DOCSLIB.ORG

Containing Inositol 5'Phosphatase (SHIP)

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Containing Inositol 5'Phosphatase (SHIP) Molecular mechanisms controlling SH2 domain- containing inositol 5’phosphatase (SHIP) function in B cells by Samantha Dawn Pauls A thesis submitted to the Faculty of Graduate Studies of The University of Manitoba in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY Department of Biochemistry and Medical Genetics University of Manitoba Winnipeg Copyright © 2016 by Samantha Dawn Pauls TABLE OF CONTENTS Table of Contents ............................................................................................................................ ii Thesis Abstract................................................................................................................................ v Acknowledgement ........................................................................................................................ vii List of Figures ................................................................................................................................ ix List of Tables ................................................................................................................................ xii List of Copywrited materials for which permission was obtained .............................................. xiii Abbreviations ............................................................................................................................... xiv CHAPTER 1: GENERAL INTRODUCTION ............................................................................... 1 1.1 Discovery of B cells ......................................................................................................... 1 1.2 The benefits of B cells: immune response to pathogens .................................................. 3 1.3 The hazard of B cells: role in inflammatory and autoimmune conditions ....................... 5 1.4 B cell development ........................................................................................................... 7 1.5 Immune receptor signaling basics: ITAM versus ITIM ................................................. 11 1.6 Signalling through the B cell receptor............................................................................ 12 1.6.1 Signal initiation ....................................................................................................... 12 1.6.2 PLCγ pathway ......................................................................................................... 19 1.6.3 MAPK pathways ..................................................................................................... 20 1.6.4 PI3K pathway.......................................................................................................... 21 1.6.5 BCR signal modulation by co-receptors ................................................................. 28 1.6.6 Abnormal BCR signaling and disease .................................................................... 30 1.7 SH2 domain-containing inositol 5’phosphatase (SHIP) ................................................ 32 1.7.1 Discovery of SHIPc ................................................................................................ 32 1.7.2 SHIP knock-out models .......................................................................................... 32 1.7.3 Structure and function ............................................................................................. 33 1.7.4 Regulation of SHIP protein levels .......................................................................... 41 1.7.5 SHIP in autoimmune and inflammatory disorders.................................................. 42 1.8 The actin cytoskeleton and B cell signaling ................................................................... 44 1.8.1 Signal initiation ....................................................................................................... 44 1.8.2 Branched actin filament formation ......................................................................... 46 1.8.3 PI3K signaling and actin ......................................................................................... 48 1.9 Thesis overview.............................................................................................................. 49 1.9.1 Study Rationale ....................................................................................................... 49 ii 1.9.2 General hypothesis .................................................................................................. 50 1.9.3 Objectives ............................................................................................................... 50 CHAPTER 2: DEFINING THE INTERACTION NETWORK OF SHIP ................................... 52 2.1 Specific Introduction ...................................................................................................... 52 2.2 Materials and Methods ................................................................................................... 54 2.2.1 Cell lines and reagents ............................................................................................ 54 2.2.2 Co-immunoprecipitation, western blotting and multiple reaction monitoring ....... 55 2.2.3 Bioinformatics prediction tools............................................................................... 56 2.2.4 Recombinant proteins ............................................................................................. 56 2.2.5 Biacore screening .................................................................................................... 56 2.2.6 Biacore steady-state affinity analysis...................................................................... 59 2.3 Results ............................................................................................................................ 59 2.3.1 Evidence for an interaction between Bam32 and SHIP in B cells .......................... 59 2.3.2 Identification of potential SHIP interaction partners using prediction tools .......... 62 2.3.3 Identification of SHIP interaction partners by a Biacore screening assay .............. 66 2.3.4 Biacore affinity analysis of SHIP-FcγRIIB and SHIP-Nck interactions ................ 70 2.4 Discussion ...................................................................................................................... 71 CHAPTER 3: A NOVEL PHOSPHORYLATION SITE IN SHIP INDUCES BINDING TO NCK AND REGULATES ACTIN DYNAMICS IN B CELLS .................................................. 75 3.1 Specific Introduction ...................................................................................................... 75 3.2 Materials and Methods ................................................................................................... 78 3.2.1 Cell culture and reagents ......................................................................................... 78 3.2.2 Plasmids and transfections ...................................................................................... 78 3.2.3 Generation of stable cell lines ................................................................................. 79 3.2.4 GST pull-downs ...................................................................................................... 79 3.2.5 FRAP assay for actin turnover ................................................................................ 80 3.2.6 Membrane recruitment assay .................................................................................. 80 3.2.7 Intracellular staining ............................................................................................... 81 3.2.8 Spreading assay ....................................................................................................... 81 3.2.9 Statistical Analysis .................................................................................................. 82 3.3 Results ............................................................................................................................ 82 3.3.1 SHIP interacts with the cytoskeletal adaptor protein Nck ...................................... 82 3.3.2 SHIP inhibits actin turnover by a mechanism seemingly dependent on Tyr944 .... 84 3.3.3 Effect of SHIP-EGFP on actin turnover is overcome by co-overexpression of Nck 87 iii 3.3.4 SHIP membrane recruitment and enzymatic activity are not diminished by Y944F mutation ................................................................................................................................ 87 3.3.5 Overexpression of SHIP-EGFP has no measurable effect on cell spreading in a transient transfection system ................................................................................................. 89 3.3.6 Cell viability after transfection is variable and vector-dependent .......................... 90 3.4 Discussion ...................................................................................................................... 92 CHAPTER 4: CONTROLLING THE INTRACELLULAR LOCALIZATION DYNAMICS OF SHIP .............................................................................................................................................. 97 4.1 Specific Introduction ...................................................................................................... 97 4.2 Materials and Methods ................................................................................................... 99 4.2.1 Cell culture and reagents ........................................................................................
Load more

Recommended publications
  • Hypoxia-Induced P53 Modulates Both Apoptosis and Radiosensitivity Via AKT
    Hypoxia-induced p53 modulates both apoptosis and radiosensitivity via AKT Katarzyna B. Leszczynska, … , Francesca M. Buffa, Ester M. Hammond J Clin Invest. 2015;125(6):2385-2398. https://doi.org/10.1172/JCI80402. Research Article Oncology Restoration of hypoxia-induced apoptosis in tumors harboring p53 mutations has been proposed as a potential therapeutic strategy; however, the transcriptional targets that mediate hypoxia-induced p53-dependent apoptosis remain elusive. Here, we demonstrated that hypoxia-induced p53-dependent apoptosis is reliant on the DNA-binding and transactivation domains of p53 but not on the acetylation sites K120 and K164, which, in contrast, are essential for DNA damage–induced, p53-dependent apoptosis. Evaluation of hypoxia-induced transcripts in multiple cell lines identified a group of genes that are hypoxia-inducible proapoptotic targets of p53, including inositol polyphosphate-5-phosphatase (INPP5D), pleckstrin domain–containing A3 (PHLDA3), sulfatase 2 (SULF2), B cell translocation gene 2 (BTG2), cytoplasmic FMR1-interacting protein 2 (CYFIP2), and KN motif and ankyrin repeat domains 3 (KANK3). These targets were also regulated by p53 in human cancers, including breast, brain, colorectal, kidney, bladder, and melanoma cancers. Downregulation of these hypoxia-inducible targets associated with poor prognosis, suggesting that hypoxia-induced apoptosis contributes to p53-mediated tumor suppression and treatment response. Induction of p53 targets, PHLDA3, and a specific INPP5D transcript mediated apoptosis in response to hypoxia through AKT inhibition. Moreover, pharmacological inhibition of AKT led to apoptosis in the hypoxic regions of p53-deficient tumors and consequently increased radiosensitivity. Together, these results identify mediators of hypoxia-induced p53-dependent apoptosis and suggest AKT inhibition may improve radiotherapy response in p53-deficient tumors.
    [Show full text]
  • The Proximal Signaling Network of the BCR-ABL1 Oncogene Shows a Modular Organization
    Oncogene (2010) 29, 5895–5910 & 2010 Macmillan Publishers Limited All rights reserved 0950-9232/10 www.nature.com/onc ORIGINAL ARTICLE The proximal signaling network of the BCR-ABL1 oncogene shows a modular organization B Titz, T Low, E Komisopoulou, SS Chen, L Rubbi and TG Graeber Crump Institute for Molecular Imaging, Institute for Molecular Medicine, Jonsson Comprehensive Cancer Center, California NanoSystems Institute, Department of Molecular and Medical Pharmacology, University of California, Los Angeles, CA, USA BCR-ABL1 is a fusion tyrosine kinase, which causes signaling effects of BCR-ABL1 toward leukemic multiple types of leukemia. We used an integrated transformation. proteomic approach that includes label-free quantitative Oncogene (2010) 29, 5895–5910; doi:10.1038/onc.2010.331; protein complex and phosphorylation profiling by mass published online 9 August 2010 spectrometry to systematically characterize the proximal signaling network of this oncogenic kinase. The proximal Keywords: adaptor protein; BCR-ABL1; phospho- BCR-ABL1 signaling network shows a modular and complex; quantitative mass spectrometry; signaling layered organization with an inner core of three leukemia network; systems biology transformation-relevant adaptor protein complexes (Grb2/Gab2/Shc1 complex, CrkI complex and Dok1/ Dok2 complex). We introduced an ‘interaction direction- ality’ analysis, which annotates static protein networks Introduction with information on the directionality of phosphorylation- dependent interactions. In this analysis, the observed BCR-ABL1 is a constitutively active oncogenic fusion network structure was consistent with a step-wise kinase that arises through a chromosomal translocation phosphorylation-dependent assembly of the Grb2/Gab2/ and causes multiple types of leukemia. It is found in Shc1 and the Dok1/Dok2 complexes on the BCR-ABL1 many cases (B25%) of adult acute lymphoblastic core.
    [Show full text]
  • Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model
    Downloaded from http://www.jimmunol.org/ by guest on September 25, 2021 T + is online at: average * The Journal of Immunology , 34 of which you can access for free at: 2016; 197:1477-1488; Prepublished online 1 July from submission to initial decision 4 weeks from acceptance to publication 2016; doi: 10.4049/jimmunol.1600589 http://www.jimmunol.org/content/197/4/1477 Molecular Profile of Tumor-Specific CD8 Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A. Waugh, Sonia M. Leach, Brandon L. Moore, Tullia C. Bruno, Jonathan D. Buhrman and Jill E. Slansky J Immunol cites 95 articles Submit online. Every submission reviewed by practicing scientists ? is published twice each month by Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts http://jimmunol.org/subscription Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html http://www.jimmunol.org/content/suppl/2016/07/01/jimmunol.160058 9.DCSupplemental This article http://www.jimmunol.org/content/197/4/1477.full#ref-list-1 Information about subscribing to The JI No Triage! Fast Publication! Rapid Reviews! 30 days* Why • • • Material References Permissions Email Alerts Subscription Supplementary The Journal of Immunology The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2016 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. This information is current as of September 25, 2021. The Journal of Immunology Molecular Profile of Tumor-Specific CD8+ T Cell Hypofunction in a Transplantable Murine Cancer Model Katherine A.
    [Show full text]
  • RET/PTC Activation in Papillary Thyroid Carcinoma
    European Journal of Endocrinology (2006) 155 645–653 ISSN 0804-4643 INVITED REVIEW RET/PTC activation in papillary thyroid carcinoma: European Journal of Endocrinology Prize Lecture Massimo Santoro1, Rosa Marina Melillo1 and Alfredo Fusco1,2 1Istituto di Endocrinologia ed Oncologia Sperimentale del CNR ‘G. Salvatore’, c/o Dipartimento di Biologia e Patologia Cellulare e Molecolare, University ‘Federico II’, Via S. Pansini, 5, 80131 Naples, Italy and 2NOGEC (Naples Oncogenomic Center)–CEINGE, Biotecnologie Avanzate & SEMM, European School of Molecular Medicine, Naples, Italy (Correspondence should be addressed to M Santoro; Email: [email protected]) Abstract Papillary thyroid carcinoma (PTC) is frequently associated with RET gene rearrangements that generate the so-called RET/PTC oncogenes. In this review, we examine the data about the mechanisms of thyroid cell transformation, activation of downstream signal transduction pathways and modulation of gene expression induced by RET/PTC. These findings have advanced our understanding of the processes underlying PTC formation and provide the basis for novel therapeutic approaches to this disease. European Journal of Endocrinology 155 645–653 RET/PTC rearrangements in papillary growth factor, have been described in a fraction of PTC thyroid carcinoma patients (7). As illustrated in figure 1, many different genes have been found to be rearranged with RET in The rearranged during tansfection (RET) proto-onco- individual PTC patients. RET/PTC1 and 3 account for gene, located on chromosome 10q11.2, was isolated in more than 90% of all rearrangements and are hence, by 1985 and shown to be activated by a DNA rearrange- far, the most frequent variants (8–11). They result from ment (rearranged during transfection) (1).As the fusion of RET to the coiled-coil domain containing illustrated in Fig.
    [Show full text]
  • Redefining the Specificity of Phosphoinositide-Binding by Human
    bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. Redefining the specificity of phosphoinositide-binding by human PH domain-containing proteins Nilmani Singh1†, Adriana Reyes-Ordoñez1†, Michael A. Compagnone1, Jesus F. Moreno Castillo1, Benjamin J. Leslie2, Taekjip Ha2,3,4,5, Jie Chen1* 1Department of Cell & Developmental Biology, University of Illinois at Urbana-Champaign, Urbana, IL 61801; 2Department of Biophysics and Biophysical Chemistry, Johns Hopkins University School of Medicine, Baltimore, MD 21205; 3Department of Biophysics, Johns Hopkins University, Baltimore, MD 21218; 4Department of Biomedical Engineering, Johns Hopkins University, Baltimore, MD 21205; 5Howard Hughes Medical Institute, Baltimore, MD 21205, USA †These authors contributed equally to this work. *Correspondence: [email protected]. bioRxiv preprint doi: https://doi.org/10.1101/2020.06.20.163253; this version posted June 21, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC 4.0 International license. ABSTRACT Pleckstrin homology (PH) domains are presumed to bind phosphoinositides (PIPs), but specific interaction with and regulation by PIPs for most PH domain-containing proteins are unclear. Here we employed a single-molecule pulldown assay to study interactions of lipid vesicles with full-length proteins in mammalian whole cell lysates.
    [Show full text]
  • RET Gene Fusions in Malignancies of the Thyroid and Other Tissues
    G C A T T A C G G C A T genes Review RET Gene Fusions in Malignancies of the Thyroid and Other Tissues Massimo Santoro 1,*, Marialuisa Moccia 1, Giorgia Federico 1 and Francesca Carlomagno 1,2 1 Department of Molecular Medicine and Medical Biotechnology, University of Naples “Federico II”, 80131 Naples, Italy; [email protected] (M.M.); [email protected] (G.F.); [email protected] (F.C.) 2 Institute of Endocrinology and Experimental Oncology of the CNR, 80131 Naples, Italy * Correspondence: [email protected] Received: 10 March 2020; Accepted: 12 April 2020; Published: 15 April 2020 Abstract: Following the identification of the BCR-ABL1 (Breakpoint Cluster Region-ABelson murine Leukemia) fusion in chronic myelogenous leukemia, gene fusions generating chimeric oncoproteins have been recognized as common genomic structural variations in human malignancies. This is, in particular, a frequent mechanism in the oncogenic conversion of protein kinases. Gene fusion was the first mechanism identified for the oncogenic activation of the receptor tyrosine kinase RET (REarranged during Transfection), initially discovered in papillary thyroid carcinoma (PTC). More recently, the advent of highly sensitive massive parallel (next generation sequencing, NGS) sequencing of tumor DNA or cell-free (cfDNA) circulating tumor DNA, allowed for the detection of RET fusions in many other solid and hematopoietic malignancies. This review summarizes the role of RET fusions in the pathogenesis of human cancer. Keywords: kinase; tyrosine kinase inhibitor; targeted therapy; thyroid cancer 1. The RET Receptor RET (REarranged during Transfection) was initially isolated as a rearranged oncoprotein upon the transfection of a human lymphoma DNA [1].
    [Show full text]
  • DOK1 Purified Maxpab Rabbit Polyclonal Antibody (D01P)
    DOK1 purified MaxPab rabbit polyclonal antibody (D01P) Catalog # : H00001796-D01P 規格 : [ 100 ug ] List All Specification Application Image Product Rabbit polyclonal antibody raised against a full-length human DOK1 Western Blot (Transfected lysate) Description: protein. Immunogen: DOK1 (NP_001372.1, 1 a.a. ~ 481 a.a) full-length human protein. Sequence: MDGAVMEGPLFLQSQRFGTKRWRKTWAVLYPASPHGVARLEFFDHKG SSSGGGRGSSRRLDCKVIRLAECVSVAPVTVETPPEPGATAFRLDTAQR SHLLAADAPSSAAWVQTLCRNAFPKGSWTLAPTDNPPKLSALEMLENSL enlarge YSPTWEGSQFWVTVQRTEAAERCGLHGSYVLRVEAERLTLLTVGAQS QILEPLLSWPYTLLRRYGRDKVMFSFEAGRRCPSGPGTFTFQTAQGNDI FQAVETAIHRQKAQGKAGQGHDVLRADSHEGEVAEGKLPSPPGPQELL DSPPALYAEPLDSLRIAPCPSQDSLYSDPLDSTSAQAGEGVQRKKPLYW DLYEHAQQQLLKAKLTDPKEDPIYDEPEGLAPVPPQGLYDLPREPKDAW WCQARVKEEGYELPYNPATDDYAVPPPRSTKPLLAPKPQGPAFPEPGT ATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST Host: Rabbit Reactivity: Human Quality Control Antibody reactive against mammalian transfected lysate. Testing: Storage Buffer: In 1x PBS, pH 7.4 Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. Instruction: MSDS: Download Datasheet: Download Applications Western Blot (Transfected lysate) Western Blot analysis of DOK1 expression in transfected 293T cell line (H00001796-T01) by DOK1 MaxPab polyclonal antibody. Lane 1: DOK1 transfected lysate(52.40 KDa). Lane 2: Non-transfected lysate. Page 1 of 2 2016/5/20 Protocol Download Gene Information Entrez GeneID: 1796 GeneBank NM_001381 Accession#: Protein NP_001372.1 Accession#: Gene Name: DOK1 Gene Alias: MGC117395,MGC138860,P62DOK
    [Show full text]
  • Influence on the Transcriptome of Tec Family Kinases with Special Emphasis on Btk
    From Department of Laboratory Medicine Karolinska Institutet, Stockholm, Sweden INFLUENCE ON THE TRANSCRIPTOME OF TEC FAMILY KINASES WITH SPECIAL EMPHASIS ON BTK Hossain M. Nawaz Stockholm 2013 All previously published papers were reproduced with permission from the publisher. Published by Karolinska Institutet. Printed by E-print AB 2013 © Hossain Nawaz, 2013 ISBN 978-91-7549-311-4 Science is a way of thinking much more than it is a body of knowledge. Carl Sagan (1934-1996), American Scientist To my family ABSTRACT Over the last decade, scientists all over the world have profoundly used gene expression profiling based on microarray. Affymetrix is considered as the one of the pioneer platforms in the field of microarray technology. In this thesis, the Affymetrix Genechip® arrays were used to study the transcriptome of Tec family kinases with special emphasis on Bruton’s tyrosine kinase (Btk) in avian B-lymphoma DT40 cell- line and fruit flies (Drosophila melanogaster). Btk is a protein tyrosine kinase belonging to the Tec family of kinases (TFKs). Btk is involved in signal transduction of the B cell receptor (BCR) pathway and plays an essential role in B lymphocyte development and function. X-linked agammaglobulinemia (XLA) is a primary immunodeficiency disease caused by mutations in the BTK gene. We studied Btk- deficient DT40 avian cell line reconstituted with the human BTK gene in order to investigate whether the loss-of-function can be rescued by the gene substitution at the transcriptomic level. Differences in the gene expression pattern showed statistically significant changes between parental DT40 and all the Btk KO cell populations, irrespective of whether they are reconstituted or not.
    [Show full text]
  • CD22 Mouse Monoclonal Antibody [Clone ID: OTI2A4] – TA807831
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA807831 CD22 Mouse Monoclonal Antibody [Clone ID: OTI2A4] Product data: Product Type: Primary Antibodies Clone Name: OTI2A4 Applications: WB Recommended Dilution: WB 1:2000 Reactivity: Human Host: Mouse Isotype: IgG1 Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 707-847 of human CD22(NP_001762) produced in E.coli. Formulation: PBS (PH 7.3) containing 1% BSA, 50% glycerol and 0.02% sodium azide. Concentration: 1 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Unconjugated Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Gene Name: CD22 molecule Database Link: NP_001762 Entrez Gene 933 Human P20273 Background: Predominantly monomer of isoform CD22-beta. Also found as heterodimer of isoform CD22- beta and a shorter isoform. Interacts with PTPN6/SHP-1, LYN, SYK, PIK3R1/PIK3R2 and PLCG1 upon phosphorylation. Interacts with GRB2, INPP5D and SHC1 upon phosphorylation (By similarity). May form a complex with INPP5D/SHIP, GRB2 and SHC1. [UniProtKB/Swiss-Prot Function] Synonyms: SIGLEC-2; SIGLEC2 This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 2 CD22 Mouse Monoclonal Antibody [Clone ID: OTI2A4] – TA807831 Protein Families: Druggable Genome, Transmembrane Protein Pathways: B cell receptor signaling pathway, Cell adhesion molecules (CAMs), Hematopoietic cell lineage Product images: HEK293T cells were transfected with the pCMV6- ENTRY control (Left lane) or pCMV6-ENTRY CD22 ([RC216939], Right lane) cDNA for 48 hrs and lysed.
    [Show full text]
  • Detection of a Rare BCR–ABL Tyrosine Kinase Fusion Protein in H929 Multiple Myeloma Cells Using Immunoprecipitation (IP)-Tandem Mass Spectrometry (MS/MS)
    Detection of a rare BCR–ABL tyrosine kinase fusion protein in H929 multiple myeloma cells using immunoprecipitation (IP)-tandem mass spectrometry (MS/MS) Susanne B. Breitkopfa,b, Min Yuana, German A. Pihanc, and John M. Asaraa,b,1 aDivision of Signal Transduction, Beth Israel Deaconess Medical Center, Boston, MA 02115; bDepartment of Medicine, Harvard Medical School, Boston, MA 02115; and cDepartment of Hematopathology, Beth Israel Deaconess Medical Center, Boston, MA 02115 Edited by Peter K. Vogt, The Scripps Research Institute, La Jolla, CA, and approved August 23, 2012 (received for review July 26, 2012) Hypothesis directed proteomics offers higher throughput over Here, we focused on a hypothesis-directed approach to identify global analyses. We show that immunoprecipitation (IP)–tandem the active signaling pathways that drive cancers. To this end, we mass spectrometry (LC-MS/MS) in H929 multiple myeloma (MM) immunoprecipitated proteins that have clinical significance in cell cancer cells led to the discovery of a rare and unexpected BCR– proliferation such as the central nodes in the AKT and ERK sig- ABL fusion, informing a therapeutic intervention using imatinib naling pathways. The p85 regulatory subunit of phosphoinositide- (Gleevec). BCR–ABL is the driving mutation in chronic myeloid leu- 3-kinase (PI3K) binds pYXXM motif-containing proteins to the kemia (CML) and is uncommon to other cancers. Three different IP– SRC homology 2 (SH2) domains of p85, thus recruiting the p110 MS experiments central to cell signaling pathways were sufficient to catalytic subunit to the plasma membrane for activation (5, 17). Activated p110 phosphorylates its lipid substrate phosphatidyli- discover a BCR–ABL fusion in H929 cells: phosphotyrosine (pY) pep- nositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-3,4,5-tri- tide IP, p85 regulatory subunit of phosphoinositide-3-kinase (PI3K) phosphate (PIP3) and binds to the pleckstrin homology (PH) IP, and the GRB2 adaptor IP.
    [Show full text]
  • Signaling Opposing Roles in CD200 Receptor Downstream of Tyrosine
    Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown This information is current as J Immunol published online 15 November 2010 of October 1, 2021. http://www.jimmunol.org/content/early/2010/11/14/jimmun ol.1002858 Downloaded from Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists http://www.jimmunol.org/ • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: by guest on October 1, 2021 http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published November 15, 2010, doi:10.4049/jimmunol.1002858 The Journal of Immunology Downstream of Tyrosine Kinase 1 and 2 Play Opposing Roles in CD200 Receptor Signaling Robin Mihrshahi and Marion H. Brown The CD200 receptor (CD200R) negatively regulates myeloid cells by interacting with its widely expressed ligand CD200. CD200R signals through a unique inhibitory pathway involving a direct interaction with the adaptor protein downstream of tyrosine kinase 2 (Dok2) and the subsequent recruitment and activation of Ras GTPase-activating protein (RasGAP). Ligand engagement of CD200R also results in tyrosine phosphorylation of Dok1, but this protein is not essential for inhibitory CD200R signaling in human myeloid cells.
    [Show full text]
  • The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages
    The Tec Kinase−Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages This information is current as Giacomo Tampella, Hannah M. Kerns, Deqiang Niu, Swati of September 29, 2021. Singh, Socheath Khim, Katherine A. Bosch, Meghan E. Garrett, Albanus Moguche, Erica Evans, Beth Browning, Tahmina A. Jahan, Mariana Nacht, Alejandro Wolf-Yadlin, Alessandro Plebani, Jessica A. Hamerman, David J. Rawlings and Richard G. James Downloaded from J Immunol published online 29 May 2015 http://www.jimmunol.org/content/early/2015/05/29/jimmun ol.1403238 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2015/05/29/jimmunol.140323 Material 8.DCSupplemental Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision by guest on September 29, 2021 • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2015 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606. Published May 29, 2015, doi:10.4049/jimmunol.1403238 The Journal of Immunology The Tec Kinase–Regulated Phosphoproteome Reveals a Mechanism for the Regulation of Inhibitory Signals in Murine Macrophages Giacomo Tampella,*,1 Hannah M.
    [Show full text]