DOCSLIB.ORG

Symplekin and Transforming Acidic Coiled-Coil Containing Protein 3 Support the Cancer Cell Mitotic Spindle

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Symplekin and Transforming Acidic Coiled-Coil Containing Protein 3 Support the Cancer Cell Mitotic Spindle SYMPLEKIN AND TRANSFORMING ACIDIC COILED-COIL CONTAINING PROTEIN 3 SUPPORT THE CANCER CELL MITOTIC SPINDLE Kathryn M. Cappell A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the requirements for the degree of Doctorate of Philosophy in the Department of Pharmacology, School of Medicine. Chapel Hill 2011 Approved by: Advisor: Dr. Angelique Whitehurst Reader: Dr. David Siderovski Reader: Dr. Channing Der Reader: Dr. Pilar Blancafort Reader: Dr. Mohanish Deshmukh ABSTRACT KATHRYN CAPPELL: Symplekin and Transforming Acidic Coiled-Coil Containing Protein 3 Support the Cancer Cell Mitotic Spindle (Under the direction of Dr. Angelique Whitehurst) An increased rate of proliferation in cancer cells, combined with abnormalities in spindle architecture, places tumors under increased mitotic stress. Previously, our laboratory performed a genome-wide paclitaxel chemosensitizer screen to identify genes whose depletion sensitizes non- small cell lung cancer (NSCLC) cells to mitotic stress induced by paclitaxel treatment. This screen uncovered a cohort of genes that are required for viability only in the presence of paclitaxel. Two genes uncovered in this screen were the polyadenylation scaffold symplekin and the gametogenic protein transforming acidic coiled-coil containing protein 3 (TACC3). Herein, we examine the impact of polyadenylation and gametogenesis on the tumor cell mitotic spindle. First, we demonstrate that depletion of SYMPK and other polyadenylation components sensitizes many NSCLC cells, but not normal immortalized lines, to paclitaxel by inducing mitotic errors and leading to abnormal mitotic progression. Second, we demonstrate that multiple gametogenic genes are required for normal microtubule dynamics and mitotic spindle formation in the presence of paclitaxel. Additionally, we show that the gametogenic protein TACC3 is uniquely required for mitosis only in transformed cell lines but not normal immortalized cell lines and that this unique dependency can be targeted in vitro with a small molecule. These studies reveal an unanticipated dependence of the cancer cell mitotic spindle on polyadenylation and gametogenic genes. We propose that, faced with mitotic stress, cancer cells develop conditional dependencies on processes such as polyadenylation that occur in all cells and emergent dependencies on gametogenic genes that are overexpressed in tumor cells. ii ACKNOWLEDGEMENTS First and foremost, I would like to thank my mentor. Angelique Whitehurst has proven to be a fantastic mentor who has guided me on the path towards becoming a scientist. Angelique is always full of energy and excitement to share her many ideas and this has made it a great experience to be her graduate student. She has challenged me where I needed it but at the same time introduced me to the joys of scientific research. I will always be grateful for the time I spent in her laboratory and look forward to watching as her career develops in the future. I would particularly like to thank our laboratory managers Brittany Larson and Moriah Scarbrough who have provided much assistance to my projects and Charlene Ross in the UNC- Animal Core who assisted with mouse studies. I am also thankful to the Department of Pharmacology, the Cancer Cell Biology Training Program and the UNC MD/PhD program. During rough patches of my PhD, these programs have really stood by me and for that I will always be grateful. Dr. Eugene Orringer and Dr. David Siderovski deserve special credit for all the support they have given me personally and for making UNC such a wonderful place to be an MD/PhD student. I would also like to thank my committee, including Dr. Pilar Blancafort, Dr. David Siderovski, Dr. Mohanish Deshmukh and Dr. Channing Der for their insights. Finally, I am grateful to my friends and family for all their support. I am thankful to my friends and labmates who have shared the ups and downs of research with me. I would also like to thank my family and in-laws for their support and for understanding what takes their daughter/sister/aunt so far away from them. Most importantly, I want to thank my husband, Steven Cappell, who is the best half of Team Cappell and without whom this dissertation would probably be formatted completely incorrectly. iii TABLE OF CONTENTS LIST OF TABLES ..........................................................................................................................vi LIST OF FIGURES........................................................................................................................vii LIST OF ABBREVIATIONS AND SYMBOLS..........................................................................viii INTRODUCTION...............................................................................................................1 Hallmarks of cancer and the stress phenotype of cancer cells....................2 Mitotic stress in cancer ...............................................................................4 Paclitaxel and genome-wide screen to identify modulators of chemosensitivity .........................................................................................9 Role of symplekin in polyadenylation and tumorigenesis........................17 The cancer-testis antigens.........................................................................24 Transforming acidic coiled-coil containing protein 3...............................27 Thesis Summary........................................................................................29 SYMPLEKIN IS REQUIRED FOR APPROPRIATE MICROTUBULE FUNCTION AND MITOSIS......................................................................................31 Summary...................................................................................................32 Introduction...............................................................................................33 Results.......................................................................................................34 Discussion.................................................................................................48 Experimental Procedures ..........................................................................51 TACC3 AND MULTIPLE GAMETOGENIC GENES SUPPORT THE CANCER CELL MITOTIC SPINDLE ......................................................................55 Summary...................................................................................................56 Introduction...............................................................................................57 iv Results.......................................................................................................58 Discussion.................................................................................................75 Experimental Procedures ..........................................................................76 CLINICAL RELEVANCE AND FUTURE DIRECTIONS.............................................79 Summary...................................................................................................80 Future directions .......................................................................................81 Clinical implications .................................................................................89 Conclusions...............................................................................................94 REFERENCES...............................................................................................................................95 v LIST OF TABLES Table 1.1 Characteristics of mammalian cleavage and polyadenylation factors............................21 Table 3.1 Characteristics of gametogenic proteins identified in screen.........................................59 vi LIST OF FIGURES Figure 1.1 The spindle assembly checkpoint ...................................................................................5 Figure 1.2 Variation in response of mitotic cells to anti-mitotic therapies ....................................13 Figure 1.3 Protein factors involved in cleavage and polyadenylation and impact of their depletion in two genome-wide screens .........................................................................20 Figure 2.1 SYMPK is required for spindle integrity after exposure to paclitaxel.........................35 Figure 2.2 SYMPK is required for normal mitotic progression in tumor cells..............................37 Figure 2.3 SYMPK is necessary for mitosis in multiple tumor cell lines ......................................39 Figure 2.4 Depletion of SYMPK impairs tumor growth in vivo....................................................41 Figure 2.5 Depletion of SYMPK reduces microtubule stability ....................................................43 Figure 2.6 SYMPK depletion leads to loss of CKAP5 ..................................................................45 Figure 2.7 SYMPK alters CKAP5 levels post-transcriptionally ....................................................47 Figure 2.8 Polyadenylation is required for CKAP5 expression and mitosis..................................49 Figure 3.1 Multiple gametogenic genes sensitize H1155 NSCLC cells to paclitaxel....................62 Figure 3.2 Loss of gametogenic genes impairs formation of the bipolar mitotic spindle ..............64 Figure 3.3 Oncogenic changes alter mitotic properties ..................................................................68 Figure
Load more

Recommended publications
  • Nuclear and Mitochondrial Genome Defects in Autisms
    UC Irvine UC Irvine Previously Published Works Title Nuclear and mitochondrial genome defects in autisms. Permalink https://escholarship.org/uc/item/8vq3278q Journal Annals of the New York Academy of Sciences, 1151(1) ISSN 0077-8923 Authors Smith, Moyra Spence, M Anne Flodman, Pamela Publication Date 2009 DOI 10.1111/j.1749-6632.2008.03571.x License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California THE YEAR IN HUMAN AND MEDICAL GENETICS 2009 Nuclear and Mitochondrial Genome Defects in Autisms Moyra Smith, M. Anne Spence, and Pamela Flodman Department of Pediatrics, University of California, Irvine, California In this review we will evaluate evidence that altered gene dosage and structure im- pacts neurodevelopment and neural connectivity through deleterious effects on synap- tic structure and function, and evidence that the latter are key contributors to the risk for autism. We will review information on alterations of structure of mitochondrial DNA and abnormal mitochondrial function in autism and indications that interactions of the nuclear and mitochondrial genomes may play a role in autism pathogenesis. In a final section we will present data derived using Affymetrixtm SNP 6.0 microar- ray analysis of DNA of a number of subjects and parents recruited to our autism spectrum disorders project. We include data on two sets of monozygotic twins. Col- lectively these data provide additional evidence of nuclear and mitochondrial genome imbalance in autism and evidence of specific candidate genes in autism. We present data on dosage changes in genes that map on the X chromosomes and the Y chro- mosome.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • A Genome-Wide Association Study Identifies New Susceptibility Loci for Esophageal Adenocarcinoma and Barrett's Esophagus
    View metadata, citation and similar papers at core.ac.uk brought to you by CORE provided by White Rose Research Online This is an author produced version of A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus.. White Rose Research Online URL for this paper: http://eprints.whiterose.ac.uk/105073/ Article: Levine, D.M., Ek, W.E., Zhang, R. et al. (31 more authors) (2013) A genome-wide association study identifies new susceptibility loci for esophageal adenocarcinoma and Barrett's esophagus. Nature Genetics, 45 (12). pp. 1487-1493. ISSN 1061-4036 https://doi.org/10.1038/ng.2796 promoting access to White Rose research papers [email protected] http://eprints.whiterose.ac.uk/ HHS Public Access Author manuscript Author Manuscript Author ManuscriptNat Genet Author Manuscript. Author manuscript; Author Manuscript available in PMC 2014 June 01. Published in final edited form as: Nat Genet. 2013 December ; 45(12): 1487–1493. doi:10.1038/ng.2796. A Genome-Wide Association Study Identifies New Susceptibility Loci for Esophageal Adenocarcinoma and Barrett’ s Esophagus David M. Levine1, Weronica E. Ek2, Rui Zhang1, Xinxue Liu3, Lynn Onstad4, Cassandra Sather5, Pierre Lao-Sirieix3, Marilie D. Gammon6, Douglas A. Corley7, Nicholas J. Shaheen8, Nigel C. Bird9, Laura J. Hardie10, Liam J. Murray11, Brian J. Reid4,12, Wong-Ho Chow13, Harvey A. Risch14, Olof Nyrén15, Weimin Ye15, Geoffrey Liu16, Yvonne Romero17,18, Leslie Bernstein19, Anna H. Wu20, Alan G. Casson21, Stephen Chanock22, Patricia Harrington23,24,25, Isabel Caldas25, Irene Debiram-Beecham3, Carlos Caldas25,26, Nicholas K. Hayward27, Paul Pharoah23,24,25, Rebecca Fitzgerald3, Stuart MacGregor2, David C.
    [Show full text]
  • HSF1 Polyclonal Antibody Catalog # AP70419
    10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 HSF1 Polyclonal Antibody Catalog # AP70419 Specification HSF1 Polyclonal Antibody - Product Information Application WB Primary Accession Q00613 Reactivity Human, Mouse Host Rabbit Clonality Polyclonal HSF1 Polyclonal Antibody - Additional Information Gene ID 3297 Other Names HSF1; HSTF1; Heat shock factor protein 1; HSF 1; Heat shock transcription factor 1; HSTF 1 Dilution WB~~Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. HSF1 Polyclonal Antibody - Background Immunofluorescence: 1/200 - 1/1000. ELISA: 1/10000. Not yet tested in other Function as a stress-inducible and applications. DNA-binding transcription factor that plays a central role in the transcriptional activation of Format the heat shock response (HSR), leading to the Liquid in PBS containing 50% glycerol, 0.5% expression of a large class of molecular BSA and 0.02% sodium azide. chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage Storage Conditions -20℃ (PubMed:1871105, PubMed:11447121, PubMed:1986252, PubMed:7760831, PubMed:7623826, PubMed:8946918, PubMed:8940068, PubMed:9341107, HSF1 Polyclonal Antibody - Protein Information PubMed:9121459, PubMed:9727490, PubMed:9499401, PubMed:9535852, Name HSF1 (HGNC:5224) PubMed:12659875, PubMed:12917326, PubMed:15016915, PubMed:25963659, Synonyms HSTF1 PubMed:26754925). In unstressed cells, is present in a HSP90-containing multichaperone Function complex that maintains it in a non-DNA-binding Functions
    [Show full text]
  • Anti-CSTF2 / Cstf 64 Antibody (ARG58549)
    Product datasheet [email protected] ARG58549 Package: 50 μl anti-CSTF2 / CstF 64 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes CSTF2 / CstF 64 Tested Reactivity Hu Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name CSTF2 / CstF 64 Antigen Species Human Immunogen Synthetic peptide around the N-terminal region of Human CSTF2 / CstF 64. (within the following sequence: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA) Conjugation Un-conjugated Alternate Names CstF-64; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; Cleavage stimulation factor subunit 2 Application Instructions Predict Reactivity Note Predicted homology based on immunogen sequence: Cow: 85%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 100%; Rat: 93% Application table Application Dilution IHC-P 4 - 8 µg/ml WB 0.2 - 1 µg/ml Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control 293T Calculated Mw 61 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. Preservative 0.09% (w/v) Sodium azide Stabilizer 2% Sucrose www.arigobio.com 1/3 Concentration Batch dependent: 0.5 - 1 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.
    [Show full text]
  • Phospho-HSF1 (Ser326) Rabbit Pab 产品说明书
    正能生物 Phospho-HSF1 (Ser326) Rabbit pAb 货号：384621 Size 100ul 50ul Antibody type Primary antibody Conjugation Unconjugated Modification Phosphoralated Isotype Rabbit IgG Host Rabbit Application WB , IHC-P , IHC-F , ICC/IF , FC , IP Purification Affinity purified Cross reactivity Human Gene name HSF1 Alternative names HSTF1 Gene symbol HSTF1 Description Swiss-Prot Acc.Q00613.Function as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage (PubMed:1871105, PubMed:11447121, PubMed:1986252, PubMed:7760831, PubMed:7623826, PubMed:8946918, PubMed:8940068, PubMed:9341107, PubMed:9121459, PubMed:9727490, PubMed:9499401, PubMed:9535852, PubMed:12659875, PubMed:12917326, PubMed:15016915, PubMed:25963659, PubMed:26754925). In unstressed cells, is present in a HSP90-containing multichaperone complex that maintains it in a non-DNA-binding inactivated monomeric form (PubMed:9727490, PubMed:11583998, PubMed:16278218). Upon exposure to heat and other stress stimuli, undergoes homotrimerization and activates HSP gene transcription through binding to site-specific heat shock elements (HSEs) present in the promoter regions of HSP genes (PubMed:1871105, PubMed:1986252, PubMed:8455624, PubMed:7935471, PubMed:7623826, PubMed:8940068, PubMed:9727490, PubMed:9499401, PubMed:10359787, PubMed:11583998, PubMed:12659875, PubMed:16278218, PubMed:25963659, PubMed:26754925). Activation is reversible, and during the attenuation and recovery phase period of the HSR, returns to its unactivated form (PubMed:11583998, PubMed:16278218). Binds to inverted 5'-NGAAN-3' pentamer DNA sequences (PubMed:1986252, PubMed:26727489). Binds to chromatin at heat shock gene promoters (PubMed:25963659).
    [Show full text]
  • Appendix 2. Significantly Differentially Regulated Genes in Term Compared with Second Trimester Amniotic Fluid Supernatant
    Appendix 2. Significantly Differentially Regulated Genes in Term Compared With Second Trimester Amniotic Fluid Supernatant Fold Change in term vs second trimester Amniotic Affymetrix Duplicate Fluid Probe ID probes Symbol Entrez Gene Name 1019.9 217059_at D MUC7 mucin 7, secreted 424.5 211735_x_at D SFTPC surfactant protein C 416.2 206835_at STATH statherin 363.4 214387_x_at D SFTPC surfactant protein C 295.5 205982_x_at D SFTPC surfactant protein C 288.7 1553454_at RPTN repetin solute carrier family 34 (sodium 251.3 204124_at SLC34A2 phosphate), member 2 238.9 206786_at HTN3 histatin 3 161.5 220191_at GKN1 gastrokine 1 152.7 223678_s_at D SFTPA2 surfactant protein A2 130.9 207430_s_at D MSMB microseminoprotein, beta- 99.0 214199_at SFTPD surfactant protein D major histocompatibility complex, class II, 96.5 210982_s_at D HLA-DRA DR alpha 96.5 221133_s_at D CLDN18 claudin 18 94.4 238222_at GKN2 gastrokine 2 93.7 1557961_s_at D LOC100127983 uncharacterized LOC100127983 93.1 229584_at LRRK2 leucine-rich repeat kinase 2 HOXD cluster antisense RNA 1 (non- 88.6 242042_s_at D HOXD-AS1 protein coding) 86.0 205569_at LAMP3 lysosomal-associated membrane protein 3 85.4 232698_at BPIFB2 BPI fold containing family B, member 2 84.4 205979_at SCGB2A1 secretoglobin, family 2A, member 1 84.3 230469_at RTKN2 rhotekin 2 82.2 204130_at HSD11B2 hydroxysteroid (11-beta) dehydrogenase 2 81.9 222242_s_at KLK5 kallikrein-related peptidase 5 77.0 237281_at AKAP14 A kinase (PRKA) anchor protein 14 76.7 1553602_at MUCL1 mucin-like 1 76.3 216359_at D MUC7 mucin 7,
    [Show full text]
  • Quantitative SUMO Proteomics Reveals the Modulation of Several
    www.nature.com/scientificreports OPEN Quantitative SUMO proteomics reveals the modulation of several PML nuclear body associated Received: 10 October 2017 Accepted: 28 March 2018 proteins and an anti-senescence Published: xx xx xxxx function of UBC9 Francis P. McManus1, Véronique Bourdeau2, Mariana Acevedo2, Stéphane Lopes-Paciencia2, Lian Mignacca2, Frédéric Lamoliatte1,3, John W. Rojas Pino2, Gerardo Ferbeyre2 & Pierre Thibault1,3 Several regulators of SUMOylation have been previously linked to senescence but most targets of this modifcation in senescent cells remain unidentifed. Using a two-step purifcation of a modifed SUMO3, we profled the SUMO proteome of senescent cells in a site-specifc manner. We identifed 25 SUMO sites on 23 proteins that were signifcantly regulated during senescence. Of note, most of these proteins were PML nuclear body (PML-NB) associated, which correlates with the increased number and size of PML-NBs observed in senescent cells. Interestingly, the sole SUMO E2 enzyme, UBC9, was more SUMOylated during senescence on its Lys-49. Functional studies of a UBC9 mutant at Lys-49 showed a decreased association to PML-NBs and the loss of UBC9’s ability to delay senescence. We thus propose both pro- and anti-senescence functions of protein SUMOylation. Many cellular mechanisms of defense have evolved to reduce the onset of tumors and potential cancer develop- ment. One such mechanism is cellular senescence where cells undergo cell cycle arrest in response to various stressors1,2. Multiple triggers for the onset of senescence have been documented. While replicative senescence is primarily caused in response to telomere shortening3,4, senescence can also be triggered early by a number of exogenous factors including DNA damage, elevated levels of reactive oxygen species (ROS), high cytokine signa- ling, and constitutively-active oncogenes (such as H-RAS-G12V)5,6.
    [Show full text]
  • Mechanisms of Mrna Polyadenylation
    Turkish Journal of Biology Turk J Biol (2016) 40: 529-538 http://journals.tubitak.gov.tr/biology/ © TÜBİTAK Review Article doi:10.3906/biy-1505-94 Mechanisms of mRNA polyadenylation Hızlan Hıncal AĞUŞ, Ayşe Elif ERSON BENSAN* Department of Biology, Arts and Sciences, Middle East Technical University, Ankara, Turkey Received: 26.05.2015 Accepted/Published Online: 21.08.2015 Final Version: 18.05.2016 Abstract: mRNA 3’-end processing involves the addition of a poly(A) tail based on the recognition of the poly(A) signal and subsequent cleavage of the mRNA at the poly(A) site. Alternative polyadenylation (APA) is emerging as a novel mechanism of gene expression regulation in normal and in disease states. APA results from the recognition of less canonical proximal or distal poly(A) signals leading to changes in the 3’ untranslated region (UTR) lengths and even in some cases changes in the coding sequence of the distal part of the transcript. Consequently, RNA-binding proteins and/or microRNAs may differentially bind to shorter or longer isoforms. These changes may eventually alter the stability, localization, and/or translational efficiency of the mRNAs. Overall, the 3’ UTRs are gaining more attention as they possess a significant posttranscriptional regulation potential guided by APA, microRNAs, and RNA-binding proteins. Here we provide an overview of the recent developments in the APA field in connection with cancer as a potential oncogene activator and/or tumor suppressor silencing mechanism. A better understanding of the extent and significance of APA deregulation will pave the way to possible new developments to utilize the APA machinery and its downstream effects in cancer cells for diagnostic and therapeutic applications.
    [Show full text]
  • Related Regulators of 3′ UTR Processing with KAPAC Andreas J
    Gruber et al. Genome Biology (2018) 19:44 https://doi.org/10.1186/s13059-018-1415-3 METHOD Open Access Discovery of physiological and cancer- related regulators of 3′ UTR processing with KAPAC Andreas J. Gruber† , Ralf Schmidt†, Souvik Ghosh, Georges Martin, Andreas R. Gruber, Erik van Nimwegen and Mihaela Zavolan* Abstract 3′ Untranslated regions (3' UTRs) length is regulated in relation to cellular state. To uncover key regulators of poly(A) site use in specific conditions, we have developed PAQR, a method for quantifying poly(A) site use from RNA sequencing data and KAPAC, an approach that infers activities of oligomeric sequence motifs on poly(A) site choice. Application of PAQR and KAPAC to RNA sequencing data from normal and tumor tissue samples uncovers motifs that can explain changes in cleavage and polyadenylation in specific cancers. In particular, our analysis points to polypyrimidine tract binding protein 1 as a regulator of poly(A) site choice in glioblastoma. Keywords: Cleavage and polyadenylation, APA, CFIm, KAPAC, PAQR, HNRNPC, PTBP1, Prostate adenocarcinoma, Glioblastoma, Colon adenocarcinoma Background signal, consisting of the CPSF1, CPSF4, FIP1L1, and The 3′ ends of most eukaryotic mRNAs are generated WDR33 proteins, has been identified [6, 7]. through endonucleolytic cleavage and polyadenylation Most genes have multiple poly(A) sites (PAS), which (CPA) [1–3]. These steps are carried out in mammalian are differentially processed across cell types [8], likely cells by a 3′ end processing complex composed of the due to cell type-specific interactions with RNA-binding cleavage and polyadenylation specificity factor (which in- proteins (RBPs). The length of 3′ UTRs is most strongly cludes the proteins CPSF1 (also known as CPSF160), dependent on the mammalian cleavage factor I (CFIm), CPSF2 (CPSF100), CPSF3 (CPSF73), CPSF4 (CPSF30), which promotes the use of distal poly(A) sites [5, 9–12].
    [Show full text]
  • The Transformation of the Centrosome Into the Basal Body: Similarities and Dissimilarities Between Somatic and Male Germ Cells and Their Relevance for Male Fertility
    cells Review The Transformation of the Centrosome into the Basal Body: Similarities and Dissimilarities between Somatic and Male Germ Cells and Their Relevance for Male Fertility Constanza Tapia Contreras and Sigrid Hoyer-Fender * Göttingen Center of Molecular Biosciences, Johann-Friedrich-Blumenbach Institute for Zoology and Anthropology-Developmental Biology, Faculty of Biology and Psychology, Georg-August University of Göttingen, 37077 Göttingen, Germany; [email protected] * Correspondence: [email protected] Abstract: The sperm flagellum is essential for the transport of the genetic material toward the oocyte and thus the transmission of the genetic information to the next generation. During the haploid phase of spermatogenesis, i.e., spermiogenesis, a morphological and molecular restructuring of the male germ cell, the round spermatid, takes place that includes the silencing and compaction of the nucleus, the formation of the acrosomal vesicle from the Golgi apparatus, the formation of the sperm tail, and, finally, the shedding of excessive cytoplasm. Sperm tail formation starts in the round spermatid stage when the pair of centrioles moves toward the posterior pole of the nucleus. The sperm tail, eventually, becomes located opposed to the acrosomal vesicle, which develops at the anterior pole of the nucleus. The centriole pair tightly attaches to the nucleus, forming a nuclear membrane indentation. An Citation: Tapia Contreras, C.; articular structure is formed around the centriole pair known as the connecting piece, situated in the Hoyer-Fender, S. The Transformation neck region and linking the sperm head to the tail, also named the head-to-tail coupling apparatus or, of the Centrosome into the Basal in short, HTCA.
    [Show full text]
  • Development and Validation of an RNA Binding Protein- Associated Prognostic Model for Hepatocellular Carcinoma
    Journal of Clinical and Translational Hepatology 2021 DOI: 10.14218/JCTH.2020.00103 Original Article Development and Validation of an RNA Binding Protein- associated Prognostic Model for Hepatocellular Carcinoma Hao Zhang , Peng Xia, Weijie Ma and Yufeng Yuan* Department of Hepatobiliary and Pancreatic Surgery, Zhongnan Hospital of Wuhan University, Wuhan, Hubei, China Received: 7 November 2020 | Revised: 24 February 2021 | Accepted: 26 March 2021 | Published: 13 April 2021 Abstract ated prognostic model for hepatocellular carcinoma. J Clin Transl Hepatol 2021. doi: 10.14218/JCTH.2020.00103. Background and Aims: The survival rate of patients with hepatocellular carcinoma is variable. The abnormal expres- sion of RNA-binding proteins (RBPs) is closely related to the occurrence and development of malignant tumors. The pri- Introduction mary aim of this study was to identify RBPs related to the prognosis of liver cancer and to construct a prognostic model Worldwide, liver cancer is the fourth leading cause of can- of liver cancer. Methods: We downloaded the hepatocellular cer-related deaths and has the sixth highest incidence.1 carcinoma gene sequencing data from The Cancer Genome It is estimated that 840,000 new cases of liver cancer are Atlas (cancergenome.nih.gov/) database, constructed a diagnosed and at least 780,000 people die of liver cancer protein-protein interaction network, and used Cytoscape to every year, with China accounting for 47% of the total num- realize the visualization. From among 325 abnormally ex- ber of liver cancer cases as well as the related mortality.2,3 pressed genes for RBPs, 9 (XPO5, enhancer of zeste 2 poly- Hepatocellular carcinoma (HCC) is the predominant type of comb repressive complex 2 subunit [EZH2], CSTF2, BRCA1, primary liver cancer, accounting for approximately 90% of RRP12, MRPL54, EIF2AK4, PPARGC1A, and SEPSECS) were all liver cancer cases.4 Although great progress has been selected for construction of the prognostic model.
    [Show full text]