solving and delegation, keys to successful supervision, common mistakes to avoid, and self-development. STDSK 81 (F, W, Sp) 81 (F, W, STDSK (1) Management Time helps student manage Self-paced course Student develops and time effectively. time management implements efficient works with text, videotapes plans. Student and lab instructor. STDSK 82 (F, W, Sp) (1) Test-taking Strategies test-taking Student learns successful with text, strategies. Student works lab instructor. audiotapes, videotapes and STDSK 95 (2) Survival Study Skills time Skill building in study habits, management, textbook reading, in developmental notetaking for students English, Math, Reading. * Late starting class. STDSK 98 (F, W, Sp) Essential Study Skills (5) Independent observation, analysis and reporting of a selected problem for advanced students in speech. Prerequisite: Instructor permission. Study Skills STDSK 80 (F, W, Sp) Library Orientation (1) Self-paced course helps student develop basic library skills. Student learns how to approach the library and use its resources effectively for research purposes, and work with text, lab instructor and librarian. Employment Interview Skills (2) Prepares students for an employment interview. Learn how to assess marketable skills and work experience, develop an effective resume and cover letter, prepare for the interview and employ effective communication before, after, and during the interview. Learning activities include a practice job interview with video critique. Not intended for students having completed Speech 150. SPCH 299 (varies) Individual Study in Speech (1-5) Interpersonal Communication (5) Interpersonal Communication the An introduction to understanding practical and theoretical aspects of interpersonal relationships through the application of intra personal information in interpersonal settings. Emphasized areas include gender, family and workplace relationship management. Information focuses on communication climates, resolving conflicts, intimacy and language. (multicultural content) (writing intensive) SPCH 151 (varies) SPCH 120 (varies) SPCH 120 (5) Small Groups Communication process. Learn An introduction to the group stages of a how to manage the different effective group's development. Acquire skills. Learn leadership and followership solving and techniques for quality problem conflict management. SPCH 130 (varies) intermixing of philosophical thought and thought of philosophical intermixing Irish culture, the area of diffusion in cultural the the development of history & politics, Irish thought. The course Irish city, and culture impacts the focuses on how process. communication SPCH 111 (varies) Intercultural Communications (5) This course is dedicated to a pursuit of Irish peoples and culture throughout the ages and their contributions to Irish civilization. Topics in this course will focus on in Multicultural Communication (5) A survey of how culture shapes the communication interaction. Emphasis is on the role of world views, how culture affects the development of value systems, interpersonal relationships, workplace and educational expectations and high and low context communication styles. (multicultural content) SPCH 110 (varies) Public Speaking (5) An introduction to the preparation and delivery of oral presentations in an extemporaneous style. Emphasis is on ethical research, logical analysis, organization of informative presentations and critical analysis. Four to six speaking assignments, plus written examination. SPCH 101 (F, W, Sp) SPCH 100 (F, W, Sp) Fundamentals of Speech Communication (5) A survey of fundamental principles of communication theory. Students are introduced to verbal and nonverbal communication, effective listening, interpersonal communication, small group discussion as well as culture and gender factors in communication. Written assignments, examinations and informal oral presentations are included. Basic Communication Skills (5) Basic Communication course A communication skills-oriented development in emphasizing hands-on skill and public interpersonal, small group communication. Speech SPCH 90 (varies) Prerequisite: SPAN 203 or equivalent class. Prerequisite: SPAN Instructor permission. Readings in Spanish and Latin-American Readings in will be selected by literature. Topics instructor's approval. students, with Variable credit. SPAN 299 (varies) SPAN (1-5) in Spanish Readings Directed 138 Course Descriptions strategies. crisis communicationsandpublicrelations opinion, persuasion,print/broadcastmedia, Topics includecommunicationtheory,public application ofpublicrelationsformanagers. A practicalapproachtotheoryand Public Relations(3) SMG 210 interviews andleadproductivemeetings. communications, conducteffective efficiency, deliverbetteroral communication barriers,increaselistening language effectively,overcome Explores waystouseverbalandnon-verbal Management Communications(3) SMG 201 harmoniously andproductively. can bemotivatedtoworktogether, organizations. Exploreshowpeopleatwork predict andinfluencehumanbehaviorin Examines elementsneededtounderstand, Supervision andGroupBehavior(3) SMG 131 orientation, andindividualdevelopment. on-the-job training,newemployee Topics include:needsassessment,evaluating training andlearningincworkenvironments. Principles andtechniquesthatfacilitate Supervising EmployeeTraining(3) SMG 125 grievances andcomplaints. troublemakers, emotionaloutbursts, work-group proficiency;anddealingwith overcoming attitudeproblemsandimproving techniques forgainingcooperation, performance andbehavior.Explores improving unacceptableemployee Examines supervisoryapproachesto Supervising theProblemEmployee(3) SMG 120 process, counselinganddiscipline. group dynamics,leadershipstyles,appraisal supervisors. Topicsinclude:motivation, functions, andskillsrequiredofall A studyoffundamentalpractices,roles, Essentials ofSupervision(3) SMG 101 selected casestudies. arbitration, disciplinaryprocedures,and managers, grievances,mediationand Examines contractadministrationfor current laborlawandrecentNLRBrulings. Survey ofthecollectivebargainingprocess, Management andLaborRelations(3) SMG 222 human behavior. understand attitudesandvaluesaffecting improve interpersonalcommunications, and ways todevelopgreaterself-awareness, and achieveorganizationalgoals.Explores personal growthneeds,increaseproductivity unlock internalforcesofmotivation,satisfy for managerswhowanttohelpemployees A studyofhumanrelationsskillsnecessary Motivation andProductivity(3) SMG 264 spirit ofteamworkprevails. which employeemotivationishighanda these leaderscreateaworkenvironmentin and qualityperformance.Examineshow levels ofmorale,self-esteem,productivity managers wholeadsubordinatestohigher A studyoftechniques,skills,andqualities Leadership Dynamics(3) SMG 261 awareness. functions andorganizationalquality interpersonal relationships,work-group designed toimproveindividualeffectiveness, behavioral scienceandmanagementmethods and jobsatisfaction.Reviewscurrent effectively toincreaseemployeeproductivity Examines techniquesofmanagingmore Managerial Excellence(3) SMG 260 study oftheemployeegrievanceprocess. principles ofagencyandemployment,a Includes asurveyofcontractlaw,the and executivepowersofregulatoryagencies. business law.Examineslegislative,judicial Introduction tothenatureandsourcesof Supervisor andtheLaw(3) SMG 255 guidelines. appraisal, andfederalemploymentlaws include: jobanalysis,recruiting,performance supervisors andthepersonnelstaff.Topics functions andtherelationshipbetween Examines typicalpersonnelmanagement Human ResourceManagement(3) SMG 250 formal managementtraining. managers andindividualswithaminimumof society. Developedforexperienced managers tosubordinates,customersand and functionstheresponsibilitiesof the interactionsamongmanagementskills organization anditsexternalenvironment, organizations andpeopletheymanage,the relationship betweenmanagersandthe achieved. Topicsincludetheinseparable as howtomaintainthatlevelonceitis high performancefromsubordinates,aswell This courseemphasizeshowtomotivate Managing forHighPerformance(3) SMG 270 management. dynamics, power,politicsandstress change, behaviormodification,group Topics include:perceptions,managing behavior intheorganizationalenvironment. processes thataffectindividualandgroup A studyofsocialandpsychological Organizational Behavior(3) SMG 265 See OfficeEducation,page126–127. Word Processing See OfficeEducation,page126. Typing audience. to thespecializedneedsofaparticular circumstances callingforprogramstailored employee trainingprogramsandother faculty member.Mayalsobeusedin study underthedirectionofanappropriate For advancedstudentsinterestedinfurther Projects (1-5) Individual Study&Special SMG 299 workforce amoreproductiveone. practices involvedinmakingadiverse supervisory issues,laws,policiesand and theworkplace.Coursealsoexamines traditions andvaluesinAmericansociety the diversityofages,languages,cultures, learn tobetterappreciateandbenefitfrom This courseexploreshowsupervisorscan Valuing CulturalDiversity(3) SMG 275 Information and Resources 139 Laurie Jinkins John Lantz Fred Whang, Vice Chair Board members (in alphabetical order) Top row: David Edwards, Chair Bottom row: Marilyn Walton TCC President Dr. Pamela Transue Board of Trustees Community College District 22 140 Information and Resources President College FacultyandAdministrativeStaff Vice PresidentofAcademicandStudentAffairs Executive DirectorofExternalRelations andTCCFoundation Vice PresidentofCollegeServices Associate DeanforInstitutionalEffectiveness Dean forArts,Humanities,andSocialSciences Dean forSciences Associate VicePresidentofStudentServices Dean forLearningResources,ABE,ESL,andDistance Dean forBusinessandContinuingEducation Dean forHealth,JusticeandHumanServices Dean forWorkforceEducation Director ofInformationSystems Associate VicePresidentofHumanResources Director ofCommunityandGovernment Relations Manager ofInternalControlandRiskManagement Director ofFacilities Director ofCentralandAuxiliaryServices Director ofMarketing Director ofInstitutionalResearchandPlanning Director ofFinancialServices ...... Director ofAthletics Associate DeanforStudentServicesandRegistration Director ofFinancialAid Director ofCenterforMulti-EthnicandCulturalAffairs,OutreachServicesTutoring Coordinator forWorkerRetraining Coordinator ofWorkFirst Director ofGigHarbor/PeninsulaCollegeCenter Coordinator ofLifelongEducation Coordinator ofContractTraining Registrar Manager ofTheChildrensCenter Manager ofAdmissions Director ofTalentSearch Director ofStudentSupportServicesProgramsandAdvising/RunningStart Director ofStudentProgramsandEmploymentDevelopment Director ofInternationalStudentServicesandPrograms Director ofFreshStartandStudentDevelopment Director ofTCCDowntownCenter Coordinator ofBusinessDivision Associate DirectorofFacilities,CapitalProjectsManagement ...... Complete staff listingavailableonlineat tcc.ctc.edu/directory.asp ...... Pa ...... Ricardo ...... Dr. PamelaJ.Transue ...... Mary AnnBrummond Yowsa Gwalamubisi Marlene S.Bosanko Kathi Hiyane-Brown Jacy L.Christensen Dr. AprilRetherford Jeanette Lunceford Frederick W.Davis Dr. TrishGeringer Annette Hayward Shane J.Conway Kimberle Matison LindaWashburn . Mary E.McCabe ...... Susan Cristao ...Susan Dorene Novotny Deborah Walker Wayne Williams Dolores Haugen .... Martin Harding Daniel E.Small Susan Mitchell Becky Morgan .JulieBurton .. Stan Topolski Leyva-Puebla Olga Larrison Hope Blakely Steve Brown Patty Nelson Sally Perkins Gary Sigmen Sandy Plann Paula Norby Steven Ellis Clint Steele Mike Flodin t Brown vacant vacant Information and Resources 141 Southwest Texas State University; Dr. Elizabeth Fortenbery Anthropology B.A., University of Tennessee; M.A., Ph.D., University of Washington Don Foster Accounting B.B.A., B.A.A.S., C.P.A. Ysidro Esparza Counselor B.A., M.S.W., Eastern Washington University Carol Evenhuis ABE Education Coordinator, Pierce County Jail B.S., So. Dakota State University; M.Ed., University of Washington-Tacoma Gregory Ferencko Mathematics B.A., Rutgers University; M.S., Western Washington University Mike Flodin Dean for Sciences B.A., Pacific Lutheran University; M.S., University of Washington Wendy Flores Educational Planner, Fresh Start B.A., University of Alaska; M.S., Alaska Pacific University Linda Ford English B.A., M.A., Western Washington University Susan M. Ford Program Chair, Nursing A.D.N., Shoreline Community College; B.S., B.S.N., M.N., University of Washington Dr. Susan Kay Donaldson Dr. Susan Language as a Second English College; B.A., Knox of Illinois M.A., Ph.D., University Duchin Dr. Brian R. History Department Chair, of Washington; B.A., M.A., University of Texas Ph.D., University Dr. Linda E. Duchin Anthropology B.A., Ph.D., University of Washington Dr. Terry Scott Earle English University; B.A., M.A., Western Kentucky Ph.D., University of Arkansas Steven Ellis Director, TCC Downtown Center B.A., Virginia State University Dr. David Endicott English B.A., Western Illinois University; M.A., Southern Illinois University; Ph.D., Ball State University Psychology Dr. James C. Danos Information Technology B.S.M.E., M.S.M.E., Louisiana State University; Ph.D., Texas A & M University Frederick W. Davis Director of Center for Multi-Ethnic Cultural Affairs, Outreach Services and Tutoring B.A., Colorado State University; M.A., San Francisco State University Dr. Pamela G. Costa Psychology B.A., M.A., Loyola Marymount University; M.S., Ph.D., Pacific Graduate School of Rich Costanzo Site Manager, IT Certification Center B.S., University of Puget Sound Charlie Crawford Library Unit Manager B.A., M.L.S., University of Washington Susan Cristao Coordinator, Lifelong Education A.A.S., College of Dupage; B.A., Trinity College; M.S.Ed., Northern Illinois University Mathematics College; A.A., Yakima Valley Community University; B.A.Ed., Central Washington M.S., Western Washington University Jan Coad, RRT Program Chair, Respiratory Therapy A.S., Santa Fe Community College; B.S., M.S., University of Central Arkansas Peggy Coleman Radiological Sciences Shane J. Conway Vice President, College Services B.S., M.S., Northern Illinois University Greg Carter, RRT Greg Carter, Respiratory Therapy University B.S., Pacific Lutheran Mary F. Chen-Johnson English B.A., Cornell University; School of Law; J.D., University of Pittsburgh M.F.A., University of Montana Jacy L. Christensen Coordinator, Worker Retraining B.A., Central Washington University Karen Clark James Carroll James Services Program Chair, Human Program University; Washington B.A., Eastern University M.A., Gonzaga Director, Central and Auxiliary Services A.A.S., Oregon Institute of Technology; A.A.S., Portland Community College Director, Accounting and Financial Services B.A., Washington State University Julie Burton Mary Ann Brummond Stephen Brown Department Chair, Physical Education; Director, Athletics B.A., M.Ed., Gonzaga University Pat Brown Dean for Health, Justice, and Human Services B.S.N., University of Maryland; M.S.N., University of Texas-San Antonio Counselor, Career Center; Coordinator, SPRUCE Program B.A., Gonzaga University; M.A., Pacific Lutheran University Katherine Brown Allen Braden English B.A., Central Washington University; M.A., M.F.A., McNeese State University Erika A. Bowles Program Chair, Information Technology Programs B.S., University of Washington; M.S.A., George Washington University Dean for Arts, Humanities, and Social Sciences A.A., Diablo Community College, California; B.A., M.A., San Jose State University Nursing B.S.N., University of Texas, Austin; M.S.N., University of Texas, El Paso Marlene S. Bosanko Jeff Bonnell Hope Blakely Management Manager, Control and Risk B.S., University of Maryland; M.B.A., St. Martin's College; C.P.A. Marit Berg Department Chair, Art B.A., San Diego State University; M.F.A., Washington State University Ingrid Bentzen, RHIA, CCS Ingrid Bentzen, Technology Program Chair, Health Information B.A., University of Puget Sound; M.Ed., University of Washington; EMT and CCS Certification Robert W. Austin Lab Assisted Learning Coordinator, Computer of Washington B.A., M.A., University Jacqueline Armstrong Jacqueline Women Center for Corrections Washington University State B.A., Washington 142 Information and Resources B.A., UniversityofWashington-Tacoma Supervisor, Assessment/SupportService Kathryn Held Manager, Admissions Annette Hayward B.A., UniversityofPugetSound Director, FreshStart&StudentDevelopment Dolores Haugen B.A., M.A.,UniversityofMontana Director ofInstitutionalResearch&Planning Martin Harding M.S., UniversityofWashington A.B., SmithCollege; Mathematics Anne Hafer M.A., UniversityofColorado B.A., StanfordUniversity; Department Chair,Biology Sue Habeck B.A., M.A.,SeattleUniversity Educational Planner,FreshStart Melody Griggs M.B.A., UniversityofPugetSound B.S., UniversityofWashington; Organizational LeadershipProgram Program Chair,BusinessManagementand Christopher Gilbert Ed.D., SeattleUniversity M.A.L.S., ReedCollege; B.A., PortlandStateUniversity; Associate VicePresident,StudentServices Dr. Patricia(Trish)Geringer B.S.M.E., UniversityofWashington M.S., UniversityofIdaho; B.S., UniversityofPugetSound; Physics Coordinator, EngineeringTransferProgram; Kenneth L.Gentili M.A.Ed., PacificLutheranUniversity B.A.Ed., EasternWashingtonUniversity; Department Chair,ReadingandStudySkills Lois H.Garrison B.A., UniversityofWashington A.A.S., TacomaCommunityCollege; Educational Planner Linda Garcia M.A., WesternWashingtonUniversity B.A., WheatonCollege(Illinois); Mathematics Rhoda H.Gage D.A., IdahoStateUniversity M.A. FresnoStateUniversity; B.A., FresnoPacificCollege; English Dr. KennethR.Fox C.P.A., StateofWashington J.D., SeattleUniversityLawSchool; B.A., M.B.A.,UniversityofPugetSound; Business Law/Accounting Leonard Heritage B.S., OregonInstituteofTechnology Program Chair,DiagnosticMedicalSonography Rachel Kendoll,RVT Ph.D., BowlingGreenStateUniversity B.A., M.S.,UniversityofToledo; Mathematics John Kellermeier M.B.A., UniversityofWashington B.A., St.Martin'sCollege; Economics, Business Timothy R.Keely B.S., M.S.,WashingtonStateUniversity Biology, Zoology,Zophysiology Timothy B.Keely M.A., PacificLutheranUniversity B.A., UniversityofPugetSound Coordinator, FreshStart Jenny Jesch M.S., UniversityofCalifornia,Berkeley B.S., PacificLutheranUniversity; Chemistry andPhysics Philip L.Hunter Ed.D., GeorgeWashingtonUniversity M.Ed., AlabamaA&MUniversity; B.A, SUNYatPotsdam; Counseling Center Dr. DavidW.Howard A.B., M.A.,UniversityofMissouri Journalism J. DavidHolman B.A., UniversityofPugetSound A.A., TacomaCommunityCollege; Administration ofLawandJustice Samuel W.Holden B.S. andM.B.A.,PacificLutheranUniversity Grants Coordinator Erin Hoiland M.A., UniversityofIowa A.B., GrinnellCollege; Student Affairs Vice President,Academicand Kathi Hiyane-Brown Ph.D., UniversityofCalifornia-SantaBarbara B.A., ColoradoCollege; Earth Sciences Dr. RalphB.Hitz B.A., M.A.,EasternWashingtonUniversity A.A., SpokaneFallsCommunityCollege; English Robert Hijiya Pamela Lee J.D., UniversityofMaineSchoolLaw. B.A., UniversityofNewHampshire; Administration ofLawandJustice E. ErikLaurentz A.A., PierceCollege Manager, Children'sCenter Olga Larrison M.A., CaliforniaStateUniversityatSacramento B.A., WheatonCollege; Department Chair,English Tamara Kuzmenkov M.S., UniversityofMinnesota B.S., OhioNorthernUniversity; Physics/Engineering Keith King M.A., SeattleUniversity B.A., UniversityofWashington; Philosophy John Kinerk B.A., M.A.T.,UniversityofWashington English Debbie Kinerk M.S., UniversityofOregon B.S., CentralWashingtonUniversity; Mathematics Scott MacDonald B.A., WesternWashingtonStateCollege B.A., UniversityofPugetSound; Coordinator, BusinessDivision Jeanette Lunceford M.Ed., SeattleUniversity B.A., UniversityofWashington; Adult BasicEducation Mary Ludwig B.A., M.A.,UniversityofWashington A.A.S., TacomaCommunityCollege; Spanish Montserrat AlvearLinkletter Ph.D., UniversityofWashington M.A., NewMexicoStateUniversity; B.A., M.A.,PekingUniversity; History Dr. YiLi M.A., AzusaPacificUniversity B.A., SouthernCaliforniaCollege; Director, StudentSupportServicesandTutoring Ricardo Leyva-Puebla TESL, B.A.,M.A.,PortlandStateUniversity English Lydia LynnLewellen M.Ed., ColoradoStateUniversity B.S.Ed., WeberStateUniversity; A.A.S., TacomaCommunityCollege; Director ofClinicalEducation,RadiologicSciences Information and Resources 143 State University Stephen Sandweiss Political Science B.A., University of Michigan; M.A., San Francisco State University Library B.A., Randolph-Macon College; M.A., English Wake Forest University; M.L.S., University of North Carolina at Chapel Hill Candyce Rennegarbe ABE Learning Disabilities Specialist B.A., Concordia Teachers College; M.A., San Francisco State University Dr. April Retherford Dean for Enrollment and Financial Aid Services B.A., M.P.A., University of Kansas; Ed.D., Oregon State University Larry Richardson Director, Inmate Education Center B.S., Purdue University; M.S.Ed., University of Southern California K. N. Rogers History B.A., M.A., Virginia Polytechnic Institute and Darlene K. Rompogren English as a Second Language B.A., M.A., M.A.T., University of Washington John Sandin Reading and Study Skills A.A., Lakewood Community College; B.A., Augsburg College; M.A., New Mexico State University Aura Pernell Learning Center, Coordinator/Instructor, Women Center for Corrections Washington of Panama B.A., University Barbara Peterson Human Services Tacoma Community College; A.T.A., A.A.S., Washington University; B.A., Western M.A., M.S., Chapman University Sandra Plann Director, International Student Services and Programs B.A., Whittier College; Los Angeles M.A., University of California, Nikki Poppen Foreign Language Department Chair, Speech and B.A., Pacific Lutheran University; M.A., University of Oregon Sheila Powers Coordinator, Families That Work B.A., Siena Heights College; M.A., Jesuit School of Theology at Berkeley Kendall M. Reid Dr. Samuel W. Orchard Chemistry B.Sc., M.Sc., University of Natal, S. Africa; Ph.D., Cambridge University Muriel Parrish Assistant Director, Financial Aid B.A., University of Nevada, Reno Sally Perkins Marketing Director B.A., University of Wisconsin-Madison Nancy A. Novak Nursing A.D.N., Columbia Basin College; B.S., Arizona State University; M.N., University of Washington Dorene Novotny Associate Vice President of Human Resources B.S., Northeast Missouri State University Janet D. Olejar Administration of Law and Justice/Paralegal Program B.A., B.Ed., Seattle University; J.D., University of Washington Patty Nelson Director of Student Programs & Activities and Em- ployment Development B.A., Western Washington University; M.A., Chapman University Kim Nichols Rzeszewicz Nursing B.S.N., University of Washington; M.S.N., University of Alaska, Anchorage Paula Norby Dean for Workforce Education B.A., University of Montana; M.S., Central Washington University Theophilus W. Mungen, Jr. Theophilus Counseling College; A.A., Volusia Community B.S., Florida A & M University; M.S., University of Idaho Dr. Karen Munson Program Program Chair, Office Professional Certified Professional Secretary University; B.S., M.S., Montana State Ed.D., Walden University Diane Nason Counselor B.A., Barat College; M.S., University of Wisconsin Dr. Darlean Mosher Dr. Darlean Programs Services and Student International University; Central B.A., Indiana Illinois University; M.A., Eastern Illinois University Ph.D., Southern Valerie Morgan-Krick Mathematics B.A., M.A., Gonzaga University Becky Morgan Director, Gig Harbor Peninsula Center B.S.N., M.Ed., University of Arizona Michael A. Mixdorf Radiologic Sciences A.S., B.S., M.Ed., University of Nevada - Las Vegas Susan Mitchell Associate Dean, Institutional Effectiveness B.A., M.A., Washington State University; M.P.A., Pacific Lutheran University Health Information Technology B.A., Carroll College; M.B.A., University of Nevada at Las Vegas Marion Miller, RHIA, CCS John Miller Nursing A.D.N., Yakima Valley Community College; B.S.N., University of San Francisco; M.N., University of Washington Dr. Ruth Ann Mikels Biology B.S., University of Puget Sound; Ph.D., University of Washington Biology B.A., West Virginia University; M.D., Vanderbilt University Medical School Washington Corrections Center for Women B.A., Butler University; M.A., University of Texas Dr. Sharon Michael Karen Meyer Rochelle Meenach-Ligrano Nursing B.S., University of Washington; M.S.N., A.R.N.P., Gonzaga University Jerome M. McCourt English A.B., Georgetown University; M.A., University of Washington Mary McCabe Registrar College A.A.S., Tacoma Community Kimberle A. Matison Director, Financial Aid Services B.A., University of Washington Tim Mason Information Technology Illinois University; B.S., Southern M.S., Troy State University Richard Mahaffey Richard Art San Francisco; College of A.A., City State University at San Jose; B.A., California of Puget Sound M.F.A., University 144 Information and Resources M.S., SyracuseUniversity B.S., WesternOregonStateCollege; Gig HarborPeninsulaCenter Coordinator, StudentServicesat Andra Spencer B.A., M.A.,TheEvergreenStateCollege TCC BridgeProgram Rudy Sookbirsingh B.A., M.A.,WashingtonStateUniversity Speech Debbie AyresSonandr‚ MICP, IngallsMemorialHospital Health Services Program Chair,EmergencyMedicaland Michael Smith M.A., UniversityofNevada-Reno B.A., WashingtonStateUniversity; Government Relations Director ofCommunityand Daniel E.Small M.S., DePaulUniversity B.S., WillametteUniversity; Sociology Chance Sims M.A., WashingtonStateUniversity B.A., UniversityofWashington; Director ofInformationSystems Gary E.Sigmen M.S., UniversityofOregon B.A., CentralWashingtonUniversity; Public Relations Diane Schuirman-Hagedorn Library Helen SueSchub M.B.A., CityUniversity B.A., WashingtonStateUniversity; Office ProfessionalProgram Susan Schneider Ph.D., StateUniversityofNewYork/Buffalo B.S., SeattleUniversity; Department Chair,PhysicalSciences;Chemistry Dr. BobSchmitt M.Ed., CityUniversity B.A., WesternWashingtonUniversity; Washington CorrectionsCenterforWomen Sherry Schmidt M.Ed., WeberStateUniversity B.S., BoiseStateUniversity; Physical Education Suzan Schenk M.A., M.A.Ed.,PacificLutheranUniversity B.A., WittenbergUniversity; Counselor forProfessional/TechnicalStudents Peggy Sargeant M.L.S., UniversityofWashington B.A., WesternWashingtonStateCollege; Library Rebeccah L.Sproat D.M.A., Universityof Washington M.M., IndianaUniversity; B.A., MansfieldUniversity; Department Chair,Music Dr. DianneVars M.Ed., LesleyCollege B.Ed., PacificLutheranUniversity; Information Technology Mark VanBeek M.A., St.Mary'sCollege M.S.T., PortlandStateUniversity; B.S., OregonStateUniversity; Washington CorrectionsCenterforWomen Mary J.Trukositz M.A., Ph.D.,OhioStateUniversity B.A., UniversityofWashington; President Dr. PamelaJ.Transue B.S., M.S.,CaliforniaStatePolytechnic Mathematics Trung G.Tran M.P.A., TheEvergreenStateCollege B.A., SeattleUniversity; Human ServiceProgram Michael J.Towey M.A., WesternWashingtonUniversity B.A., WesternWashingtonUniversity; Coordinator, WorkFirstProgram Stan Topolski B.S., M.S.,UniversityofWisconsin,Madison Mathematics Robert Tan M.Ed., UniversityofWashington B.S., UniversityofPortland Educational Planner,FreshStart Marla Tam-Hoy M.A., UniversityofWashington B.A., EasternWashingtonUniversity; Sociology Department Chair,BehavioralSciences; Bruce V.Sydow M.L.I.S., UniversityofWashington B.A., TheEvergreenStateCollege; A.A.S., PierceCollege; Library Syd O.Sullivan B.A. andM.A., A.A., VenturaCollege; English asaSecondLanguage Brandy Stricker B.R.E., PrairieBibleCollege,Alberta,Canada Director, FacilitiesandGrounds Clint Steele University, Pomona California StateUniversitySacramento; M.S., CentralWashingtonUniversity B.A., WashingtonStateUniversity; Professional DevelopmentCoordinator Alan Waugh M.A., SouthernIllinoisUniversityatCarbondale B.A., NorthernIllinoisUniversity; English asaSecondLanguage Gail Watters B.A., M.P.A.,TheEvergreenStateCollege A.A.S., TacomaCommunityCollege; Coordinator, TCCBridgeProgram Kim Washington M.Ed., SeattleUniversity B.A., WashingtonStateUniversity Coordinator, AdultBasicSkillsProgram Kim Ward M.S., InstituteofChemicalTechnology,China M.S., CaliforniaStateUniversity,Northridge; Information Technology Qi Wang B.A., M.A.,Ph.D.,UniversityofWashington A.A., FullertonCommunityCollege; English Dr. RichardP.Wakefield M.S., UniversityofIdaho B.S., UniversityofWashington; A.A., ClarkCollege; Department Chair,Mathematics Edward A.Zimmerman and HealthServices/Paramedic Clinical Coordinator/Instructor,EmergencyMedical Sam Yount M.A., PacificLutheranUniversity B.A., UniversityofMaryland; Washington CorrectionsCenterforWomen Silva Wright M.S.E., UniversityofPennsylvania-Moore M.B.A., WhartonBusinessSchool, B.S., MorganStateCollege; Continuing Education Dean forBusinessDivisionand M. WayneWilliams Ph.D., MichiganStateUniversity M.B.A., UniversityofWashington; Program Chair,GlobalBusiness Dr. JamesL.Wiek Certificate, HealthInformationManagement, B.A., EasternWashingtonUniversity; Health InformationManagement Rich Weidman,RHIA,CCS-P M.A., WesternWashingtonUniversity B.A., CentralWashingtonUniversity; Physical Education Norman Webstad School ofEngineering University ofPennsylvania; Seattle University Information and Resources 145 15 39-40 38-51 29-37 23-86 40-50 24-25 79-138 27, 96-97 59, 97-98 ...... 16 4-5, 24-25 . 24, 77-78 ...... 3 Lab ...... s ...... 95 ...... 95 ...... 5, 25 ...... 39 ...... 51 ...... 27 Values ...... 96 ...... 26 Services ...... 30 ...... 58 ...... 35 ...... 36 TCC ...... ducation ...... 40 ...... Course TCC ...... 34 Training ...... 13 Sonography ...... 18 ...... 16 ...... 40 Quarters ...... 25 ...... 33 ...... Courses t/Graduation ...... 33 ...... 148 (Buckley Amendment) Based Upon Disability Communities Communication Skills Courses College Mission, Vision and College Mission, Computed Tomography (CAL) Computer Assisted Learning Computer Science Courses Computer User Specialist Computer User Confidential Records Credits Transferred to Course Repeats Course Withdrawal Credit Hours and Credits Transferred from D Deficiency, Academic Definitions Degrees and Graduation ...... Degrees, Multiple Degrees, Application for Developmental Education Disabled Students, Access Discrimination, Sex and College Policies Commencemen Diagnostic Medical Continuing Professional E Condensed Format Courses Contract/Customized Services Coordinated Studies/Learning Counseling Center Convenience Store Course Audit Course Descriptions Distance Learning Courses Distribution Requirements Downtown Business Downtown Center 92-93 93-94 48-49 49-50 50-51 ...... 54-55, 82 ...... 25 ...... 57 Inside Back Cover and ...... 20 ...... 54 Arts: General ...... 56 Studies Degree ...... 35 ...... 92 ...... 95 ...... 16 ...... 17 ...... 139 ...... 33 ...... 58 ...... 18 ...... 93 ...... 5 ...... 33 ...... 16 ...... 152 ...... 27 ...... 16 ...... 17 ...... 36 ...... 20 (MECA) (formerly Lifelong Education) Reserve Academy Certificate Program Management Organizational Leadership Applications Center for Multi-Ethnic/Cultural Affairs Center for Personal Enrichment Career Center Campus Parking Change of Grade Cheating Chemistry Courses Children's' Center Clubs and Organizations College Bookstore C Campus Guide Campus Map Basic Law Enforcement B Bridge Program Buckley Amendment Board of Trustees Bookkeeping Systems Bookstore Botany Courses Business Administration and Business Management and Business Courses Business Labs Biology Courses Astronomy Courses Athletics Audits, Course Automated Accounting Associate in General Associate in Technical Associate in Awards, Scholastic Honors Awards, Scholastic Honors 34-35 34-35 88-92 42-43 44-45 41-42 30-31 23, 86 ...40-43 149-150 124-126 ...... 8 ...... 16 ...... 87 63, 109-111 55-57, 83-86 ...... 24 Degree ...47-48 ...... 33 ...... Inside Front Cover Inside Front Students ...... students ...... 70-71, Courses ...... 8 ...... 31 ...... 87 ...... 15 Science Degree Credit ...... 34 ...... 140 ...... 82 ...... 37 Completion ment ...... 13 Procedures

...... 4 Justice ...... 9 ...... 35 ...... 8 ...... 27

...... 9

Academic Suspension Policy and Law and Option A ...... Option B (Transfer Degree) Examinations and see Health Technology Academic Calendar Academic Deficiency Academic Forgiveness Policy Academic Probation and A Index Academic Review Accounting Courses Accreditation Access Services, disabled Adding a Class Administration of Articulation Agree Art Gallery Appeal Procedures Application Procedures Art Courses Administrative Staff Admissions Admission of International Associate in Applied Sciences Associate in Arts and Adult Basic Education Associate of Science Adult High School Assessment Associate Degree Nursing Adult Learning Center Advanced Placement An Equal Opportunity Employer/Educator ... 36 Anthropology Courses Application Form AIDS Policy Allied Health Core Courses, Advising American Sign Language 146 Information and Resources Grades andGrade Grades andAcademic Government, Student Global Business Gig HarborPeninsulaCenter Geology Courses German Geography Courses General EducationDevelopment G Frequently CalledNumbers Fresh Start French Courses Food Court Financial Assistance Financial Aid Faculty Members F Education Courses Economics Courses E Dual Credit/TechPrep Dropping aClass Drama Courses Fees, SpecialandOther English Composition Engineering Courses Employment Student Employment SecurityService Emergency Medicaland Electronic/Wireless Security Educational Paraprofessional Environmental Science Enrollment English asa English Literature (GED) Courses Health Services Second Language ...... 109 ...... 18 ...... 8, 22 8, ...... 11 ...... 107 ...... 98 ...... 13 ...... Courses ...... 107 ...... Point ...... 107 ...... 98 ...... Courses ...... 11 ...... 17 ...... 20 ...... Courses ...... 31 ...... Polices Courses ...... 32 ...... Costs ...... 6 ...... 4, 24 4, ...... 17 ...... 60-61, 100-101 ...... 10 ...... 25, 73,99 107-108 141-144 101-102 104-105 102-104 105-106 106-107 61, 108 60, 100 99-100 32-35 7-13 Intramural Activities International StudentServices International StudentAdmissions Intercollegiate Athletics Instructional Programs Instructional Services Law EnforcementReserve Late Registration L Jump StartCourses Journalism Courses Job AssistanceCenter Japanese Courses J Information TechnologyCertification Information Technology Information Directory Incomplete Grade ID Cards I Health Technology Health Information Handbook, Student H Graduation Grades, Changeof Human Development Housing Information Horticulture (seeBotany) Honors, Scholastic Home andFamilyLife History Courses High SchoolCompletion High SchoolCompletion Humanities Cou Human Services Center (ITCC) Technology Education Courses ...... 18 ...... 51 ...... rses ...... Program ...... 5 ...... 12 ...... 33 ...... 119 ...... 33 ...... Courses ...... 18 ...... 27 ...... 120 ...... 20 ...... 18 ...... Instruction ...... 15 ...... 151 ...... 17 ...... 24 ...... Courses ...... 20 ...... Courses Academy ...... 64-66, 117-119 62-63, 108-109 63-64, 115-116 ...... 17 ...... 112 ...... 63, 109-111 ...... 8 ...... 93 ...... 56 ...... 113-114 112-113 114-115 116-117 21-28 50-51 Listening/Language Lab Lifelong Education Library Services Library ScienceCourses Learning Labs Map (Campus) Magnetic ResonanceImaging Management, Certificate M Nursing, Associate Nursing, CertifiedAssistant Office Education Oceanography Courses O Non-Resident Student Non-Degree SeekingStatus Non-Credit ClassRefunds Non-Credit Classes-Personal Newspaper, Student Network Administratorand N Music Courses Museum/Gallery Operations Multiple Degrees Multi-Media Services .. Multi-Ethnic/Cultural Affairs(MECA) Men's Services Medical Transcriptionist Medical OfficeProfessional Medical ImagingCourses Medical BillingCertificate Media Services Math: TechnicalCourses Math Lab Mathematics Courses Orientation Office Professional (see CenterforPers (see ResidenceClassification) Enrichment Hardware Support ...... 28 ...... 9 ...... 17 ...... 15 ...... 15 ...... 40 ...... Courses Degree Program ...... 20 ...... 15 ...... 66 ...... 126 ...... onal Enrichme ...... 15 ...... 120 ...... 69 ...... 68 ...... 123 ...... 122 ...... 11 ...... 68 ...... 30 ...... 69 ...... Inside BackCover ...... 77 ...... 121 ...... 70-71, 124-126 ...... 10 ...... t ..25 .... nt) 121-122 123-124 126-127 ....16 ...... 12, 25 27-28 69-70 71-72 Information and Resources 147 34-35 76-77 ...... 1-6 ...... 13 5, 24-25 137-138 ...... 22 ...... 3 ...... 64 ...... 64 ...... 30 ...... 17 ...... 8 course ...... 71 ...... Overview (Transfer) Values ...... 10 Schools ...... Services ...... 5 ...... 11 ...... 139 ...... 22 Technology) Technology) ...... 17 ...... 22 ...... 77 Programs ...... 10 ...... 18 ...... 15 Waivers ...... 28 ...... 30 ...... 13 Management Course Management Reservist Services (see Professional/Technical) (see Information Board of Trustees (see Information (see Office Professional) Supervision and Supervision Academic Suspension, Tacoma Mall Campus TCC Downtown TCC Foundation TCC Mission, Visions and Transcripts Transcripts from Other U University Level Education V Veterans, Active Duty Military and Vocational Program Admission W Wait lists Web Developer T College Tacoma Community Tacoma Community College Transfer Information Transfer Programs TRIO Student Support Tuition and Fees Tuition and Fee Tutoring Center Typing Courses (see Office Professional) . 126 Web Graphics WorkFirst Program Writing Center Women's Programs Word Processing Worker Retraining Withdrawal from the College/a 19-20 36-37 16-18 50-51 10-11 12-13 ...... 16 72, 126 72, 126 ...... 10 136-137 ...... 136 ...... 33 (SOC) .... 31 ...... 20 ...... 75-76, 134-136 Courses Program ...24-25 ...... Disabilities ...... 18 ...... 36 ...... 8 Fee Waiver ...... 35 ...... Awards Activities ...... 17 ...... 20 ...... 137 Office ...... 20 ...... 33 Responsibilities Policy ...... 18 ...... 136 Organizations ...... 13 ...... 10 ...... 37 ...... 137 ...... 20 Professional) Professional) ...... 22 ...... 10 ...... 11 ...... 10 ...... (S.T.A.G.E.) (see Office Academic Suspension (see Office (see Office Student Access to Growth & Earning Student Rights and SPRUCE Program Student Clubs and Speech Courses Student Employment Student Government Student Handbook Student Newspaper Student Programs and Special Fees Small Business Management Sociology Courses Spanish Courses Small Business Development Student Services Study Skills Courses Substance Abuse Secretarial Office Skills Re-enrollment Following Re-enrollment Senior Citizen Tuition and Receptionist-Clerk Services for Students with Servicemen's Opportunity College Sexual Harassment Safety and Security S Satisfactory/Unsatisfactory Grade Schedule Changes Scholarships Scholastic Honors and Running Start Refunds . Procedures Registration Repeating a Course Residency Respiratory Therapy ...... Running Start Admissions 8, 52 34-35 41-42 30-32 52-78 89, 91 12, 25 ...... 53 133-134 128-129 129-130 127-128 25, 73, 99 73-74, 127 ...... 74-75, 130-132 ...... 28 ...... 128 ...... 51 ...... 129 ...... 129 ...... 36 ...... 30 ...... 34 Center ...... 100 ...... 130 Degree ...... 133 ...... 129 Courses ...... Assessments ...... 12 ...... Courses ...... 56 ...... 18 Program Non-Activity Courses Professional Courses Technology Program Courses Paraprofessional) Health Services) Program Admissions (see Non-Credit) Reading Courses Readmission Real Estate R Radiologic Sciences Quarter, Definition of Reading and Writing Q Physical Education Policy Appeals Physical Education Courses Physical Education Physical Science Courses Physics Courses Political Science Pregnancy Policy-Radiologic Paralegal and Art 246) Photography (see Art 146 Paramedic (see Emergency and Paramedic (see Paraeducator, (see Educational Paraeducator, Pacific Rim Studies Rim Studies Pacific P Probation, Academic Professional/Technical President's Medal Awards Prior Learning Parking Personal Enrichment Courses Pharmacy Technician Philosophy Courses Professional/Technical Program Chart Professional/Technical Programs Psychology Courses 148 Information and Resources Accredited: Definitions Deficiency: Curriculum (PluralCurriculaor Credit/Quarter CreditHour: Counselor: Commencement: Audit: Advisor: Direct Transfer: Degree: Takeaclasswithoutreceivingcredit. Adiplomaawardedbythecollege specific degree. a groupofcoursesrequiredfor courses offeredbythecollege.Also, Curriculums): nature. problems ofanacademicorpersonal and whoassistsstudentshave who hasspecialtraininginguidance universities. accepted byothercollegesand Indicates thatcourseworkis regional accreditingagencies. minimum standardsestablishedby degree. or credithoursmustbeearnedfora hour. Aspecifiednumberofcredits required toearnonecreditor of attendanceeachweekare however, twoorthreeclockhours such aslaboratorycourses, quarter (11weeks).Insomecases each weekforaperiodofone for oneclockhourofattendance Ordinarily, onecredithourisgiven measurement ofcollegework. ceremony heldinJune. planning theirprogramsofstudy. designated toassiststudentsin of study. successfully completedaprogram which signifiesastudenthas Academic ReviewPolicy. because oflowgrades.Seethe status imposedonastudent graduation, oradegree.Also, required foraspecificprogram, Degree section. transfer information,seethe High School-CollegeRelations.For of theWashingtonCouncilfor Inter-College RelationsCommission guidelines developedbythe direct transferofitsstudentsunder universities inthestatefor and privatefour-yearcolleges agreements withmostofthepublic Amemberofthecollegefaculty Amemberofthecollegefaculty Lackofcreditinacourse Certifiedashavingfulfilled Thecollegehas Anannualgraduation Thecompletelistof A Distribution Requirements: Discipline: Honors/High Honors: Honors Program: Grade-Point Average(GPA): Grade Point: General EducationalDevelopment(GED): Elective: Drop: Division: Incomplete: SeeWithdraw. English, etc. teaching, suchasArt,History, qualifications. students withexceptionalacademic two-year courseofstudyfor total hoursheorshehasattempted. points onastudent'srecordbythe obtained bydividingthetotalgrade cumulative grade-pointaverageis hours attemptedinaquarter.A grade pointsearnedbytotalcredit average obtainedbydividingtotal grades, 0points. 2 points;D,1point;Eandother of Aequals4points;B,3C, a grade,asfollows:eachcredithour graduation. accepted inlieuofhighschool GED examinationsgenerallyis school equivalency.Passageofthe want toearnacertificateofhigh graduated fromhighschoolandwho needs ofadultswhohavenot A programdesignedtomeetthe a particularprogram. Allied Health,etc. subjects e.g.,Business,Humanities, is devotedtoagroupofrelated the majordepartmentrequirements. an associatedegree,inadditionto courses requiredforgraduationwith on thestudent'spermanentrecord. year oftheirissuanceortheyremain traditional lettergradewithinone Incompletes mustbeconvertedtoa take thefinalexamination. unable tocompletethecourseor some unavoidablereasonhasbeen satisfactory workinaclassbutfor only whenastudenthasdone or higherforHighHonors. 3.33 orhigherforHonorsand3.66 graduate withacumulativeGPAof graduation forstudentswho Acoursewhichisnotrequiredfor Anareawithinthecollegewhich Abranchofknowledgeor Anincompleteisagradegiven Anumericalvalueassignedto Aprogramwitha Adesignationat Arangeof Thenumerical Withdraw: Resident Student: Registration: Quarter Hour: Quarter: Probation: Prerequisite: Pre-Professional: Non-Resident Student: Major: Thesubjectorfieldofstudytowhich Add/Drop form. quarter. Thismustbedonewithan before the30thcalendardayof more information. Admissions Proceduressectionfor which heorshehasregistered.See commencement ofthequarterfor one yearimmediatelypriorto the StateofWashingtonforatleast maintained abonafidedomicilein parents orlegalguardianshave resident ifoneorbothofhisher student isalsoclassifiedasa purposes. Afinanciallydependent the stateforotherthaneducational established abonafidedomicilein she isregisteringandwhohas day ofthequarterforwhichheor immediately priortothefirstclass Washington foratleastoneyear has hadadomicileintheStateof who isfinanciallyindependentand payment offees. includes theselectionofcoursesand the beginningofeachquarter.It Registration usuallyisrequiredat officially enrolledinacollege. Quarters. Fall, WinterandSpringquarter. regular academicyearconsistsof approximately 11weeks.The met withinagivenperiod. specified conditionswhichmustbe because oflowgrades,usuallywith prerequisites forMATH124. 115 andMATH116are another course.Forexample:MATH before astudentisallowedtotake university. upon transfertoaseniorcollegeor specialization inaparticularfield prepare studentsforlater Student. attention. the studentdevotesconcentrated Atermofinstructionconsisting Astatusimposeduponastudent Toofficiallystoptakingclasses Acoursewhichmustbetaken Theprocessofbecoming SeeCreditHoursand Aprogramdesignedto Aresidentstudentisone SeeResident Information and Resources 149 150 Information and Resources Information and Resources 151 566.5118 566.5191 566.5087 566.5020 566.5131 566.5035 566.5037 566.5153 566.5035 566.5138 566.5042 566.5002 566.5120 566.6032 566.5166 566.5144 566.5180 566.5020 566.5122 566.5048 566.5097 566.5040 566.5027 566.5025 566.5048 566-5096 396.9128 566.5135 566.5144 566.5000 566.5144 566.5120 851.2424 566.5120 566.5035 566.5001 566.5328 ...... 566.5081 ...... Phone Number (253) Phone Number ...... 18) ...... 18) ...... 18) ...... 7) ...... (Bldg. 9) ...... (Bldg. 11) ...... 7) ...... nter (Bldg. 18) nter (Bldg. 18) ...... 6 ...... ) ...... dg. 18) Center (Bldg. Center (Bldg. dg. 7) 18) 4) ...... s (Bldg. 18)...... 18) ...... 9) ...... (Bldg. 18) (Bldg. 18) g. 7) ...... cords (Bldg. 18) cords Center (Bldg. Bldg. 18) port Services (Bldg...... Bldg. 11) Bldg. 18) Center (Bldg...... Hunt Street, Gig Harbor Challenge (Bldg. 8) ... Assistance Center (Bldg. 18) .... lt Learning lt Learning Center (Bldg. 7) . lt Learning Center (Bl utoring Center ( Bldg. 24 Professional/Technical Programs Registration and Re Financial Aid Services Bldg. 6 Registration and Re Advising Center (Bldg. 18) TRIO Student Sup Office of Veterans Affair Registration and Records Ce Circulation Desk (Bld International Student Services Bldg. 24 Registration and Records Bldg. 23 ...... Counseling Center ( Registration and Records Bookstore (Bldg. 11) .... Program Coordinator Bldg. 11 Athletic Director (Bldg. Financial Aid Services (Bl Advising Center ( Human Resources (Bldg. Advising Center (Bldg. 18 Advising Center (Bldg. Access Services Office-Bldg Registration and Records Ce Registration and Records ..... 1501 Pacific Ave. Room 12 ...... Bldg. 11 ...... Admissions Center (Bldg...... Job ...... Adu ...... 3993 Adults ...... Adu ...... The ...... colleges ......

...... T ......

Student Employment (off-campus jobs) Student Newspaper Personal Enrichment Professional/Technical Programs Registration Student Activities Transfer to other Tutoring Work Study positions (for students receiving Financial Aid) TCC Foundation Office Transcripts TRIO ...... Veterans Information Withdrawal from college Library Services International Student Information Continuing Education Counseling Credential Evaluation Degree/Graduation Books and Supplies Career Center Center for Multi-Ethnic/Cultural Affairs (MECA) Children's Center Downtown Center Athletics/Intramurals Financial Aid, Scholarships GED...... Adu Gig Harbor Peninsula Center Academic Questions Advising and Educator An Equal Opportunity Employer High School Completion for

Subject General Information Information Directory Information Disabilities for Students with Access Services Admission to TCC Adult Basic Education Adding/Dropping a course 152 Campus Guide Writing Lab TRIO StudentSupportServices; Reading Lab; Math Lab; Music Classrooms; Language/Listening Lab; Library; High SchoolCompletion; Cascade ConferenceCenter CAL Lab; Adult LearningCenter; Learning ResourceCenter; 7 Classrooms Marketing; Community &GovernmentRelations; College DevelopmentOffice/TCCFoundation; 6 Art Gallery 5B Carpenter Shop 5A Art Classrooms 5 Payroll Human Resources; 4 College Auditorium 3 Fresh Start 2A Business Office 2 Receiving Print Shop; Mail Services; Facilities &Grounds; Purchasing; 1 Description Bldg # Campus Guide (Rainier andBakerRooms); Bldg # Description Counseling; Career Center; Assessment; Advising; Admissions; Access Servicesforstudentswithdisabilities; Information; Welcome Center; 18 Classrooms Computer Center; 17 Lecture Hall 16 Lecture Hall 15 Sciences Building 14 Faculty Offices 12 Tutoring Student Government; Student Programs&Activities; Parking Permits; Outreach Services; Multi-Ethnic/Cultural Affairs; International StudentServicesandPrograms; Espresso; Dining Services; Cashier; Bookstore; Opgaard StudentCenter; 11 Lecture Hall 10 Workforce Education Athletic Department; Faculty Offices; 9 The Challenge(StudentNewspaper) Classrooms; 8 1234567 1 1 1 1234567 Description Bldg # 20 Independent StudyLabforBusinessPrograms Allied HealthPrograms; Faculty Offices; Classrooms; 19 Veterans Affairs Student Records; Running Start; Registration; Registrar; Job AssistanceCenter; Financial Aid; Associate VicePresident ofStudentServices; Information Technology VocationalCenter ITVC Classroom AdministrationBldg. CAB Parking Lots B-N Institutional Research&Planning Vice President-CollegeServices; Vice President-Academic&StudentAffairs; President’s Office; Administrative Offices Temporary Maintenance/Storage Building 25 University ofPhoenix Classroom Building; Continuing Education; 24 Children's Center 23 Security Classroom Building; 22 Physical EducationBuilding 21 Faculty Offices 23456 23456 23456 -Bldg. 26 -Bldg. 27 7 7 7 New Construction Campus Map