DOCSLIB.ORG

Reprogramming of Nucleotide Metabolism Mediates Synergy Between Epigenetic Therapy and MAP Kinase Inhibition

Total Page：16

File Type：pdf, Size：1020Kb

Download full-text PDF Read full-text
Reprogramming of Nucleotide Metabolism Mediates Synergy Between Epigenetic Therapy and MAP Kinase Inhibition Published OnlineFirst October 21, 2020; DOI: 10.1158/1535-7163.MCT-20-0259 MOLECULAR CANCER THERAPEUTICS | SMALL MOLECULE THERAPEUTICS Reprogramming of Nucleotide Metabolism Mediates Synergy between Epigenetic Therapy and MAP Kinase Inhibition A C Tatiana Shorstova1, Jie Su1, Tiejun Zhao1, Michael Dahabieh1, Matthew Leibovitch1, Mariana De Sa Tavares Russo2, Daina Avizonis2, Shivshankari Rajkumar3, Ian R. Watson3, Sonia V. del Rincon 1, Wilson H. Miller Jr1, William D. Foulkes1,4, and Michael Witcher1 ABSTRACT ◥ Small cell carcinoma of the ovary, hypercalcemic type synergy is also observed in some SMARCA4-expressing ovarian (SCCOHT) is a rare but often lethal cancer that is diagnosed at a adenocarcinoma models intrinsically resistant to BETi. Mass spec- median age of 24 years. Optimal management of patients is not well trometry, coupled with knockdown of newly found targets such as defined, and current treatment remains challenging, necessitating thymidylate synthase, revealed that the repression of a panel of the discovery of novel therapeutic approaches. The identification of proteins involved in nucleotide synthesis underlies this synergy SMARCA4-inactivating mutations invariably characterizing this both in vitro and in vivo, resulting in reduced pools of nucleotide type of cancer provided insights facilitating diagnostic and thera- metabolites and subsequent cell-cycle arrest. Overall, our data peutic measures against this disease. We show here that the BET indicate that dual treatment with BETi and MEKi represents a inhibitor OTX015 acts in synergy with the MEK inhibitor cobime- rational combination therapy against SCCOHT and potentially tinib to repress the proliferation of SCCOHT in vivo. Notably, this additional ovarian cancer subtypes. Introduction others (3). The identification of a central role for SMARCA4 mutations in the pathogenesis of this tumor (4, 5), and subsequent use of Small cell carcinoma of the ovary, hypercalcemic type (SCCOHT) is SMARCA4 (BRG1) IHC, with or without using antibodies raised an aggressive malignant tumor with a dismal prognosis (1). The mean against SMARCA2 (BRM) has greatly facilitated the diagnosis (6). age at diagnosis is approximately 24 years, and most patients die within Most SMARCA4 mutations in SCCOHT are deleterious resulting in 2 years of diagnosis. For SCCOHT, treatment generally involves a complete loss of protein expression, being confirmed by IHC in surgery and adjuvant chemotherapy, most commonly platinum- almost 100% of cases (4, 6). SMARCA4 and its paralog SMARCA2 are based compounds. Despite combination chemotherapy approaches, essential ATPase components of the multisubunit SWI/SNF (SWItch/ however, the prognosis still remains poor with overall 5-year survival Sucrose Non-Fermentable) chromatin remodeling complex and mod- rates of only 16% (2). Moving forward, personalized therapies for ify histone–DNA interactions by shifting or evicting nucleosomes to SCCOHT will require proper diagnosis and the identification of change the landscape of accessible regions on chromatin, thereby oncogenic drivers of these carcinomas. Differentiating SCCOHT from affecting transcriptional activation (7). SMARCA2 is concomitantly morphologically similar tumors is challenging. The “small” and “large” lost with SMARCA4 in almost all SCCOHT cases, and this profile now variants are fairly analogous (3), and SCCOHT also needs to be constitutes a molecular signature of the disease (6). distinguished from other primary and metastatic tumors that may Previously, it was shown that SMARCA4 and another bromodo- be found within the same tissue including nonepithelial ovarian main protein BRD4 independently associate with distal enhancer neoplasms and metastases from small cell lung carcinoma among elements of c-MYC in order to activate oncogene transcription, suggesting some redundancy between these two proteins in gene 1Departments of Oncology and Experimental Medicine, McGill University, Lady regulation and tumorigenesis (8). This led us to hypothesize that in Davis Institute and Segal Cancer Centre, Jewish General Hospital, Montreal, the absence of SMARCA4 and SMARCA2, BRD family members Quebec, Canada. 2Goodman Cancer Research Centre’s (GCRC) Metabolomics might represent essential proteins for driving transcriptional networks Facility, McGill University, Montreal, Quebec, Canada. 3Department of Biochem- involved in proliferation and survival (9). Thus, targeting SMARCA4- istry, Goodman Research Centre, McGill University, Montreal, Quebec, Canada. deficient cancers with bromodomain inhibitors (BETi), that target 4 Departments of Oncology and Human Genetics, McGill University, Lady Davis multiple BRD proteins, might effectively shut down this BRD-driven Institute and Segal Cancer Centre, Jewish General Hospital, Montreal, Quebec, fi Canada. oncogenic network. We demonstrated that SMARCA4/A2-de cient SCCOHT and non–small cell lung cancer (NSCLC) models were Note: Supplementary data for this article are available at Molecular Cancer acutely sensitive to BET inhibitors in vitro and in mouse models at Therapeutics Online (http://mct.aacrjournals.org/). very low doses (9). Notably, this work revealed that BETi efficacy Corresponding Author: Michael Witcher, Lady Davis Institute and Segal Cancer correlated with repression of PI3K and MAPK pathways. This is Centre, Jewish General Hospital, McGill University, 3755 Chemin de la Cote- Sainte-Catherine, Montreal, Quebec H3T1E2, Canada. Phone: 514-340-8222, ext. consistent with other studies suggesting that intrinsic resistance to 23363; Fax: 514-340-7502; E-mail: [email protected] BETi is conferred by constitutive signaling through receptor tyrosine kinase pathways including PI3K and MAPK (10–12). Recently, it was Mol Cancer Ther 2021;20:64–75 shown that NRAS-mutant melanoma models displayed resistance to doi: 10.1158/1535-7163.MCT-20-0259 BETi. In turn, combining BETi with MEKi led to decreased cell Ó2020 American Association for Cancer Research. proliferation in vitro and was also effective against melanomas AACRJournals.org | 64 Downloaded from mct.aacrjournals.org on September 29, 2021. © 2021 American Association for Cancer Research. Published OnlineFirst October 21, 2020; DOI: 10.1158/1535-7163.MCT-20-0259 Combination BETi/MEKi Treatments in Ovarian Cancer carrying NRAS mutations in vivo (13). The precise mechanism Francois-Michel¸ Boisvert (Department of Anatomy and Cell Biology, through which this combination works, and whether this approach Universite de Sherbrooke). Next, the cells were exposed to 0.01% may be applicable to additional tumor types, remains unclear. DMSO, OTX015 (200 nmol/L), and cobimetinib (200 nmol/L) alone Here, we screened a range of inhibitors targeting PI3K and MAPK or in combination. After 24 hours of treatment, the cell pellets were pathways for potential synergy with BETi against a panel of frozen in liquid nitrogen and sent for the stable isotope labeling by SMARCA4-deficient and SMARCA4-expressing ovarian cancer cell amino acids in cell culture (SILAC) analysis to the Department of lines. Among all the tested compounds, we found a strong synergy Anatomy and Cell Biology, Universite de Sherbrooke. The analysis was between BETi (OTX015) and MEK inhibitors (cobimetinib and performed precisely as previously described (15). Perseus program was trametinib) at suboptimal doses in both ovarian cancer models. used for statistical analysis. The data were obtained from 3 replicates This combination also proved highly effective against orthotopic with log2 fold change > 0.5 and P value ≤ 0.05. Volcano plots were xenograft models of ovarian cancer. Using mass spectrometry to generated with Instant Clue. The data are available at the PRIDE assess changes in protein content after exposure to combination database (accession #PXD017581). therapy revealed that concurrent treatment with BETi/MEKi represses key enzymes involved in nucleotide metabolism. A con- Co-immunoprecipitation comitant decrease in nucleotide pools was validated using meta- Co-immunoprecipitation (co-IP) experiments were performed as bolomics profiling. This culminates in a reduced pool of nucleotide described previously (16). The HEK293T cells were transfected, using precursors and cell-cycle arrest. Overall, the combination of BETi/ polyethylenimine, with cDNAs encoding TYMS-Flag, Ubiquitin-HA, MEKi highlights a potential new therapeutic approach to treat and subsequently treated for 20 hours with MG132 (7 mmol/L), multiple subtypes of ovarian tumors. OTX015 (200 nmol/L), and/or Cobimetinib (200 nmol/L). Subse- quently, cells were collected, lysed, and immunoprecipitation carried out using antibodies against either FLAG or HA tags. Materials and Methods Cell culture In vivo experiments The OVK18 cell line was received from the RIKEN cell bank. Animal experiments were performed following guidelines of The SCCOHT1 cell line was a gift from Dr. Ralf Hass (Hannover the Canadian Council of Animal Care and approved by the Medical School, Hannover, Germany). OVCAR4, OVCAR3, SKOV3, Animal Resources Centre at McGill University. Five-week-old female IGROV1, and HEK293T were purchased from the ATCC. The cell NOD/SCID mice were injected with 5 Â 106 of OVK18 cells or 1 Â 107 lines were grown in RPMI-1640 medium supplemented with 10% FBS. of OVCAR4 cells in 1xPBS into left ovary via laparotomy. Treatments The culture medium for HEK293T cells was DMEM with 10% FBS. with vehicle, 20 mg/kg/day of OTX015 and 5 mg/kg/day of The cell lines were cultured for a maximum of 3 weeks. The
Load more

Recommended publications
  • Differential Control of Dntp Biosynthesis and Genome Integrity
    www.nature.com/scientificreports OPEN Diferential control of dNTP biosynthesis and genome integrity maintenance by the dUTPase Received: 6 November 2015 Accepted: 12 June 2017 superfamily enzymes Published online: 20 July 2017 Rita Hirmondo1, Anna Lopata1, Eva Viola Suranyi1,2, Beata G. Vertessy1,2 & Judit Toth1 dUTPase superfamily enzymes generate dUMP, the obligate precursor for de novo dTTP biosynthesis, from either dUTP (monofunctional dUTPase, Dut) or dCTP (bifunctional dCTP deaminase/dUTPase, Dcd:dut). In addition, the elimination of dUTP by these enzymes prevents harmful uracil incorporation into DNA. These two benefcial outcomes have been thought to be related. Here we determined the relationship between dTTP biosynthesis (dTTP/dCTP balance) and the prevention of DNA uracilation in a mycobacterial model that encodes both the Dut and Dcd:dut enzymes, and has no other ways to produce dUMP. We show that, in dut mutant mycobacteria, the dTTP/dCTP balance remained unchanged, but the uracil content of DNA increased in parallel with the in vitro activity-loss of Dut accompanied with a considerable increase in the mutation rate. Conversely, dcd:dut inactivation resulted in perturbed dTTP/dCTP balance and two-fold increased mutation rate, but did not increase the uracil content of DNA. Thus, unexpectedly, the regulation of dNTP balance and the prevention of DNA uracilation are decoupled and separately brought about by the Dcd:dut and Dut enzymes, respectively. Available evidence suggests that the discovered functional separation is conserved in humans and other organisms. Proper control of the intracellular concentration of deoxyribonucleoside-5-triphosphates (dNTPs), the building blocks of DNA, is critically important for efcient and high-fdelity DNA replication and genomic stability1, 2.
    [Show full text]
  • DUT (NM 001948) Human Tagged ORF Clone Product Data
    OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for RC221635 DUT (NM_001948) Human Tagged ORF Clone Product data: Product Type: Expression Plasmids Product Name: DUT (NM_001948) Human Tagged ORF Clone Tag: Myc-DDK Symbol: DUT Synonyms: dUTPase Vector: pCMV6-Entry (PS100001) E. coli Selection: Kanamycin (25 ug/mL) Cell Selection: Neomycin ORF Nucleotide >RC221635 representing NM_001948 Sequence: Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGCCCTGCTCTGAAGAGACACCCGCCATTTCACCCAGTAAGCGGGCCCGGCCTGCGGAGGTGGGCGGCA TGCAGCTCCGCTTTGCCCGGCTCTCCGAGCACGCCACGGCCCCCACCCGGGGCTCCGCGCGCGCCGCGGG CTACGACCTGTACAGTGCCTATGATTACACAATACCACCTATGGAGAAAGCTGTTGTGAAAACGGACATT CAGATAGCGCTCCCTTCTGGGTGTTATGGAAGAGTGGCTCCACGGTCAGGCTTGGCTGCAAAACACTTTA TTGATGTAGGAGCTGGTGTCATAGATGAAGATTATAGAGGAAATGTTGGTGTTGTACTGTTTAATTTTGG CAAAGAAAAGTTTGAAGTCAAAAAAGGTGATCGAATTGCACAGCTCATTTGCGAACGGATTTTTTATCCA GAAATAGAAGAAGTTCAAGCCTTGGATGACACCGAAAGGGGTTCAGGAGGTTTTGGTTCCACTGGAAAGA AT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA Protein Sequence: >RC221635 representing NM_001948 Red=Cloning site Green=Tags(s) MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDI QIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYP EIEEVQALDDTERGSGGFGSTGKN myc-FLAG tag Chromatograms:
    [Show full text]
  • Crucial Roles of Thymidine Kinase 1 and Deoxyutpase in Incorporating the Antineoplastic Nucleosides Trifluridine and 2'-Deoxy-5-Fluorouridine Into DNA
    INTERNATIONAL JOURNAL OF ONCOLOGY 46: 2327-2334, 2015 Crucial roles of thymidine kinase 1 and deoxyUTPase in incorporating the antineoplastic nucleosides trifluridine and 2'-deoxy-5-fluorouridine into DNA KAzUKI SAKAMoTo, Tatsushi YoKogAwA, HIRoYUKI UENo, KEI ogUcHI, HIRoMI KAzUNo, KEIJI ISHIDA, NozoMU TANAKA, AKIKo oSADA, YUKARI YAMADA, HIRoYUKI oKABE and KENIcHI Matsuo Drug Discovery and Development I, Discovery and Preclinical Research Division, Taiho Pharmaceutical co., Ltd., Tsukuba, Ibaraki 300-2611, Japan Received March 6, 2015; Accepted April 9, 2015 DoI: 10.3892/ijo.2015.2974 Abstract. Trifluridine (FTD) and 2'-deoxy-5-fluorouridine transported into cells by ENT1 and ENT2 and were phosphor- (FdUrd), a derivative of 5-fluorouracil (5-FU), are antitumor ylated by thymidine kinase 1, which showed a higher catalytic agents that inhibit thymidylate synthase activity and their activity for FTD than for FdUrd. deoxyUTPase (DUT) did not nucleotides are incorporated into DNA. However, it is evident recognize dTTP and FTD-triphosphate (F3dTTP), whereas that several differences occur in the underlying antitumor deoxyuridine-triphosphate (dUTP) and FdUrd-triphosphate mechanisms associated with these nucleoside analogues. (FdUTP) were efficiently degraded by DUT. DNA poly- Recently, TAS-102 (composed of FTD and tipiracil hydrochlo- merase α incorporated both F3dTTP and FdUTP into DNA at ride, TPI) was shown to prolong the survival of patients with sites aligned with adenine on the opposite strand. FTD-treated colorectal cancer who received a median of 2 prior therapies, cells showed differing nuclear morphologies compared to including 5-FU. TAS-102 was recently approved for clinical FdUrd-treated cells. These findings indicate that FTD and use in Japan.
    [Show full text]
  • Electronic Reprint Phosphorylation Adjacent to the Nuclear Localization
    electronic reprint Acta Crystallographica Section D Biological Crystallography ISSN 0907-4449 Phosphorylation adjacent to the nuclear localization signal of human dUTPase abolishes nuclear import: structural and mechanistic insights Gergely Rona,´ Mary Marfori, Mat´ e´ Borsos, Ildiko´ Scheer, EnikoTak˝ acs,´ Judit Toth,´ Fruzsina Babos, Anna Magyar, Anna Erdei, Zoltan´ Bozoky,´ Laszl´ o´ Buday, Bostjan Kobe and Beata´ G. Vertessy´ Acta Cryst. (2013). D69, 2495–2505 Copyright c International Union of Crystallography Author(s) of this paper may load this reprint on their own web site or institutional repository provided that this cover page is retained. Republication of this article or its storage in electronic databases other than as specified above is not permitted without prior permission in writing from the IUCr. For further information see http://journals.iucr.org/services/authorrights.html Acta Crystallographica Section D: Biological Crystallography welcomes the submission of papers covering any aspect of structural biology, with a particular emphasis on the struc- tures of biological macromolecules and the methods used to determine them. Reports on new protein structures are particularly encouraged, as are structure–function papers that could include crystallographic binding studies, or structural analysis of mutants or other modified forms of a known protein structure. The key criterion is that such papers should present new insights into biology, chemistry or structure. Papers on crystallo- graphic methods should be oriented towards biological crystallography, and may include new approaches to any aspect of structure determination or analysis. Papers on the crys- tallization of biological molecules will be accepted providing that these focus on new methods or other features that are of general importance or applicability.
    [Show full text]
  • Regulation of Human Dutpase Gene Expression and P53-Mediated Transcriptional Repression in Response to Oxaliplatin-Induced DNA Damage Peter M
    78–95 Nucleic Acids Research, 2009, Vol. 37, No. 1 Published online 16 November 2008 doi:10.1093/nar/gkn910 Regulation of human dUTPase gene expression and p53-mediated transcriptional repression in response to oxaliplatin-induced DNA damage Peter M. Wilson1, William Fazzone1, Melissa J. LaBonte1, Heinz-Josef Lenz2 and Robert D. Ladner1,* 1Department of Pathology and 2Division of Medical Oncology, Norris Comprehensive Cancer Center, Keck School of Medicine, University of Southern California, Los Angeles, CA 90033, USA Received May 19, 2008; Revised October 28, 2008; Accepted October 29, 2008 ABSTRACT INTRODUCTION Deoxyuridine triphosphate nucleotidohydrolase Deoxyuridine triphosphate nucleotidohydrolase (dUT (dUTPase) catalyzes the hydrolysis of dUTP to Pase) is the sole enzyme responsible for the hydrolysis of dUMP and PPi. Although dUTP is a normal intermedi- dUTP to dUMP and pyrophosphate simultaneously pro- ate in DNA synthesis, its accumulation and misincor- viding substrate for thymidylate synthase (TS) and elim- poration into DNA is lethal. Importantly, uracil inating dUTP from the DNA biosynthetic pathway. Although dUTP is a normal intermediate in DNA synth- misincorporation is a mechanism of cytotoxicity esis, its extensive accumulation and misincorporation induced by fluoropyrimidine chemotherapeutic into DNA is lethal in both prokaryotic and eukaryotic agents including 5-fluorouracil (5-FU) and elevated organisms as evidenced from knockout models (1,2). expression of dUTPase is negatively correlated Importantly, uracil misincorporation also represents with clinical response to 5-FU-therapy. In this study a major mechanism of cytotoxicity induced by the we performed the first functional characterization of TS-inhibitor class of chemotherapeutic agents including the dUTPase promoter and demonstrate a role for the fluoropyrimidines 5-fluorouracil (5-FU), fluorodeox- E2F-1 and Sp1 in driving dUTPase expression.
    [Show full text]
  • Targeting Nucleotide Metabolism Enhances the Efficacy of Anthracyclines and Anti-Metabolites in Triple-Negative Breast Cancer
    www.nature.com/npjbcancer ARTICLE OPEN Targeting nucleotide metabolism enhances the efficacy of anthracyclines and anti-metabolites in triple-negative breast cancer Craig Davison1, Roisin Morelli1, Catherine Knowlson1, Melanie McKechnie1, Robbie Carson1, Xanthi Stachtea1, Kylie A. McLaughlin2, Vivien E. Prise2, Kienan Savage 1, Richard H. Wilson3, Karl A. Mulligan2, Peter M. Wilson2, Robert D. Ladner1,5 and ✉ Melissa J. LaBonte 1,4,5 Triple-negative breast cancer (TNBC) remains the most lethal breast cancer subtype with poor response rates to the current chemotherapies and a lack of additional effective treatment options. We have identified deoxyuridine 5′-triphosphate nucleotidohydrolase (dUTPase) as a critical gatekeeper that protects tumour DNA from the genotoxic misincorporation of uracil during treatment with standard chemotherapeutic agents commonly used in the FEC regimen. dUTPase catalyses the hydrolytic dephosphorylation of deoxyuridine triphosphate (dUTP) to deoxyuridine monophosphate (dUMP), providing dUMP for thymidylate synthase as part of the thymidylate biosynthesis pathway and maintaining low intracellular dUTP concentrations. This is crucial as DNA polymerase cannot distinguish between dUTP and deoxythymidylate triphosphate (dTTP), leading to dUTP misincorporation into DNA. Targeting dUTPase and inducing uracil misincorporation during the repair of DNA damage induced by fluoropyrimidines or anthracyclines represents an effective strategy to induce cell lethality. dUTPase inhibition significantly sensitised TNBC cell lines 1234567890():,; to fluoropyrimidines and anthracyclines through imbalanced nucleotide pools and increased DNA damage leading to decreased proliferation and increased cell death. These results suggest that repair of treatment-mediated DNA damage requires dUTPase to prevent uracil misincorporation and that inhibition of dUTPase is a promising strategy to enhance the efficacy of TNBC chemotherapy.
    [Show full text]
  • The Role of a Key Amino Acid Position in Species- Specific Proteinaceous Dutpase Inhibition
    Article The Role of a Key Amino Acid Position in Species- Specific Proteinaceous dUTPase Inhibition András Benedek 1,2,*, Fanni Temesváry-Kis 1, Tamjidmaa Khatanbaatar 1, Ibolya Leveles 1,2, Éva Viola Surányi 1,2, Judit Eszter Szabó 1,2, Lívius Wunderlich 1 and Beáta G. Vértessy 1,2,* 1 Budapest University of Technology and Economics, Department of Applied Biotechnology and Food Science, H -1111 Budapest, Szent Gellért tér 4, Hungary; [email protected] (F.T-K.); [email protected] (T.K.); [email protected] (L.W.) 2 Research Centre for Natural Sciences, Hungarian Academy of Sciences, H-1117 Budapest, Magyar tudósok körútja 2, Hungary; [email protected] (I.L.); [email protected] (É.V.S.); [email protected] (J.E.S.) * Correspondence: [email protected] (A.B.); [email protected] (B.G.V.) Received: 14 May 2019; Accepted: 27 May 2019; Published: 6 June 2019 Abstract: Protein inhibitors of key DNA repair enzymes play an important role in deciphering physiological pathways responsible for genome integrity, and may also be exploited in biomedical research. The staphylococcal repressor StlSaPIbov1 protein was described to be an efficient inhibitor of dUTPase homologues showing a certain degree of species-specificity. In order to provide insight into the inhibition mechanism, in the present study we investigated the interaction of StlSaPIbov1 and Escherichia coli dUTPase. Although we observed a strong interaction of these proteins, unexpectedly the E. coli dUTPase was not inhibited. Seeking a structural explanation for this phenomenon, we identified a key amino acid position where specific mutations sensitized E.
    [Show full text]
  • CRISPR/Cas9-Mediated Knock-Out of Dutpase in Mice Leads to Early Embryonic Lethality
    bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. CRISPR/Cas9-mediated knock-out of dUTPase in mice leads to early embryonic lethality Hajnalka Laura Pálinkás1,2*, Gergely Rácz 1,3, Zoltán Gál4, Orsolya Hoffmann4, Gergely Tihanyi1,3, Elen Gócza4*, László Hiripi4*, Beáta G. Vértessy1,3* *Corresponding authors 1Institute of Enzymology, RCNS, Hungarian Academy of Sciences, Budapest, Hungary 2Doctoral School of Multidisciplinary Medical Science, University of Szeged, Szeged, Hungary 3Department of Applied Biotechnology and Food Sciences, Budapest University of Technology and Economics, Budapest, Hungary 4Department of Animal Biotechnology, Agricultural Biotechnology Institute, National Agricultural Research and Innovation Centre, Gödöllő, Hungary Correspondence and requests for materials should be addressed to Beáta G. Vértessy (email: [email protected]). Correspondence may also be addressed to Hajnalka Laura Pálinkás ([email protected]), Elen Gócza ([email protected]), and László Hiripi ([email protected]). 1 bioRxiv preprint doi: https://doi.org/10.1101/335422; this version posted May 31, 2018. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Abstract Sanitization of nucleotide pools is essential for genome maintenance. Among the enzymes significant in this mechanism, deoxyuridine 5'-triphosphate nucleotidohydrolase (dUTPase) performs cleavage of dUTP into dUMP and inorganic pyrophosphate. By this reaction the enzyme efficiently prevents uracil incorporation into DNA and provides dUMP, the substrate for de novo thymidylate biosynthesis.
    [Show full text]
  • The Relationship Between Dntp Pool Levels and Mutagenesis in an Escherichia Coli NDP Kinase Mutant
    The relationship between dNTP pool levels and mutagenesis in an Escherichia coli NDP kinase mutant Jared Nordman and Andrew Wright* Department of Molecular Biology and Microbiology, Tufts University School of Medicine, 136 Harrison Avenue, Boston, MA 02111 Edited by Jonathan Beckwith, Harvard Medical School, Boston, MA, and approved May 6, 2008 (received for review March 27, 2008) Loss of nucleoside diphosphate kinase (Ndk) function in Escherichia The human genome contains eight Ndk paralogues, Nm23 coli results in an increased frequency of spontaneous mutation and H1–H8, which have been implicated in multiple cellular pro- an imbalance in dNTP pool levels. It is presumed that the imbalance cesses. For example, human NDP kinase (nm23-H1) was initially in dNTP pool levels is responsible for the mutator phenotype of an identified as a suppressor of tumor metastasis by using meta- E. coli ndk mutant. A human homologue of Ndk and potential static melanoma cell lines (17). Nm23-H2 has been shown to suppressor of tumor metastasis, nm23-H2, can complement the cleave DNA in a mechanism similar to that of the AP lyase family mutagenic phenotype of an E. coli ndk mutant. Here, we show that of DNA repair enzymes, and directly regulate expression of the the antimutagenic property of nm23-H2 in E. coli is independent of c-MYC oncogene (18, 19). Mutational loss of NDP kinase dNTP pool levels, indicating that dNTP pool imbalance is not function in Drosophila leads to developmental defects (20). responsible for the mutator phenotype associated with the loss of Interestingly, restoration of NDP kinase enzymatic activity is ndk function.
    [Show full text]
  • Disruption of Nucleocytoplasmic Trafficking As a Cellular Senescence
    www.nature.com/emm ARTICLE OPEN Disruption of nucleocytoplasmic trafficking as a cellular senescence driver Ji-Hwan Park1,14, Sung Jin Ryu2,13,14, Byung Ju Kim3,13,14, Hyun-Ji Cho3, Chi Hyun Park4, Hyo Jei Claudia Choi2, Eun-Jin Jang3, Eun Jae Yang5, Jeong-A Hwang5, Seung-Hwa Woo5, Jun Hyung Lee5, Ji Hwan Park5, Kyung-Mi Choi6, Young-Yon Kwon6, 6 7 3 3 8 9 10 5 ✉ Cheol-Koo Lee , Joon✉ Tae Park , Sung✉ Chun Cho , Yun-Il Lee , Sung✉ Bae Lee , Jeong A. Han , Kyung A. Cho , Min-Sik Kim , Daehee Hwang11 , Young-Sam Lee3,5 and Sang Chul Park3,12 © The Author(s) 2021 Senescent cells exhibit a reduced response to intrinsic and extrinsic stimuli. This diminished reaction may be explained by the disrupted transmission of nuclear signals. However, this hypothesis requires more evidence before it can be accepted as a mechanism of cellular senescence. A proteomic analysis of the cytoplasmic and nuclear fractions obtained from young and senescent cells revealed disruption of nucleocytoplasmic trafficking (NCT) as an essential feature of replicative senescence (RS) at the global level. Blocking NCT either chemically or genetically induced the acquisition of an RS-like senescence phenotype, named nuclear barrier-induced senescence (NBIS). A transcriptome analysis revealed that, among various types of cellular senescence, NBIS exhibited a gene expression pattern most similar to that of RS. Core proteomic and transcriptomic patterns common to both RS and NBIS included upregulation of the endocytosis-lysosome network and downregulation of NCT in senescent cells, patterns also observed in an aging yeast model.
    [Show full text]
  • Uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer
    A Predictive Signature for Oxaliplatin and 5- uorouracil Based Chemotherapy Inlocally Advanced Gastric Cancer Qinchuan Wang Zhejiang University https://orcid.org/0000-0002-2370-6714 Xiyong Liu City of Hope National Medical Center Chen Chen Zhejiang University Jida Chen Zhejiang University Beisi Xu Saint Jude Children's Research Hospital Lini Chen Zhejiang University Jichun Zhou Zhejiang University Yasheng Huang Hangzhou Hospital of Traditional Chinese Medicine Wenjun Chen Zhejiang University Rongyue Teng Zhejiang University Wenhe Zhao Zhejiang University Lidan Jin Zhejiang University Jun Shen Zhejiang University Jianguo Shen Zhejiang University Yun Yen ( [email protected] ) Linbo Wang Zhejiang University Page 1/23 Research Keywords: Locally advanced gastric cancer, adjuvant chemotherapy, overall survival, prediction, mutation Posted Date: June 12th, 2020 DOI: https://doi.org/10.21203/rs.3.rs-34678/v1 License: This work is licensed under a Creative Commons Attribution 4.0 International License. Read Full License Page 2/23 Abstract Background: Adjuvantchemotherapy(AC)plays a substantial role in the treatment of locally advanced gastric cancer (LAGC), but the response remains poor. Weaims to improve its ecacy in LAGC. Methods: We identied the expression of eight genes closely associated with platinum and uorouracil metabolism (RRM1, RRM2, RRM2B, POLH, DUT, TYMS, TYMP, MKI67) in the discovery cohort (N=291). And we further validated the ndings in TCGA (N=279) and GEO. Overall survival (OS) was used as an endpoint. Univariate and multivariate Cox models were applied. A multivariate Cox regression model was simulated to predict theOS. Results: In the discovery cohort,the univariate Coxmodelindicated that AC was benecial to high-RRM1, high-DUT, low-RRM2, low-RRM2B, low-POLH, low-KI67, low-TYMS or low-TYMP patients, the results were validated in the TCGA cohort.
    [Show full text]
  • Novel Opportunities for Thymidylate Metabolism As a Therapeutic Target
    3029 Novel opportunities for thymidylate metabolism as a therapeutic target Peter M. Wilson,1 William Fazzone,1 small-molecule inhibitor to dUTPase represents a viable Melissa J. LaBonte,1 Jinxia Deng,2 strategy to improve the clinical efficacy of these mainstay Nouri Neamati,2 and Robert D. Ladner1 chemotherapeutic agents. [Mol Cancer Ther 2008; 7(9):3029–37] 1Department of Pathology, Norris Comprehensive Cancer Center, Keck School of Medicine, and 2Department of Pharmacology and Pharmaceutical Sciences, School of Pharmacy, University of Southern California, Los Angeles, California Introduction The fluoropyrimidine 5-fluorouracil (5-FU) is widely used in the treatment of a range of cancers, including breast Abstract cancers, and cancers of the aerodigestive and gastrointes- For over 40 years, the fluoropyrimidine 5-fluorouracil tinal tract (1). However, 5-FU has had the greatest effect (5-FU) has remained the central agent in therapeutic and is arguably the most successful drug approved to date regimens employed in the treatment of colorectal cancer for the treatment of colorectal cancer. Throughout 50 years and is frequently combined with the DNA-damaging of clinical development, the response rate of advanced agents oxaliplatin and irinotecan, increasing response colorectal cancer chemotherapy using 5-FU and 5-FU-based rates and improving overall survival. However, many combinations has improved from 10% to 15% to 40% to patients will derive little or no benefit from treatment, 50% primarily due to the introduction of efficacious combi- highlighting the need to identify novel therapeutic targets nation partners such as the topoisomerase I inhibitor to improve the efficacy of current 5-FU-based chemother- irinotecan and the platinum agent oxaliplatin and deter- apeutic strategies.
    [Show full text]