DOCSLIB.ORG

A Novel Approach to Identification of Diagnostic Markers In

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
A Novel Approach to Identification of Diagnostic Markers In A NOVEL APPROACH TO IDENTIFICATION OF DIAGNOSTIC MARKERS IN PROSTATE CANCER by INNA SHYSHYNOVA Submitted in partial fulfillment of the requirements For the degree of Doctor of Philosophy Dissertation Adviser: Professor Andrei Gudkov Department of Biochemistry CASE WESTERN RESERVE UNIVERSITY August, 2006 iii TABLE OF CONTENTS CHAPTER .................................................................................................................. PAGE A NOVEL APPROACH TO IDENTIFICATION OF DIAGNOSTIC MARKERS IN PROSTATE CANCER ...........................................................................................1 TABLE OF CONTENTS.................................................................................................. IV LIST OF FIGURES .......................................................................................................... IX LIST OF TABLES............................................................................................................ XI ACKNOWLEDMENTS .................................................................................................XIII LIST OF ABBREVIATIONS........................................................................................ XIV I. INTRODUCTION ...................................................................................................1 1. Tumor markers.............................................................................................1 2. The prostate..................................................................................................5 3. Prostate cancer .............................................................................................5 3.1 Diagnosis of prostate cancer ............................................................6 3.2 Prostate cancer treatment strategies.................................................7 4. Prostatic Acid Phosphatase (PAP)...............................................................9 5. Prostate-Specific Antigen (PSA) ...............................................................10 5.1 PSA as prostate cancer marker and its advantages ........................10 5.2 Drawbacks of PSA-based diagnostics of prostate cancer..............11 5.3 PSA is transcriptionally repressed by p53 .....................................12 6. Prostate-Specific Membrane Antigen (PSMA) .........................................15 7. The search for novel markers in prostate cancer .......................................15 7.1 The attributes of an ideal tumor marker.........................................16 7.2 Methods of prostate tumor markers search....................................19 7.3 Potential PCa markers....................................................................20 II. THE GENERAL STRATEGY OF THE STUDY.................................................26 iv III. IDENTIFICATION OF NOVEL MARKERS IN PROSTATE CANCER BY IN SILICO EXPRESSION PROFILING....................................................................29 1. Rationale ....................................................................................................29 2. Introduction................................................................................................29 2.1 General strategy of EST data mining.............................................29 2.2 EST clustering................................................................................30 2.3 Commonly used criteria of gene selection.....................................31 2.3.1 Digital Differential Display (DDD)...................................31 2.3.2 Pool specificity...................................................................32 2.3.3 Guilt By Association (GBA)..............................................32 2.4 A novel in silico profiling approach ..............................................33 3. Materials and Methods...............................................................................33 3.1 Step 1: Assignment of ESTs to their parent transcripts .................33 3.2 Step 2: cDNA library selection and tissue pool assembly .............34 3.3 Step 3: Selection of candidate genes with desired digital expression profile.............................................................................................35 3.3.1 Reconstruction of expression profiles................................35 3.3.2 Selection of potential markers ...........................................36 3.4 Software implementation of the algorithms used ..........................41 3.5 Redundancy elimination ................................................................41 3.6 The relationship between our approach and the previous work ....42 4. Results........................................................................................................43 4.1 The screening summary .................................................................43 4.2 Known cancer markers ..................................................................43 5. Discussion..................................................................................................45 6. Conclusions................................................................................................45 IV. IDENTIFICATION OF NOVEL POTENTIAL PROSTATE CANCER MARKERS BY IN VIVO EXPRESSION PROFILING .......................................47 1. Rationale ....................................................................................................47 2. Introduction................................................................................................47 2.1 Tumor-suppressor genes: human tumors and mouse models ........48 3. Materials and Methods...............................................................................49 3.1 Transgenic animals ........................................................................49 v 3.2 RNA isolation ................................................................................50 3.3 Probes preparation and microarray hybridizations ........................50 3.4 Microarray data analysis and pre-candidate gene selection...........50 4. Identification of the human homologs for the selected mouse genes: the BI-HUMANIZER software .......................................................................51 4.1 The inner workings of BI-HUMANIZER......................................52 5. Results........................................................................................................56 5.1 Genes upregulated in the murine prostate after tumor suppressor inactivation.....................................................................................56 5.2 BI-HUMANIZER results...............................................................58 5.3 Known cancer markers ..................................................................58 6. Discussion..................................................................................................60 7. Conclusions................................................................................................60 V. VERIFICATION OF THE SELECTED PRE-CANDIDATE GENES BY MICROARRAY HYBRIDIZATION....................................................................61 1. Rationale ....................................................................................................61 2. Introduction................................................................................................61 3. Materials and Methods...............................................................................62 3.1 cDNA clone selection and ordering...............................................62 3.2 Microarray printing......................................................................127 3.3 Cell culture sources for hybridization probe preparation ............127 3.4 Probe preparation and microarray hybridization .........................127 3.5 Microarray data analysis..............................................................130 3.5.1 Quality control .................................................................130 3.5.2 Normalization ..................................................................130 3.5.3 Cluster analysis ................................................................131 3.5.4 The selection of candidate genes for validation...............131 4. Results......................................................................................................131 4.1 Cluster analysis of expression across samples.............................131 4.2 Cluster analysis of expression across genes.................................132 4.3 Selection of candidates for validation of expression profiles ......134 5. Discussion................................................................................................134 6. Conclusions..............................................................................................136 vi VI. VALIDATION OF THE CANDIDATES’ EXPRESSION PATTERNS ...........138 1. Rationale ..................................................................................................138 2. Introduction..............................................................................................138 3. Semi-quantitative RT-PCR ......................................................................138 3.1 Materials and Methods.................................................................138 3.2 Results..........................................................................................139 4. Northern blot analysis..............................................................................142
Load more

Recommended publications
  • Acetyl Group Coordinated Progression Through the Catalytic Cycle of an Arylalkylamine N-Acetyltransferase
    RESEARCH ARTICLE Acetyl group coordinated progression through the catalytic cycle of an arylalkylamine N-acetyltransferase Adam A. Aboalroub, Ashleigh B. Bachman, Ziming Zhang, Dimitra Keramisanou, David J. Merkler, Ioannis Gelis* Department of Chemistry, University of South Florida, Tampa, Florida, United States of America * [email protected] a1111111111 a1111111111 a1111111111 Abstract a1111111111 a1111111111 The transfer of an acetyl group from acetyl-CoA to an acceptor amine is a ubiquitous bio- chemical transformation catalyzed by Gcn5-related N-acetyltransferases (GNATs). Although it is established that the reaction proceeds through a sequential ordered mecha- nism, the role of the acetyl group in driving the ordered formation of binary and ternary com- OPEN ACCESS plexes remains elusive. Herein, we show that CoA and acetyl-CoA alter the conformation of the substrate binding site of an arylalkylamine N-acetyltransferase (AANAT) to facilitate Citation: Aboalroub AA, Bachman AB, Zhang Z, Keramisanou D, Merkler DJ, Gelis I (2017) Acetyl interaction with acceptor substrates. However, it is the presence of the acetyl group within group coordinated progression through the the catalytic funnel that triggers high affinity binding. Acetyl group occupancy is relayed catalytic cycle of an arylalkylamine N- through a conserved salt bridge between the P-loop and the acceptor binding site, and is acetyltransferase. PLoS ONE 12(5): e0177270. manifested as differential dynamics in the CoA and acetyl-CoA-bound states. The capacity https://doi.org/10.1371/journal.pone.0177270 of the acetyl group carried by an acceptor to promote its tight binding even in the absence of Editor: Viswanathan V. Krishnan, California State CoA, but also its mutually exclusive position to the acetyl group of acetyl-CoA underscore its University Fresno, UNITED STATES importance in coordinating the progression of the catalytic cycle.
    [Show full text]
  • Bioinorganic Chemistry of Nickel
    inorganics Editorial Bioinorganic Chemistry of Nickel Michael J. Maroney 1,* and Stefano Ciurli 2,* 1 Department of Chemistry and Program in Molecular and Cellular Biology, University of Massachusetts Amherst, 240 Thatcher Rd. Life Sciences, Laboratory Rm N373, Amherst, MA 01003, USA 2 Laboratory of Bioinorganic Chemistry, Department of Pharmacy and Biotechnology, University of Bologna, Viale G. Fanin 40, I-40127 Bologna, Italy * Correspondence: [email protected] (M.J.M.); [email protected] (S.C.) Received: 11 October 2019; Accepted: 11 October 2019; Published: 30 October 2019 Following the discovery of the first specific and essential role of nickel in biology in 1975 (the dinuclear active site of the enzyme urease) [1], nickel has become a major player in bioinorganic chemistry,particularly in microorganisms, having impacts on both environmental settings and human pathologies. At least nine classes of enzymes are now known to require nickel in their active sites, including catalysis of redox [(Ni,Fe) hydrogenases, carbon monoxide dehydrogenase, methyl coenzyme M reductase, acetyl coenzyme A synthase, superoxide dismutase] and nonredox (glyoxalase I, acireductone dioxygenase, lactate isomerase, urease) chemistries. In addition, the dark side of nickel has been illuminated in regard to its participation in microbial pathogenesis, cancer, and immune responses. Knowledge gleaned from the investigations of inorganic chemists into the coordination and redox chemistry of this element have boosted the understanding of these biological roles of nickel in each context. In this issue, eleven contributions, including four original research articles and seven critical reviews, will update the reader on the broad spectrum of the role of nickel in biology.
    [Show full text]
  • Supplemental Table S1
    Entrez Gene Symbol Gene Name Affymetrix EST Glomchip SAGE Stanford Literature HPA confirmed Gene ID Profiling profiling Profiling Profiling array profiling confirmed 1 2 A2M alpha-2-macroglobulin 0 0 0 1 0 2 10347 ABCA7 ATP-binding cassette, sub-family A (ABC1), member 7 1 0 0 0 0 3 10350 ABCA9 ATP-binding cassette, sub-family A (ABC1), member 9 1 0 0 0 0 4 10057 ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 1 0 0 0 0 5 10060 ABCC9 ATP-binding cassette, sub-family C (CFTR/MRP), member 9 1 0 0 0 0 6 79575 ABHD8 abhydrolase domain containing 8 1 0 0 0 0 7 51225 ABI3 ABI gene family, member 3 1 0 1 0 0 8 29 ABR active BCR-related gene 1 0 0 0 0 9 25841 ABTB2 ankyrin repeat and BTB (POZ) domain containing 2 1 0 1 0 0 10 30 ACAA1 acetyl-Coenzyme A acyltransferase 1 (peroxisomal 3-oxoacyl-Coenzyme A thiol 0 1 0 0 0 11 43 ACHE acetylcholinesterase (Yt blood group) 1 0 0 0 0 12 58 ACTA1 actin, alpha 1, skeletal muscle 0 1 0 0 0 13 60 ACTB actin, beta 01000 1 14 71 ACTG1 actin, gamma 1 0 1 0 0 0 15 81 ACTN4 actinin, alpha 4 0 0 1 1 1 10700177 16 10096 ACTR3 ARP3 actin-related protein 3 homolog (yeast) 0 1 0 0 0 17 94 ACVRL1 activin A receptor type II-like 1 1 0 1 0 0 18 8038 ADAM12 ADAM metallopeptidase domain 12 (meltrin alpha) 1 0 0 0 0 19 8751 ADAM15 ADAM metallopeptidase domain 15 (metargidin) 1 0 0 0 0 20 8728 ADAM19 ADAM metallopeptidase domain 19 (meltrin beta) 1 0 0 0 0 21 81792 ADAMTS12 ADAM metallopeptidase with thrombospondin type 1 motif, 12 1 0 0 0 0 22 9507 ADAMTS4 ADAM metallopeptidase with thrombospondin type 1
    [Show full text]
  • Integrated Multivariate Analysis of Transcriptomic Data Reveals Immunological Mechanisms in Mice After Leishmania Infantum Infec
    1 Integrated multivariate analysis of transcriptomic data 2 reveals immunological mechanisms in mice after 3 Leishmania infantum infection 4 5 Génesis Palacios1, Raquel Diaz-Solano1, Basilio Valladares1,2,4, Roberto Dorta- 6 Guerra1,3, Emma Carmelo1,2,4*. 7 1 Instituto Universitario de Enfermedades Tropicales y Salud Pública de Canarias, 8 Universidad de la Laguna, La Laguna, Islas Canarias, Spain.2 Departamento de 9 Obstetricia y Ginecología, Pediatría, Medicina Preventiva y Salud Pública, 10 Toxicología, Medicina Legal y Forense y Parasitología. 3 Departamento de 11 Matemáticas, Estadística e Investigación Operativa, Facultad de Ciencias, 12 Universidad de La Laguna, La Laguna, Spain. 4 Red de Investigación Colaborativa 13 en Enfermedades Tropicales (RICET). 14 15 16 17 18 19 20 21 1 22 SUPPLEMENTAL MATERIAL 23 Supplementary file 1. List of TaqMan assays used for RT-qPCR analysis using 24 QuantStudioTM 12K Flex Real-Time PCR System. 25 PANEL 1. N° Assay ID GEN NOMBRE DEL GEN GRUPO 1 Mm00437762_m1 B2m beta-2 microglobulin 2 Mm00446968_m1 Hprt hypoxanthine guanine phosphoribosyl transferase 3 Mm00435617_m1 Pgk1 phosphoglycerate kinase 1 Endogenous gene 4 Mm01277042_m1 Tbp TATA box binding protein expression 5 Mm01201237_m1 Ubc ubiquitin C tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation 6 Mm01722325_m1 Ywhaz protein, zeta polypeptide 7 Mm00599890_m1 Ifngr1 interferon gamma receptor 1 8 Mm00492626_m1 Ifngr2 interferon gamma receptor 2 9 Mm01168134_m1 Ifng interferon gamma 10 Mm01178820_m1 Tgfb1 transforming growth factor,
    [Show full text]
  • Identification and Characterization of TPRKB Dependency in TP53 Deficient Cancers
    Identification and Characterization of TPRKB Dependency in TP53 Deficient Cancers. by Kelly Kennaley A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Molecular and Cellular Pathology) in the University of Michigan 2019 Doctoral Committee: Associate Professor Zaneta Nikolovska-Coleska, Co-Chair Adjunct Associate Professor Scott A. Tomlins, Co-Chair Associate Professor Eric R. Fearon Associate Professor Alexey I. Nesvizhskii Kelly R. Kennaley [email protected] ORCID iD: 0000-0003-2439-9020 © Kelly R. Kennaley 2019 Acknowledgements I have immeasurable gratitude for the unwavering support and guidance I received throughout my dissertation. First and foremost, I would like to thank my thesis advisor and mentor Dr. Scott Tomlins for entrusting me with a challenging, interesting, and impactful project. He taught me how to drive a project forward through set-backs, ask the important questions, and always consider the impact of my work. I’m truly appreciative for his commitment to ensuring that I would get the most from my graduate education. I am also grateful to the many members of the Tomlins lab that made it the supportive, collaborative, and educational environment that it was. I would like to give special thanks to those I’ve worked closely with on this project, particularly Dr. Moloy Goswami for his mentorship, Lei Lucy Wang, Dr. Sumin Han, and undergraduate students Bhavneet Singh, Travis Weiss, and Myles Barlow. I am also grateful for the support of my thesis committee, Dr. Eric Fearon, Dr. Alexey Nesvizhskii, and my co-mentor Dr. Zaneta Nikolovska-Coleska, who have offered guidance and critical evaluation since project inception.
    [Show full text]
  • A Computational Approach for Defining a Signature of Β-Cell Golgi Stress in Diabetes Mellitus
    Page 1 of 781 Diabetes A Computational Approach for Defining a Signature of β-Cell Golgi Stress in Diabetes Mellitus Robert N. Bone1,6,7, Olufunmilola Oyebamiji2, Sayali Talware2, Sharmila Selvaraj2, Preethi Krishnan3,6, Farooq Syed1,6,7, Huanmei Wu2, Carmella Evans-Molina 1,3,4,5,6,7,8* Departments of 1Pediatrics, 3Medicine, 4Anatomy, Cell Biology & Physiology, 5Biochemistry & Molecular Biology, the 6Center for Diabetes & Metabolic Diseases, and the 7Herman B. Wells Center for Pediatric Research, Indiana University School of Medicine, Indianapolis, IN 46202; 2Department of BioHealth Informatics, Indiana University-Purdue University Indianapolis, Indianapolis, IN, 46202; 8Roudebush VA Medical Center, Indianapolis, IN 46202. *Corresponding Author(s): Carmella Evans-Molina, MD, PhD ([email protected]) Indiana University School of Medicine, 635 Barnhill Drive, MS 2031A, Indianapolis, IN 46202, Telephone: (317) 274-4145, Fax (317) 274-4107 Running Title: Golgi Stress Response in Diabetes Word Count: 4358 Number of Figures: 6 Keywords: Golgi apparatus stress, Islets, β cell, Type 1 diabetes, Type 2 diabetes 1 Diabetes Publish Ahead of Print, published online August 20, 2020 Diabetes Page 2 of 781 ABSTRACT The Golgi apparatus (GA) is an important site of insulin processing and granule maturation, but whether GA organelle dysfunction and GA stress are present in the diabetic β-cell has not been tested. We utilized an informatics-based approach to develop a transcriptional signature of β-cell GA stress using existing RNA sequencing and microarray datasets generated using human islets from donors with diabetes and islets where type 1(T1D) and type 2 diabetes (T2D) had been modeled ex vivo. To narrow our results to GA-specific genes, we applied a filter set of 1,030 genes accepted as GA associated.
    [Show full text]
  • COX17 (NM 005694) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC210756 COX17 (NM_005694) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: COX17 (NM_005694) Human Tagged ORF Clone Tag: Myc-DDK Symbol: COX17 Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC210756 representing NM_005694 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCGGGTCTGGTTGACTCAAACCCTGCCCCGCCTGAGTCTCAGGAGAAGAAGCCGCTGAAGCCCTGCT GCGCTTGCCCGGAGACCAAGAAGGCGCGCGATGCGTGTATCATCGAGAAAGGAGAAGAACACTGTGGACA TCTAATTGAGGCCCACAAGGAATGCATGAGAGCCCTAGGATTTAAAATA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC210756 representing NM_005694 Red=Cloning site Green=Tags(s) MPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI myc-FLAG tag Chromatograms: https://cdn.origene.com/chromatograms/mk8114_f02.zip Restriction Sites: SgfI-MluI This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 COX17 (NM_005694) Human Tagged ORF Clone – RC210756 Cloning Scheme: Plasmid Map: ACCN: NM_005694 ORF Size: 189 bp This product is
    [Show full text]
  • Interconversion Between Active and Inactive TATA-Binding Protein
    1446–1459 Nucleic Acids Research, 2012, Vol. 40, No. 4 Published online 19 October 2011 doi:10.1093/nar/gkr802 Interconversion between active and inactive TATA-binding protein transcription complexes in the mouse genome Mohamed-Amin Choukrallah, Dominique Kobi1, Igor Martianov1, W. W. M. Pim Pijnappel2,4, Nikolai Mischerikow2,3, Tao Ye1, Albert J. R. Heck3,4,5, H. Th. Marc Timmers2,4 and Irwin Davidson1,* 1Institut de Ge´ ne´ tique et de Biologie Mole´ culaire et Cellulaire, CNRS/INSERM/ULP, 1 Rue Laurent Fries, 67404 Illkirch Ce´ dex, France, 2Molecular Cancer Research, University Medical Center Utrecht, Universiteitsweg 100, 3Biomolecular Mass Spectrometry and Proteomics Group, Bijvoet Centre for Biomolecular Research and Utrecht Institute for Pharmaceutical Sciences, Utrecht University, 4Netherlands Proteomics Centre and 5Centre for Biomedical Genetics, Padualaan 8, 3584 CH Utrecht, The Netherlands Received June 10, 2011; Revised September 12, 2011; Accepted September 13, 2011 ABSTRACT preinitiation complex comprising B-TFIID that primes the promoter for productive preinitiation The TATA binding protein (TBP) plays a pivotal role complex formation in mammalian cells. in RNA polymerase II (Pol II) transcription through incorporation into the TFIID and B-TFIID complexes. The role of mammalian B-TFIID composed of TBP INTRODUCTION and B-TAF1 is poorly understood. Using a com- Accurate initiation of transcription by RNA polymerase plementation system in genetically modified mouse II (Pol II) requires the assembly of the multiprotein cells where endogenous TBP can be condi- preinitiation complex (PIC) on the core promoter around tionally inactivated and replaced by exogenous the mRNA start site (1–3). Amongst the basal transcrip- mutant TBP coupled to tandem affinity purification tion factors in this process is the TFIID complex com- and mass spectrometry, we identify two TBP prising the TATA binding protein (TBP) and a set of 13–14 TBP-associated factors (TAFs) (4–7).
    [Show full text]
  • Cysteine Dioxygenase 1 Is a Metabolic Liability for Non-Small Cell Lung Cancer Authors: Yun Pyo Kang1, Laura Torrente1, Min Liu2, John M
    bioRxiv preprint doi: https://doi.org/10.1101/459602; this version posted November 1, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Cysteine dioxygenase 1 is a metabolic liability for non-small cell lung cancer Authors: Yun Pyo Kang1, Laura Torrente1, Min Liu2, John M. Asara3,4, Christian C. Dibble5,6 and Gina M. DeNicola1,* Affiliations: 1 Department of Cancer Physiology, H. Lee Moffitt Cancer Center and Research Institute, Tampa, FL, USA 2 Proteomics and Metabolomics Core Facility, Moffitt Cancer Center and Research Institute, Tampa, FL, USA 3 Division of Signal Transduction, Beth Israel Deaconess Medical Center, Boston, MA, USA 4 Department of Medicine, Harvard Medical School, Boston, MA, USA 5 Department of Pathology and Cancer Center, Beth Israel Deaconess Medical Center, Boston, MA, USA 6 Department of Pathology, Harvard Medical School, Boston, MA, USA *Correspondence to: [email protected]. Keywords: KEAP1, NRF2, cysteine, CDO1, sulfite Summary NRF2 is emerging as a major regulator of cellular metabolism. However, most studies have been performed in cancer cells, where co-occurring mutations and tumor selective pressures complicate the influence of NRF2 on metabolism. Here we use genetically engineered, non-transformed primary cells to isolate the most immediate effects of NRF2 on cellular metabolism. We find that NRF2 promotes the accumulation of intracellular cysteine and engages the cysteine homeostatic control mechanism mediated by cysteine dioxygenase 1 (CDO1), which catalyzes the irreversible metabolism of cysteine to cysteine sulfinic acid (CSA). Notably, CDO1 is preferentially silenced by promoter methylation in non-small cell lung cancers (NSCLC) harboring mutations in KEAP1, the negative regulator of NRF2.
    [Show full text]
  • IL21R Expressing CD14+CD16+ Monocytes Expand in Multiple
    Plasma Cell Disorders SUPPLEMENTARY APPENDIX IL21R expressing CD14 +CD16 + monocytes expand in multiple myeloma patients leading to increased osteoclasts Marina Bolzoni, 1 Domenica Ronchetti, 2,3 Paola Storti, 1,4 Gaetano Donofrio, 5 Valentina Marchica, 1,4 Federica Costa, 1 Luca Agnelli, 2,3 Denise Toscani, 1 Rosanna Vescovini, 1 Katia Todoerti, 6 Sabrina Bonomini, 7 Gabriella Sammarelli, 1,7 Andrea Vecchi, 8 Daniela Guasco, 1 Fabrizio Accardi, 1,7 Benedetta Dalla Palma, 1,7 Barbara Gamberi, 9 Carlo Ferrari, 8 Antonino Neri, 2,3 Franco Aversa 1,4,7 and Nicola Giuliani 1,4,7 1Myeloma Unit, Dept. of Medicine and Surgery, University of Parma; 2Dept. of Oncology and Hemato-Oncology, University of Milan; 3Hematology Unit, “Fondazione IRCCS Ca’ Granda”, Ospedale Maggiore Policlinico, Milan; 4CoreLab, University Hospital of Parma; 5Dept. of Medical-Veterinary Science, University of Parma; 6Laboratory of Pre-clinical and Translational Research, IRCCS-CROB, Referral Cancer Center of Basilicata, Rionero in Vulture; 7Hematology and BMT Center, University Hospital of Parma; 8Infectious Disease Unit, University Hospital of Parma and 9“Dip. Oncologico e Tecnologie Avanzate”, IRCCS Arcispedale Santa Maria Nuova, Reggio Emilia, Italy ©2017 Ferrata Storti Foundation. This is an open-access paper. doi:10.3324/haematol. 2016.153841 Received: August 5, 2016. Accepted: December 23, 2016. Pre-published: January 5, 2017. Correspondence: [email protected] SUPPLEMENTAL METHODS Immunophenotype of BM CD14+ in patients with monoclonal gammopathies. Briefly, 100 μl of total BM aspirate was incubated in the dark with anti-human HLA-DR-PE (clone L243; BD), anti-human CD14-PerCP-Cy 5.5, anti-human CD16-PE-Cy7 (clone B73.1; BD) and anti-human CD45-APC-H 7 (clone 2D1; BD) for 20 min.
    [Show full text]
  • Limited Diagnostic Utility of Chromogranin a Measurements in Workup of Neuroendocrine Tumors
    diagnostics Article Limited Diagnostic Utility of Chromogranin A Measurements in Workup of Neuroendocrine Tumors Jonas Baekdal 1,2,*, Jesper Krogh 1,2, Marianne Klose 1,2, Pernille Holmager 1,2, Seppo W. Langer 1,3, Peter Oturai 1,4,5, Andreas Kjaer 1,4,5 , Birgitte Federspiel 1,6, Linda Hilsted 1,7, Jens F. Rehfeld 1,7, Ulrich Knigge 1,2,8 and Mikkel Andreassen 1,2 1 ENETS Neuroendocrine Tumor Centre of Excellence, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark; [email protected] (J.K.); [email protected] (M.K.); [email protected] (P.H.); [email protected] (S.W.L.); [email protected] (P.O.); [email protected] (A.K.); [email protected] (B.F.); [email protected] (L.H.); [email protected] (J.F.R.); [email protected] (U.K.); [email protected] (M.A.) 2 Department of Endocrinology, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark 3 Department of Oncology, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark 4 Department of Clinical Physiology, Nuclear Medicine & PET and Cluster for Molecular Imaging, Copenhagen University Hospital, 2100 Copenhagen, Denmark 5 Department of Biomedical Sciences, Rigshospitalet and University of Copenhagen, 2100 Copenhagen, Denmark 6 Department of Pathology, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark 7 Department of Clinical Biochemistry, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark 8 Department of Surgery and Transplantation, Rigshospitalet, Copenhagen University Hospital, 2100 Copenhagen, Denmark * Correspondence: [email protected]; Tel.: +45-6013-4687 Received: 11 October 2020; Accepted: 28 October 2020; Published: 29 October 2020 Abstract: Background: Plasma chromogranin A (CgA) is related to tumor burden and recommended in the follow-up of patients diagnosed with neuroendocrine tumors (NETs).
    [Show full text]
  • Small-Cell Neuroendocrine Tumors: Cell State Trumps the Oncogenic Driver Matthew G
    Published OnlineFirst January 26, 2018; DOI: 10.1158/1078-0432.CCR-17-3646 CCR Translations Clinical Cancer Research Small-Cell Neuroendocrine Tumors: Cell State Trumps the Oncogenic Driver Matthew G. Oser1,2 and Pasi A. Janne€ 1,2,3 Small-cell neuroendocrine cancers often originate in the lung SCCB and SCLC share common genetic driver mutations. but can also arise in the bladder or prostate. Phenotypically, Clin Cancer Res; 24(8); 1775–6. Ó2018 AACR. small-cell carcinoma of the bladder (SCCB) shares many simi- See related article by Chang et al., p. 1965 larities with small-cell lung cancer (SCLC). It is unknown whether In this issue of Clinical Cancer Research, Chang and colleagues ponent, suggesting that RB1 and TP53 loss occurs after the initial (1) perform DNA sequencing to characterize the mutational development of the urothelial carcinoma and is required for signature of small-cell carcinoma of the bladder (SCCB). They transdifferentiation from urothelial cancer to SCCB. This is rem- find that both SCCB and small-cell lung cancer (SCLC) harbor iniscent of a similar phenomenon observed in two other tumors near universal loss-of-function mutations in RB1 and TP53.In types: (i) EGFR-mutant lung cancer and (ii) castration-resistant contrast to the smoking mutational signature found in SCLC, prostate cancer, where RB1 and TP53 loss is necessary for the SCCB has an APOBEC mutational signature, a signature also transdifferentiation from an adenocarcinoma to a small-cell neu- found in urothelial carcinoma. Furthermore, they show that SCCB roendocrine tumor. EGFR-mutant lung cancers acquire RB1 loss as and urothelial carcinoma share many common mutations that are a mechanism of resistance to EGFR tyrosine kinase inhibitors (3), distinct from mutations found in SCLC, suggesting that SCCB and castration-resistant prostate cancers acquire RB1 and TP53 may arise from a preexisting urothelial cancer.
    [Show full text]