Related Regulators of 3′ UTR Processing with KAPAC Andreas J
Total Page:16
File Type:pdf, Size:1020Kb
Load more
Recommended publications
-
Nuclear and Mitochondrial Genome Defects in Autisms
UC Irvine UC Irvine Previously Published Works Title Nuclear and mitochondrial genome defects in autisms. Permalink https://escholarship.org/uc/item/8vq3278q Journal Annals of the New York Academy of Sciences, 1151(1) ISSN 0077-8923 Authors Smith, Moyra Spence, M Anne Flodman, Pamela Publication Date 2009 DOI 10.1111/j.1749-6632.2008.03571.x License https://creativecommons.org/licenses/by/4.0/ 4.0 Peer reviewed eScholarship.org Powered by the California Digital Library University of California THE YEAR IN HUMAN AND MEDICAL GENETICS 2009 Nuclear and Mitochondrial Genome Defects in Autisms Moyra Smith, M. Anne Spence, and Pamela Flodman Department of Pediatrics, University of California, Irvine, California In this review we will evaluate evidence that altered gene dosage and structure im- pacts neurodevelopment and neural connectivity through deleterious effects on synap- tic structure and function, and evidence that the latter are key contributors to the risk for autism. We will review information on alterations of structure of mitochondrial DNA and abnormal mitochondrial function in autism and indications that interactions of the nuclear and mitochondrial genomes may play a role in autism pathogenesis. In a final section we will present data derived using Affymetrixtm SNP 6.0 microar- ray analysis of DNA of a number of subjects and parents recruited to our autism spectrum disorders project. We include data on two sets of monozygotic twins. Col- lectively these data provide additional evidence of nuclear and mitochondrial genome imbalance in autism and evidence of specific candidate genes in autism. We present data on dosage changes in genes that map on the X chromosomes and the Y chro- mosome. -
A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated. -
HSF1 Polyclonal Antibody Catalog # AP70419
10320 Camino Santa Fe, Suite G San Diego, CA 92121 Tel: 858.875.1900 Fax: 858.622.0609 HSF1 Polyclonal Antibody Catalog # AP70419 Specification HSF1 Polyclonal Antibody - Product Information Application WB Primary Accession Q00613 Reactivity Human, Mouse Host Rabbit Clonality Polyclonal HSF1 Polyclonal Antibody - Additional Information Gene ID 3297 Other Names HSF1; HSTF1; Heat shock factor protein 1; HSF 1; Heat shock transcription factor 1; HSTF 1 Dilution WB~~Western Blot: 1/500 - 1/2000. Immunohistochemistry: 1/100 - 1/300. HSF1 Polyclonal Antibody - Background Immunofluorescence: 1/200 - 1/1000. ELISA: 1/10000. Not yet tested in other Function as a stress-inducible and applications. DNA-binding transcription factor that plays a central role in the transcriptional activation of Format the heat shock response (HSR), leading to the Liquid in PBS containing 50% glycerol, 0.5% expression of a large class of molecular BSA and 0.02% sodium azide. chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage Storage Conditions -20℃ (PubMed:1871105, PubMed:11447121, PubMed:1986252, PubMed:7760831, PubMed:7623826, PubMed:8946918, PubMed:8940068, PubMed:9341107, HSF1 Polyclonal Antibody - Protein Information PubMed:9121459, PubMed:9727490, PubMed:9499401, PubMed:9535852, Name HSF1 (HGNC:5224) PubMed:12659875, PubMed:12917326, PubMed:15016915, PubMed:25963659, Synonyms HSTF1 PubMed:26754925). In unstressed cells, is present in a HSP90-containing multichaperone Function complex that maintains it in a non-DNA-binding Functions -
Symplekin and Transforming Acidic Coiled-Coil Containing Protein 3 Support the Cancer Cell Mitotic Spindle
SYMPLEKIN AND TRANSFORMING ACIDIC COILED-COIL CONTAINING PROTEIN 3 SUPPORT THE CANCER CELL MITOTIC SPINDLE Kathryn M. Cappell A dissertation submitted to the faculty of the University of North Carolina at Chapel Hill in partial fulfillment of the requirements for the degree of Doctorate of Philosophy in the Department of Pharmacology, School of Medicine. Chapel Hill 2011 Approved by: Advisor: Dr. Angelique Whitehurst Reader: Dr. David Siderovski Reader: Dr. Channing Der Reader: Dr. Pilar Blancafort Reader: Dr. Mohanish Deshmukh ABSTRACT KATHRYN CAPPELL: Symplekin and Transforming Acidic Coiled-Coil Containing Protein 3 Support the Cancer Cell Mitotic Spindle (Under the direction of Dr. Angelique Whitehurst) An increased rate of proliferation in cancer cells, combined with abnormalities in spindle architecture, places tumors under increased mitotic stress. Previously, our laboratory performed a genome-wide paclitaxel chemosensitizer screen to identify genes whose depletion sensitizes non- small cell lung cancer (NSCLC) cells to mitotic stress induced by paclitaxel treatment. This screen uncovered a cohort of genes that are required for viability only in the presence of paclitaxel. Two genes uncovered in this screen were the polyadenylation scaffold symplekin and the gametogenic protein transforming acidic coiled-coil containing protein 3 (TACC3). Herein, we examine the impact of polyadenylation and gametogenesis on the tumor cell mitotic spindle. First, we demonstrate that depletion of SYMPK and other polyadenylation components sensitizes many NSCLC cells, but not normal immortalized lines, to paclitaxel by inducing mitotic errors and leading to abnormal mitotic progression. Second, we demonstrate that multiple gametogenic genes are required for normal microtubule dynamics and mitotic spindle formation in the presence of paclitaxel. -
Anti-CSTF2 / Cstf 64 Antibody (ARG58549)
Product datasheet [email protected] ARG58549 Package: 50 μl anti-CSTF2 / CstF 64 antibody Store at: -20°C Summary Product Description Rabbit Polyclonal antibody recognizes CSTF2 / CstF 64 Tested Reactivity Hu Predict Reactivity Ms, Rat, Cow, Dog, Gpig, Hrs, Rb Tested Application IHC-P, WB Host Rabbit Clonality Polyclonal Isotype IgG Target Name CSTF2 / CstF 64 Antigen Species Human Immunogen Synthetic peptide around the N-terminal region of Human CSTF2 / CstF 64. (within the following sequence: VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA) Conjugation Un-conjugated Alternate Names CstF-64; CF-1 64 kDa subunit; Cleavage stimulation factor 64 kDa subunit; CSTF 64 kDa subunit; Cleavage stimulation factor subunit 2 Application Instructions Predict Reactivity Note Predicted homology based on immunogen sequence: Cow: 85%; Dog: 85%; Guinea Pig: 86%; Horse: 86%; Mouse: 86%; Rabbit: 100%; Rat: 93% Application table Application Dilution IHC-P 4 - 8 µg/ml WB 0.2 - 1 µg/ml Application Note * The dilutions indicate recommended starting dilutions and the optimal dilutions or concentrations should be determined by the scientist. Positive Control 293T Calculated Mw 61 kDa Properties Form Liquid Purification Affinity purified. Buffer PBS, 0.09% (w/v) Sodium azide and 2% Sucrose. Preservative 0.09% (w/v) Sodium azide Stabilizer 2% Sucrose www.arigobio.com 1/3 Concentration Batch dependent: 0.5 - 1 mg/ml Storage instruction For continuous use, store undiluted antibody at 2-8°C for up to a week. For long-term storage, aliquot and store at -20°C or below. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. -
Phospho-HSF1 (Ser326) Rabbit Pab 产品说明书
正能生物 Phospho-HSF1 (Ser326) Rabbit pAb 货号:384621 Size 100ul 50ul Antibody type Primary antibody Conjugation Unconjugated Modification Phosphoralated Isotype Rabbit IgG Host Rabbit Application WB , IHC-P , IHC-F , ICC/IF , FC , IP Purification Affinity purified Cross reactivity Human Gene name HSF1 Alternative names HSTF1 Gene symbol HSTF1 Description Swiss-Prot Acc.Q00613.Function as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage (PubMed:1871105, PubMed:11447121, PubMed:1986252, PubMed:7760831, PubMed:7623826, PubMed:8946918, PubMed:8940068, PubMed:9341107, PubMed:9121459, PubMed:9727490, PubMed:9499401, PubMed:9535852, PubMed:12659875, PubMed:12917326, PubMed:15016915, PubMed:25963659, PubMed:26754925). In unstressed cells, is present in a HSP90-containing multichaperone complex that maintains it in a non-DNA-binding inactivated monomeric form (PubMed:9727490, PubMed:11583998, PubMed:16278218). Upon exposure to heat and other stress stimuli, undergoes homotrimerization and activates HSP gene transcription through binding to site-specific heat shock elements (HSEs) present in the promoter regions of HSP genes (PubMed:1871105, PubMed:1986252, PubMed:8455624, PubMed:7935471, PubMed:7623826, PubMed:8940068, PubMed:9727490, PubMed:9499401, PubMed:10359787, PubMed:11583998, PubMed:12659875, PubMed:16278218, PubMed:25963659, PubMed:26754925). Activation is reversible, and during the attenuation and recovery phase period of the HSR, returns to its unactivated form (PubMed:11583998, PubMed:16278218). Binds to inverted 5'-NGAAN-3' pentamer DNA sequences (PubMed:1986252, PubMed:26727489). Binds to chromatin at heat shock gene promoters (PubMed:25963659). -
Quantitative SUMO Proteomics Reveals the Modulation of Several
www.nature.com/scientificreports OPEN Quantitative SUMO proteomics reveals the modulation of several PML nuclear body associated Received: 10 October 2017 Accepted: 28 March 2018 proteins and an anti-senescence Published: xx xx xxxx function of UBC9 Francis P. McManus1, Véronique Bourdeau2, Mariana Acevedo2, Stéphane Lopes-Paciencia2, Lian Mignacca2, Frédéric Lamoliatte1,3, John W. Rojas Pino2, Gerardo Ferbeyre2 & Pierre Thibault1,3 Several regulators of SUMOylation have been previously linked to senescence but most targets of this modifcation in senescent cells remain unidentifed. Using a two-step purifcation of a modifed SUMO3, we profled the SUMO proteome of senescent cells in a site-specifc manner. We identifed 25 SUMO sites on 23 proteins that were signifcantly regulated during senescence. Of note, most of these proteins were PML nuclear body (PML-NB) associated, which correlates with the increased number and size of PML-NBs observed in senescent cells. Interestingly, the sole SUMO E2 enzyme, UBC9, was more SUMOylated during senescence on its Lys-49. Functional studies of a UBC9 mutant at Lys-49 showed a decreased association to PML-NBs and the loss of UBC9’s ability to delay senescence. We thus propose both pro- and anti-senescence functions of protein SUMOylation. Many cellular mechanisms of defense have evolved to reduce the onset of tumors and potential cancer develop- ment. One such mechanism is cellular senescence where cells undergo cell cycle arrest in response to various stressors1,2. Multiple triggers for the onset of senescence have been documented. While replicative senescence is primarily caused in response to telomere shortening3,4, senescence can also be triggered early by a number of exogenous factors including DNA damage, elevated levels of reactive oxygen species (ROS), high cytokine signa- ling, and constitutively-active oncogenes (such as H-RAS-G12V)5,6. -
Mechanisms of Mrna Polyadenylation
Turkish Journal of Biology Turk J Biol (2016) 40: 529-538 http://journals.tubitak.gov.tr/biology/ © TÜBİTAK Review Article doi:10.3906/biy-1505-94 Mechanisms of mRNA polyadenylation Hızlan Hıncal AĞUŞ, Ayşe Elif ERSON BENSAN* Department of Biology, Arts and Sciences, Middle East Technical University, Ankara, Turkey Received: 26.05.2015 Accepted/Published Online: 21.08.2015 Final Version: 18.05.2016 Abstract: mRNA 3’-end processing involves the addition of a poly(A) tail based on the recognition of the poly(A) signal and subsequent cleavage of the mRNA at the poly(A) site. Alternative polyadenylation (APA) is emerging as a novel mechanism of gene expression regulation in normal and in disease states. APA results from the recognition of less canonical proximal or distal poly(A) signals leading to changes in the 3’ untranslated region (UTR) lengths and even in some cases changes in the coding sequence of the distal part of the transcript. Consequently, RNA-binding proteins and/or microRNAs may differentially bind to shorter or longer isoforms. These changes may eventually alter the stability, localization, and/or translational efficiency of the mRNAs. Overall, the 3’ UTRs are gaining more attention as they possess a significant posttranscriptional regulation potential guided by APA, microRNAs, and RNA-binding proteins. Here we provide an overview of the recent developments in the APA field in connection with cancer as a potential oncogene activator and/or tumor suppressor silencing mechanism. A better understanding of the extent and significance of APA deregulation will pave the way to possible new developments to utilize the APA machinery and its downstream effects in cancer cells for diagnostic and therapeutic applications. -
Development and Validation of an RNA Binding Protein- Associated Prognostic Model for Hepatocellular Carcinoma
Journal of Clinical and Translational Hepatology 2021 DOI: 10.14218/JCTH.2020.00103 Original Article Development and Validation of an RNA Binding Protein- associated Prognostic Model for Hepatocellular Carcinoma Hao Zhang , Peng Xia, Weijie Ma and Yufeng Yuan* Department of Hepatobiliary and Pancreatic Surgery, Zhongnan Hospital of Wuhan University, Wuhan, Hubei, China Received: 7 November 2020 | Revised: 24 February 2021 | Accepted: 26 March 2021 | Published: 13 April 2021 Abstract ated prognostic model for hepatocellular carcinoma. J Clin Transl Hepatol 2021. doi: 10.14218/JCTH.2020.00103. Background and Aims: The survival rate of patients with hepatocellular carcinoma is variable. The abnormal expres- sion of RNA-binding proteins (RBPs) is closely related to the occurrence and development of malignant tumors. The pri- Introduction mary aim of this study was to identify RBPs related to the prognosis of liver cancer and to construct a prognostic model Worldwide, liver cancer is the fourth leading cause of can- of liver cancer. Methods: We downloaded the hepatocellular cer-related deaths and has the sixth highest incidence.1 carcinoma gene sequencing data from The Cancer Genome It is estimated that 840,000 new cases of liver cancer are Atlas (cancergenome.nih.gov/) database, constructed a diagnosed and at least 780,000 people die of liver cancer protein-protein interaction network, and used Cytoscape to every year, with China accounting for 47% of the total num- realize the visualization. From among 325 abnormally ex- ber of liver cancer cases as well as the related mortality.2,3 pressed genes for RBPs, 9 (XPO5, enhancer of zeste 2 poly- Hepatocellular carcinoma (HCC) is the predominant type of comb repressive complex 2 subunit [EZH2], CSTF2, BRCA1, primary liver cancer, accounting for approximately 90% of RRP12, MRPL54, EIF2AK4, PPARGC1A, and SEPSECS) were all liver cancer cases.4 Although great progress has been selected for construction of the prognostic model. -
Antisense Oligonucleotide-Based Therapeutic Against Menin for Triple-Negative Breast Cancer Treatment
biomedicines Article Antisense Oligonucleotide-Based Therapeutic against Menin for Triple-Negative Breast Cancer Treatment Dang Tan Nguyen 1,†, Thi Khanh Le 1,2,† , Clément Paris 1,†, Chaïma Cherif 1 , Stéphane Audebert 3 , Sandra Oluchi Udu-Ituma 1,Sébastien Benizri 4 , Philippe Barthélémy 4 , François Bertucci 1, David Taïeb 1,5 and Palma Rocchi 1,* 1 Predictive Oncology Laboratory, Centre de Recherche en Cancérologie de Marseille (CRCM), Inserm UMR 1068, CNRS UMR 7258, Institut Paoli-Calmettes, Aix-Marseille University, 27 Bd. Leï Roure, 13273 Marseille, France; [email protected] (D.T.N.); [email protected] (T.K.L.); [email protected] (C.P.); [email protected] (C.C.); [email protected] (S.O.U.-I.); [email protected] (F.B.); [email protected] (D.T.) 2 Department of Life Science, University of Science and Technology of Hanoi (USTH), Hanoi 000084, Vietnam 3 Marseille Protéomique, Centre de Recherche en Cancérologie de Marseille, INSERM, CNRS, Institut Paoli-Calmettes, Aix-Marseille University, 13009 Marseille, France; [email protected] 4 ARNA Laboratory, INSERM U1212, CNRS UMR 5320, University of Bordeaux, 33076 Bordeaux, France; [email protected] (S.B.); [email protected] (P.B.) 5 Biophysics and Nuclear Medicine Department, La Timone University Hospital, European Center for Research in Medical Imaging, Aix-Marseille University, 13005 Marseille, France * Correspondence: [email protected]; Tel.: +33-626-941-287 † These authors contributed equally. Citation: Nguyen, D.T.; Le, T.K.; Paris, C.; Cherif, C.; Audebert, S.; Abstract: The tumor suppressor menin has dual functions, acting either as a tumor suppressor or Oluchi Udu-Ituma, S.; Benizri, S.; as an oncogene/oncoprotein, depending on the oncological context. -
NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer
Florida International University FIU Digital Commons FIU Electronic Theses and Dissertations University Graduate School 11-7-2018 Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer Jairo Ramos [email protected] Follow this and additional works at: https://digitalcommons.fiu.edu/etd Part of the Clinical Epidemiology Commons Recommended Citation Ramos, Jairo, "Decipher Mechanisms by which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer" (2018). FIU Electronic Theses and Dissertations. 3872. https://digitalcommons.fiu.edu/etd/3872 This work is brought to you for free and open access by the University Graduate School at FIU Digital Commons. It has been accepted for inclusion in FIU Electronic Theses and Dissertations by an authorized administrator of FIU Digital Commons. For more information, please contact [email protected]. FLORIDA INTERNATIONAL UNIVERSITY Miami, Florida DECIPHER MECHANISMS BY WHICH NUCLEAR RESPIRATORY FACTOR ONE (NRF1) COORDINATES CHANGES IN THE TRANSCRIPTIONAL AND CHROMATIN LANDSCAPE AFFECTING DEVELOPMENT AND PROGRESSION OF INVASIVE BREAST CANCER A dissertation submitted in partial fulfillment of the requirements for the degree of DOCTOR OF PHILOSOPHY in PUBLIC HEALTH by Jairo Ramos 2018 To: Dean Tomás R. Guilarte Robert Stempel College of Public Health and Social Work This dissertation, Written by Jairo Ramos, and entitled Decipher Mechanisms by Which Nuclear Respiratory Factor One (NRF1) Coordinates Changes in the Transcriptional and Chromatin Landscape Affecting Development and Progression of Invasive Breast Cancer, having been approved in respect to style and intellectual content, is referred to you for judgment. -
Global Analysis of Chromosome X Gene Expression in Primary Cultures of Normal Ovarian Surface Epithelial Cells and Epithelial Ovarian Cancer Cell Lines
5-17 6/12/06 18:21 Page 5 INTERNATIONAL JOURNAL OF ONCOLOGY 30: 5-17, 2007 5 Global analysis of chromosome X gene expression in primary cultures of normal ovarian surface epithelial cells and epithelial ovarian cancer cell lines MARIE-HÉLÈNE BENOÎT1, THOMAS J. HUDSON1,2,3, GEORGES MAIRE4, JEREMY A. SQUIRE4,5, SUZANNA L. ARCAND6, DIANE PROVENCHER7,8, ANNE-MARIE-MES-MASSON7,9 and PATRICIA N. TONIN1,3,6 1Department of Human Genetics, McGill University, Montreal, Quebec H3A 1A1; 2McGill University and Genome Quebec Innovation Centre, Montreal, Quebec H3A 1A4; 3Department of Medicine, McGill University, Montreal, Quebec H3G 1A4; 4Applied Molecular Oncology, The Ontario Cancer Institute, Princess Margaret Hospital, Toronto, Ontario M5G 2M9; 5Departments of Medical Biophysics and Laboratory of Medicine and Pathobiology, University of Toronto, Toronto, Ontario M5G 1L5; 6The Research Institute of McGill University Health Center, Montreal, Quebec H3G 1A4; 7Centre de Recherche du Centre Hospitalier de l'Université de Montreal (CR-CHUM)/Institut du cancer de Montréal, Montreal, Quebec H2L 4M1; 8Division de gynécologie et obstétrique, and 9Départément de médicine, Université de Montréal, Montreal, Quebec H3C 3J7, Canada Received June 2, 2006; Accepted August 3, 2006 Abstract. The interpretation of loss of heterozygosity (LOH) and TOV21G. The combined evidence is consistent with two in cancers is complicated as genes that map to LOH regions proposed mechanisms to account for absence of Xi in female may be transcriptionally active (Xa) or inactive (Xi) due to X cancers: Xi loss followed by Xa duplication (exemplified by chromosome inactivation (XCI). We have analyzed the TOV112D) and transcriptional reactivation of Xi (exemplified chromosome X transcriptome in four epithelial ovarian by TOV21G).