DOCSLIB.ORG

FDX2 (NM 001031734) Human Tagged ORF Clone Product Data

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
FDX2 (NM 001031734) Human Tagged ORF Clone Product Data OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RG209470 FDX2 (NM_001031734) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: FDX2 (NM_001031734) Human Tagged ORF Clone Tag: TurboGFP Symbol: FDX2 Synonyms: FDX1L; MEOAL Vector: pCMV6-AC-GFP (PS100010) E. coli Selection: Ampicillin (100 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RG209470 representing NM_001031734 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGCCTCCATGGCCCGGGGAGGCGTGAGTGCCAGGGTTCTACTGCAGGCTGCCAGGGGCACCTGGT GGAACAGACCTGGGGGCACTTCCGGGTCGGGGGAGGGGGTGGCGCTGGGGACAACCAGAAAGTTTCAAGC GACAGGCTCGCGCCCGGCTGGAGAGGAGGACGCGGGCGGCCCGGAGCGGCCCGGGGACGTGGTGAACGTG GTGTTCGTAGACCGCTCAGGCCAGCGGATCCCAGTGAGTGGCAGAGTCGGGGACAATGTTCTTCACCTGG CCCAGCGCCACGGGGTGGACCTGGAAGGGGCCTGTGAAGCCTCCCTGGCCTGCTCCACCTGCCATGTGTA TGTGAGTGAAGACCACCTGGATCTCCTGCCTCCTCCCGAGGAGAGGGAAGACGACATGCTAGACATGGCC CCCCTCCTCCAGGAGAACTCGCGGCTGGGCTGCCAGATTGTGCTGACACCGGAGCTGGAAGGAGCGGAAT TCACCCTGCCCAAGATCACCAGGAACTTCTACGTGGATGGCCATGTCCCCAAGCCCCAC ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA Protein Sequence: >RG209470 representing NM_001031734 Red=Cloning site Green=Tags(s) MAASMARGGVSARVLLQAARGTWWNRPGGTSGSGEGVALGTTRKFQATGSRPAGEEDAGGPERPGDVVNV VFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVYVSEDHLDLLPPPEEREDDMLDMA PLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDGHVPKPH TRTRPLE - GFP Tag - V Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 3 FDX2 (NM_001031734) Human Tagged ORF Clone – RG209470 Cloning Scheme: Plasmid Map: ACCN: NM_001031734 ORF Size: 549 bp OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 2 / 3 FDX2 (NM_001031734) Human Tagged ORF Clone – RG209470 RefSeq: NM_001031734.2, NP_001026904.1 RefSeq Size: 852 bp RefSeq ORF: 561 bp Locus ID: 112812 UniProt ID: Q6P4F2 Gene Summary: This gene encodes a member of the ferredoxin family. The encoded protein contains a 2Fe-2S ferredoxin-type domain and is essential for heme A and Fe/S protein biosynthesis. Mutation in FDX1L gene is associated with mitochondrial muscle myopathy. [provided by RefSeq, Sep 2014] This product is to be used for laboratory only. Not for diagnostic or therapeutic use. ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 3 / 3.
Load more

Recommended publications
  • Photosynthetic Metabolism and Nitrogen Reshuffling Are Regulated
    plants Article Photosynthetic Metabolism and Nitrogen Reshuffling Are Regulated by Reversible Cysteine Thiol Oxidation Following Nitrogen Deprivation in Chlamydomonas Amanda L. Smythers , Evan W. McConnell , Hailey C. Lewis, Saher N. Mubarek and Leslie M. Hicks * Department of Chemistry, The University of North Carolina at Chapel Hill, Chapel Hill, NC, 27599, USA; [email protected] (A.L.S.); [email protected] (E.W.M.); [email protected] (H.C.L.); [email protected] (S.N.M.) * Correspondence: [email protected]; Tel.: +1-919-843-6903 Received: 30 April 2020; Accepted: 19 June 2020; Published: 23 June 2020 Abstract: As global temperatures climb to historic highs, the far-reaching effects of climate change have impacted agricultural nutrient availability. This has extended to low latitude oceans, where a deficit in both nitrogen and phosphorus stores has led to dramatic decreases in carbon sequestration in oceanic phytoplankton. Although Chlamydomonas reinhardtii, a freshwater model green alga, has shown drastic systems-level alterations following nitrogen deprivation, the mechanisms through which these alterations are triggered and regulated are not fully understood. This study examined the role of reversible oxidative signaling in the nitrogen stress response of C. reinhardtii. Using oxidized cysteine resin-assisted capture enrichment coupled with label-free quantitative proteomics, 7889 unique oxidized cysteine thiol identifiers were quantified, with 231 significantly changing peptides from 184 proteins following 2 h of nitrogen deprivation. These results demonstrate that the cellular response to nitrogen assimilation, photosynthesis, pigment biosynthesis, and lipid metabolism are regulated by reversible oxidation. An enhanced role of non-damaging oxidative pathways is observed throughout the photosynthetic apparatus that provides a framework for further analysis in phototrophs.
    [Show full text]
  • Sex Differences in the Genetic Architecture of Depression
    www.nature.com/scientificreports OPEN Sex diferences in the genetic architecture of depression Hee-Ju Kang1,3, Yoomi Park2,3, Kyung-Hun Yoo2, Ki-Tae Kim2, Eun-Song Kim1, Ju-Wan Kim1, Sung-Wan Kim1, Il-Seon Shin1, Jin-Sang Yoon1, Ju Han Kim2,3 ✉ & Jae-Min Kim1,3 ✉ The prevalence and clinical characteristics of depressive disorders difer between women and men; however, the genetic contribution to sex diferences in depressive disorders has not been elucidated. To evaluate sex-specifc diferences in the genetic architecture of depression, whole exome sequencing of samples from 1000 patients (70.7% female) with depressive disorder was conducted. Control data from healthy individuals with no psychiatric disorder (n = 72, 26.4% female) and East-Asian subpopulation 1000 Genome Project data (n = 207, 50.7% female) were included. The genetic variation between men and women was directly compared using both qualitative and quantitative research designs. Qualitative analysis identifed fve genetic markers potentially associated with increased risk of depressive disorder in females, including three variants (rs201432982 within PDE4A, and rs62640397 and rs79442975 within FDX1L) mapping to chromosome 19p13.2 and two novel variants (rs820182 and rs820148) within MYO15B at the chromosome 17p25.1 locus. Depressed patients homozygous for these variants showed more severe depressive symptoms and higher suicidality than those who were not homozygotes (i.e., heterozygotes and homozygotes for the non-associated allele). Quantitative analysis demonstrated that the genetic burden of protein-truncating and deleterious variants was higher in males than females, even after permutation testing. Our study provides novel genetic evidence that the higher prevalence of depressive disorders in women may be attributable to inherited variants.
    [Show full text]
  • A Novel Complex Neurological Phenotype Due to a Homozygous Mutation in FDX2
    doi:10.1093/brain/awy172 BRAIN 2018: 141; 2289–2298 | 2289 Downloaded from https://academic.oup.com/brain/article-abstract/141/8/2289/5054138 by FAC.MED.RIB.PRETO-BIBL.CENTRAL-USP user on 26 October 2018 A novel complex neurological phenotype due to a homozygous mutation in FDX2 Juliana Gurgel-Giannetti,1,* David S. Lynch,2,3,* Anderson Rodrigues Branda˜o de Paiva,4 Leandro Tavares Lucato,5 Guilherme Yamamoto,6 Christer Thomsen,7 Somsuvro Basu,8 Fernando Freua,4 Alexandre Varella Giannetti,9 Bruno Della Ripa de Assis,4 Mara Dell Ospedale Ribeiro,4 Isabella Barcelos,4 Katiane Saya˜o Souza,4 Fernanda Monti,4 Uira´ Souto Melo,6 Simone Amorim,4 Leonardo G. L. Silva,6 Lu´cia Ineˆs Macedo-Souza,6 Angela M. Vianna-Morgante,6 Michio Hirano,10 Marjo S. Van der Knaap,11 Roland Lill,8,12 Mariz Vainzof,6 Anders Oldfors,7 Henry Houlden2,3 and Fernando Kok4,6 *These authors contributed equally to this work. Defects in iron–sulphur [Fe-S] cluster biogenesis are increasingly recognized as causing neurological disease. Mutations in a number of genes that encode proteins involved in mitochondrial [Fe-S] protein assembly lead to complex neurological phenotypes. One class of proteins essential in the early cluster assembly are ferredoxins. FDX2 is ubiquitously expressed and is essential in the de novo formation of [2Fe-2S] clusters in humans. We describe and genetically define a novel complex neurological syndrome identified in two Brazilian families, with a novel homozygous mutation in FDX2. Patients were clinically evaluated, underwent MRI, nerve conduction studies, EMG and muscle biopsy.
    [Show full text]
  • Bacteriostatic and Bactericidal Effects of Free Nitrous Acid on Model Microbes in Wastewater Treatment
    Bacteriostatic and bactericidal effects of free nitrous acid on model microbes in wastewater treatment Shuhong Gao Master of Science Harbin Institute of Technology, Harbin, China A thesis submitted for the degree of Doctor of Philosophy at The University of Queensland in 2016 School of Chemical Engineering Advanced Water Management Centre Abstract There is great potential to use free nitrous acid (FNA), the protonated form of nitrite (HNO2), as an antimicrobial agent due to its bacteriostatic and bactericidal effects on a range of microorganisms. However, the antimicrobial mechanism of FNA is largely unknown. The overall objective of this thesis is to elucidate the responses of two model bacteria, namely Psuedomonas aeruginosa PAO1 and Desulfovibrio vulgaris Hildenborough, in wastewater treatment in terms of microbial susceptibility, tolerance and resistance to FNA exposure. The effects of FNA on the opportunistic pathogen P. aeruginosa PAO1, a well-studied denitrifier capable of nitrate/nitrite reduction through anaerobic respiration, were determined. It was revealed that the antimicrobial effect of FNA is concentration-determined and population-specific. By applying different levels of FNA, it was seen that 0.1 to 0.2 mg N/L FNA exerted a temporary inhibitory effect on P. aeruginosa PAO1 growth, while complete respiratory growth inhibition was not detected until an FNA concentration of 1.0 mg N/L was applied. The FNA concentration of 5.0 mg N/L caused complete cell killing and likely cell lysis. Differential killing by FNA in the P. aeruginosa PAO1 subpopulations was detected, suggesting intra-strain heterogeneity. A delayed recovery from FNA treatment suggested that FNA caused cell damage which required repair prior to P.
    [Show full text]
  • Structure and Functional Dynamics of the Mitochondrial Fe/S Cluster Synthesis Complex
    ARTICLE DOI: 10.1038/s41467-017-01497-1 OPEN Structure and functional dynamics of the mitochondrial Fe/S cluster synthesis complex Michal T. Boniecki1, Sven A. Freibert 2, Ulrich Mühlenhoff2, Roland Lill 2,3 & Miroslaw Cygler 1,4 Iron–sulfur (Fe/S) clusters are essential protein cofactors crucial for many cellular functions including DNA maintenance, protein translation, and energy conversion. De novo Fe/S cluster synthesis occurs on the mitochondrial scaffold protein ISCU and requires cysteine 1234567890 desulfurase NFS1, ferredoxin, frataxin, and the small factors ISD11 and ACP (acyl carrier protein). Both the mechanism of Fe/S cluster synthesis and function of ISD11-ACP are poorly understood. Here, we present crystal structures of three different NFS1-ISD11-ACP complexes with and without ISCU, and we use SAXS analyses to define the 3D architecture of the complete mitochondrial Fe/S cluster biosynthetic complex. Our structural and biochemical studies provide mechanistic insights into Fe/S cluster synthesis at the catalytic center defined by the active-site Cys of NFS1 and conserved Cys, Asp, and His residues of ISCU. We assign specific regulatory rather than catalytic roles to ISD11-ACP that link Fe/S cluster synthesis with mitochondrial lipid synthesis and cellular energy status. 1 Department of Biochemistry, University of Saskatchewan, 107 Wiggins Road, Saskatoon, SK, Canada S7N 5E5. 2 Institut für Zytobiologie und Zytopathologie, Philipps-Universität, Robert-Koch-Strasse 6, 35032 Marburg, Germany. 3 LOEWE Zentrum für Synthetische Mikrobiologie SynMikro, Hans- Meerwein-Strasse, 35043 Marburg, Germany. 4 Department of Biochemistry, McGill University, 3649 Promenade Sir William Osler, Montreal, QC, Canada H3G 0B1.
    [Show full text]
  • Functional Reconstitution of Mitochondrial Fe/S Cluster Synthesis on Isu1 Reveals the Involvement of Ferredoxin
    ARTICLE Received 18 May 2014 | Accepted 19 Aug 2014 | Published 31 Oct 2014 DOI: 10.1038/ncomms6013 Functional reconstitution of mitochondrial Fe/S cluster synthesis on Isu1 reveals the involvement of ferredoxin Holger Webert1, Sven-Andreas Freibert1, Angelo Gallo2, Torsten Heidenreich1, Uwe Linne3, Stefan Amlacher4, Ed Hurt4, Ulrich Mu¨hlenhoff1, Lucia Banci2,5 & Roland Lill1,6,7 Maturation of iron–sulphur (Fe/S) proteins involves complex biosynthetic machinery. In vivo synthesis of [2Fe–2S] clusters on the mitochondrial scaffold protein Isu1 requires the cysteine desulphurase complex Nfs1-Isd11, frataxin, ferredoxin Yah1 and its reductase Arh1. The roles of Yah1–Arh1 have remained enigmatic, because they are not required for in vitro Fe/S cluster assembly. Here, we reconstitute [2Fe–2S] cluster synthesis on Isu1 in a reaction depending on Nfs1-Isd11, frataxin, Yah1, Arh1 and NADPH. Unlike in the bacterial system, frataxin is an essential part of Fe/S cluster biosynthesis and is required simultaneously and stoichiome- trically to Yah1. Reduced but not oxidized Yah1 tightly interacts with apo-Isu1 indicating a dynamic interaction between Yah1–apo-Isu1. Nuclear magnetic resonance structural studies identify the Yah1–apo-Isu1 interaction surface and suggest a pathway for electron flow from reduced ferredoxin to Isu1. Together, our study defines the molecular function of the ferre- doxin Yah1 and its human orthologue FDX2 in mitochondrial Fe/S cluster synthesis. 1 Institut fu¨r Zytobiologie und Zytopathologie, Philipps-Universita¨t Marburg, Robert-Koch-Strasse 6, 35032 Marburg, Germany. 2 CERM, Magnetic Resonance Center, University of Florence, Sesto Fiorentino, 50019 Florence, Italy. 3 Fachbereich Chemie, Philipps-Universita¨t Marburg, Hans-Meerwein-Street, 35043 Marburg, Germany.
    [Show full text]
  • WO 2013/066848 Al 10 May 2013 (10.05.2013) W P O PCT
    (12) INTERNATIONAL APPLICATION PUBLISHED UNDER THE PATENT COOPERATION TREATY (PCT) (19) World Intellectual Property Organization International Bureau (10) International Publication Number (43) International Publication Date WO 2013/066848 Al 10 May 2013 (10.05.2013) W P O PCT (51) International Patent Classification: SHETTY, Reshma P. [US/US]; 1506 Columbia Road, CUP 7/(94 (2006.01) Unit 4, Boston, Massachusetts 02127 (US). KELLY, Jason R. [US/US]; 29 Elm Street, Apt. 4, Cambridge, (21) International Application Number: Massachusetts 02139 (US). PCT/US20 12/062540 (74) Agent: CAMACHO, Jennifer A.; Greenberg Traurig, (22) International Filing Date: LLP, One International Place, Boston, Massachusetts 30 October 2012 (30.10.2012) 021 10 (US). (25) Filing Language: English (81) Designated States (unless otherwise indicated, for every (26) Publication Language: English kind of national protection available): AE, AG, AL, AM, AO, AT, AU, AZ, BA, BB, BG, BH, BN, BR, BW, BY, (30) Priority Data: BZ, CA, CH, CL, CN, CO, CR, CU, CZ, DE, DK, DM, 13/285,919 3 1 October 201 1 (3 1. 10.201 1) US DO, DZ, EC, EE, EG, ES, FI, GB, GD, GE, GH, GM, GT, (71) Applicant: GINKGO BIOWORKS, INC. [US/US]; 27 HN, HR, HU, ID, IL, IN, IS, JP, KE, KG, KM, KN, KP, Drydock Avenue, Boston, Massachusetts 02210 (US). KR, KZ, LA, LC, LK, LR, LS, LT, LU, LY, MA, MD, ME, MG, MK, MN, MW, MX, MY, MZ, NA, NG, NI, (72) Inventors; and NO, NZ, OM, PA, PE, PG, PH, PL, PT, QA, RO, RS, RU, (71) Applicants : FISCHER, Curt R [US/US]; 169 RW, SC, SD, SE, SG, SK, SL, SM, ST, SV, SY, TH, TJ, Monsignor O'Brien Highway, #314, Cambridge, Mas TM, TN, TR, TT, TZ, UA, UG, US, UZ, VC, VN, ZA, sachusetts 02141 (US).
    [Show full text]
  • Chinese Medicine for Psoriasis Vulgaris Based on Syndrome Pattern: a Network Pharmacological Study
    Hindawi Evidence-Based Complementary and Alternative Medicine Volume 2020, Article ID 5239854, 16 pages https://doi.org/10.1155/2020/5239854 Research Article Chinese Medicine for Psoriasis Vulgaris Based on Syndrome Pattern: A Network Pharmacological Study Dongmei Wang ,1,2,3 Chuanjian Lu ,2,3 Jingjie Yu,2,3 Miaomiao Zhang,2,3 Wei Zhu,2,3 and Jiangyong Gu 2,3,4 1Dermatology Hospital of Southern Medical University, Guangzhou 510091, China 2Guangdong Provincial Academy of Chinese Medical Sciences, Guangzhou 510006, China 3'e Second Clinical College, Guangzhou University of Chinese Medicine, Guangzhou 510006, China 4Department of Biochemistry, School of Basic Medical Science, Guangzhou University of Chinese Medicine, Guangzhou 510006, China Correspondence should be addressed to Chuanjian Lu; [email protected] and Jiangyong Gu; [email protected] Received 9 September 2019; Revised 13 January 2020; Accepted 23 January 2020; Published 28 April 2020 Academic Editor: Maria Camilla Bergonzi Copyright © 2020 Dongmei Wang et al. -is is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. Background. -e long-term use of conventional therapy for psoriasis vulgaris remains a challenge due to limited or no patient response and severe side effects. Complementary and alternative treatments such as traditional Chinese medicine (TCM) are widely used in East Asia. TCM treatment is based on individual syndrome types. -ree TCM formulae, Compound Qingdai Pills (F1), Yujin Yinxie Tablets (F2), and Xiaoyin Tablets (F3), are used for blood heat, blood stasis, and blood dryness type of psoriasis vulgaris, respectively.
    [Show full text]
  • Ferredoxin Reductase Is Critical for P53-Dependent Tumor Suppression Via Iron Regulatory Protein 2
    Downloaded from genesdev.cshlp.org on September 26, 2021 - Published by Cold Spring Harbor Laboratory Press Ferredoxin reductase is critical for p53- dependent tumor suppression via iron regulatory protein 2 Yanhong Zhang,1,9 Yingjuan Qian,1,2,9 Jin Zhang,1 Wensheng Yan,1 Yong-Sam Jung,1,2 Mingyi Chen,3 Eric Huang,4 Kent Lloyd,5 Yuyou Duan,6 Jian Wang,7 Gang Liu,8 and Xinbin Chen1 1Comparative Oncology Laboratory, Schools of Veterinary Medicine and Medicine, University of California at Davis, Davis, California 95616, USA; 2College of Veterinary Medicine, Nanjing Agricultural University, Nanjing 210014, China; 3Department of Pathology, University of Texas Southwestern Medical Center, Dallas, Texas 75390, USA; 4Department of Pathology, School of Medicine, University of California at Davis Health, Sacramento, California 95817, USA; 5Department of Surgery, School of Medicine, University of California at Davis Health, Sacramento, California 95817, USA; 6Department of Dermatology and Internal Medicine, University of California at Davis Health, Sacramento, California 95616, USA; 7Department of Pathology, School of Medicine, Wayne State University, Detroit, Michigan 48201 USA; 8Department of Medicine, School of Medicine, University of Alabama at Birmingham, Birmingham, Alabama 35294, USA Ferredoxin reductase (FDXR), a target of p53, modulates p53-dependent apoptosis and is necessary for steroido- genesis and biogenesis of iron–sulfur clusters. To determine the biological function of FDXR, we generated a Fdxr- deficient mouse model and found that loss of Fdxr led to embryonic lethality potentially due to iron overload in developing embryos. Interestingly, mice heterozygous in Fdxr had a short life span and were prone to spontaneous tumors and liver abnormalities, including steatosis, hepatitis, and hepatocellular carcinoma.
    [Show full text]
  • Vitamin D in Pregnancy: Understanding Immune
    Vitamin D in pregnancy: understanding immune effects in the decidua by Jennifer Ann Tamblyn A thesis submitted to The University of Birmingham for the degree of DOCTOR OF PHILOSOPHY Institute of Metabolism and Systems Research (IMSR) College of Medical and Dental Sciences University of Birmingham, 2018 University of Birmingham Research Archive e-theses repository This unpublished thesis/dissertation is copyright of the author and/or third parties. The intellectual property rights of the author or third parties in respect of this work are as defined by The Copyright Designs and Patents Act 1988 or as modified by any successor legislation. Any use made of information contained in this thesis/dissertation must be in accordance with that legislation and must be properly acknowledged. Further distribution or reproduction in any format is prohibited without the permission of the copyright holder. Abstract Epidemiology has linked preeclampsia (PET) to vitamin D deficiency. To date, studies have focused upon serum 25-hydroxyvitamin D3 (25(OH)D3) alone as the marker of vitamin D status. We provide strong evidence comprehensive analysis of vitamin D metabolites in pregnancy is highly informative, particularly within the context of PET. Uniquely, analysis of maternal urinary metabolites provides a novel insight into vitamin D and the kidney, with lower 25(OH)D3 and 24,25(OH)2D3 excretion early indicators of a predisposition towards PET. Since vitamin D is a potent regulator of immune function, and the decidua appears a key extra-renal site for vitamin D metabolism, we investigated effects of 1,25(OH)2D3 upon decidual uterine natural killer cells and macrophages.
    [Show full text]
  • Actinobacillus Pleuropneumoniae Exprimés En Conditions D’Infection
    Université de Montréal ÉTUDE DES GÈNES D’ACTINOBACILLUS PLEUROPNEUMONIAE EXPRIMÉS EN CONDITIONS D’INFECTION par VINCENT DESLANDES Département de pathologie et microbiologie Faculté de médecine vétérinaire Thèse présentée à la Faculté de médecine vétérinaire en vue de l’obtention du grade de philosophiae doctor (Ph.D.) en Sciences Vétérinaires option microbiologie Août 2010 © Vincent Deslandes, 2010 ii Université de Montréal Faculté de médecine vétérinaire Cette thèse intitulée : ÉTUDE DES GÈNES D’ACTINOBACILLUS PLEUROPNEUMONIAE EXPRIMÉS EN CONDITIONS D’INFECTION présentée par VINCENT DESLANDES a été évaluée par un jury composé des personnes suivantes Dr Daniel Dubreuil Président rapporteur Dr Mario Jacques Directeur de recherche Dre Josée Harel Codirectrice Dr John H.E. Nash Codirecteur Dre Mariela Segura Membre du jury Dr Roger Lévesque Examinateur externe John Morris Fairbrother Représentant du doyen iii RÉSUMÉ Actinobacillus pleuropneumoniae est l’agent étiologique de la pleuropneumonie porcine. La bactérie se transmet par voies aériennes et contacts directs. Plusieurs facteurs de virulence ont été identifiés, nommément les polysaccharides capsulaires, les lipopolysaccharide, les exotoxines ApxI à IV et de nombreux mécanismes d’acquisition du fer. Aucun vaccin efficace contre tous les sérotypes de la bactérie n’a encore été élaboré. Afin de mieux comprendre de quelle façon A. pleuropneumoniae régule la transcription de ses nombreux facteurs de virulence et de découvrir de nouvelles cibles potentielles pour l’élaboration de vaccins efficaces, le profil transcriptomique de la bactérie a été étudié dans des conditions simulant l’infection ainsi qu’à la suite d’une infection naturelle aiguë chez l’animal. Des biopuces de première et de seconde génération (AppChip1 et AppChip2) comportant respectivement 2025 cadres de lecture ouverts (ORF) de la version préliminaire du génome d’A.
    [Show full text]
  • University of Groningen Paediatric Cardiomyopathies Herkert, Johanna
    University of Groningen Paediatric cardiomyopathies Herkert, Johanna Cornelia DOI: 10.33612/diss.97534698 IMPORTANT NOTE: You are advised to consult the publisher's version (publisher's PDF) if you wish to cite from it. Please check the document version below. Document Version Publisher's PDF, also known as Version of record Publication date: 2019 Link to publication in University of Groningen/UMCG research database Citation for published version (APA): Herkert, J. C. (2019). Paediatric cardiomyopathies: an evolving landscape of genetic aetiology and diagnostic applications. Rijksuniversiteit Groningen. https://doi.org/10.33612/diss.97534698 Copyright Other than for strictly personal use, it is not permitted to download or to forward/distribute the text or part of it without the consent of the author(s) and/or copyright holder(s), unless the work is under an open content license (like Creative Commons). The publication may also be distributed here under the terms of Article 25fa of the Dutch Copyright Act, indicated by the “Taverne” license. More information can be found on the University of Groningen website: https://www.rug.nl/library/open-access/self-archiving-pure/taverne- amendment. Take-down policy If you believe that this document breaches copyright please contact us providing details, and we will remove access to the work immediately and investigate your claim. Downloaded from the University of Groningen/UMCG research database (Pure): http://www.rug.nl/research/portal. For technical reasons the number of authors shown on this cover page is limited to 10 maximum. Download date: 11-10-2021 Paediatric cardiomyopathies An evolving landscape of genetic aetiology and diagnostic applications Johanna C.
    [Show full text]