ATAGENIX LABORATORIES

Catalog Number:ATMA10033Mo Anti ECP1-trx mouse monoclonal antibody

Product overview product name Anti ECP1-trx mouse monoclonal antibody catalog No. ATMA10033Mo

Category Primary antibody

Host Mouse

Species specificity Escherichia coli

Tested applications Elisa,IHC

Clonality Monoclonal

Clone No. 52-C-11

Conjugation Unconjugate

Immunogen MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKMSLQKTVEKLFDELDKDKSGKISCAELKSALQSCSAEPLDDDHVKAFLDKLDSNKDGELSLDELMALF

Alternative Names Calcium-binding SPEC 2C

Uniprot ID P0AA25

Product performance

Form Liquid

Buffer PBS, pH7.4, containing 0.05% proclin300, 50% glycerol.

Storage Use a manual defrost freezer and avoid repeated freeze thaw cycles.

Store at 4 °C for frequent use.

Store at -20 to -80 °C for twelve months from the date of receipt.

Concentration 1mg/ml

Isotype IgG1

MW 12 kDa

Purity Protein G purified from mice ascites

Dilution range

Elisa:1:1000~5000,IHC:1:50~100

Reference

PMID: 4883076,PMID: 10947986

Web:www.atagenix.com E-mail: [email protected] Tel: 027-87433958 ATAGENIX LABORATORIES

Catalog Number:ATMA10033Mo Anti ECP1-trx mouse monoclonal antibody

Product background

Calcium-binding are proteins that participate in calcium cell signalling pathways by binding to Ca2+, the calcium ion that plays an important role in many cellular processes. Calcium binding proteins have specific domains that bind to calcium and are known to be heterogenous.One of the functions of Calcium binding proteins is to regulate the amount of free (unbound)

Ca2+ in the cytosol of the cell. Regulation of Ca(2+) is known as Calcium homeostasis. Ca(2+) binding proteins can be either intracellular and extracellular. Those that are intracellular can contain or lack a structural EF- hand domain. Extra cellular calcium binding proteins are classified into six groups. Since Ca (2+) is an important second messenger, it can act as an activator or inhibitor in gene transcription. Those that belong to the EF-hand superfamily such as and Calcineurin have been linked to transcription regulation. When levels of Ca(2+) increase in the cell, these members of the EF-hand superfamily regulate transcription indirectly by phosphorylating/dephosphorylating transcription factors

With their role in , calcium-binding proteins contribute to all aspects of the cell's functioning, from homeostasis to learning and memory. For example, the neuron-specific calexcitin has been found to have an excitatory effect on neurons, and interacts with proteins that control the firing state of neurons, such as the voltage-dependent potassium channel. Compartmentalization of calcium binding proteins such as and -28 kDa has been noted within cells, suggesting that these proteins perform distinct functions in localized . It also indicates that in addition to freely diffusing through the cytoplasm to attain a homogeneous distribution, calcium binding proteins can bind to cellular structures through interactions that are likely important for their functions

Web:www.atagenix.com E-mail: [email protected] Tel: 027-87433958