SL18562R-FITC.Pdf

Total Page：16

File Type：pdf, Size：1020Kb

SunLong Biotech Co.,LTD Tel: 0086-571- 56623320 Fax:0086-571- 56623318 E-mail:[email protected] www.sunlongbiotech.com Rabbit Anti-Macro H2A.2/FITC Conjugated antibody SL18562R-FITC Product Name: Anti-Macro H2A.2/FITC Chinese Name: FITC标记的异型组蛋白H2A.2抗体 Core histone macro H2A2.2; Core histone macro-H2A.2; Core histone macroH2A2.2; Alias: H2A histone family member Y2; H2AFY2; H2AW_HUMAN; Histone macroH2A2; Macro H2A2; MacroH2A.2; MacroH2A2; mH2A2. Organism Species: Rabbit Clonality: Polyclonal React Species: Human,Mouse,Rat,Dog,Cow,Horse,Rabbit, ICC=1:50-200IF=1:50-200 Applications: not yet tested in other applications. optimal dilutions/concentrations should be determined by the end user. Molecular weight: 40kDa Form: Lyophilized or Liquid Concentration: 1mg/ml immunogen: KLH conjugated synthetic peptide derived from human Macro H2A.2 Lsotype: IgGwww.sunlongbiotech.com Purification: affinity purified by Protein A Storage Buffer: 0.01M TBS(pH7.4) with 1% BSA, 0.03% Proclin300 and 50% Glycerol. Store at -20 °C for one year. Avoid repeated freeze/thaw cycles. The lyophilized antibody is stable at room temperature for at least one month and for greater than a year Storage: when kept at -20°C. When reconstituted in sterile pH 7.4 0.01M PBS or diluent of antibody the antibody is stable for at least two weeks at 2-4 °C. Function: Variant histone H2A which replaces conventional H2A in a subset of nucleosomes where it represses transcription. Nucleosomes wrap and compact DNA into chromatin, Product Detail: limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. May be involved in stable X chromosome inactivation. Subcellular Location: Nucleus. Chromosome. Enriched in inactive X chromosome chromatin and in senescence-associated heterochromatin. Similarity: Contains 1 histone H2A domain. Contains 1 Macro domain. Database links: Entrez Gene: 55506 Human Entrez Gene: 404634 Mouse Entrez Gene: 361844 Rat SwissProt: Q9P0M6 Human SwissProt: Q8CCK0 Mouse Unigene: 499953 Human Unigene: 272870 Mouse Unigene: 163432 Rat Important Note: This product as supplied is intended for research use only, not for use in human, therapeuticwww.sunlongbiotech.com or diagnostic applications. .

Copy Link

Recommended publications

Identification of Novel Chemotherapeutic Strategies For
www.nature.com/scientificreports OPEN Identification of novel chemotherapeutic strategies for metastatic uveal melanoma Received: 17 November 2016 Paolo Fagone1, Rosario Caltabiano2, Andrea Russo3, Gabriella Lupo1, Accepted: 09 February 2017 Carmelina Daniela Anfuso1, Maria Sofia Basile1, Antonio Longo3, Ferdinando Nicoletti1, Published: 17 March 2017 Rocco De Pasquale4, Massimo Libra1 & Michele Reibaldi3 Melanoma of the uveal tract accounts for approximately 5% of all melanomas and represents the most common primary intraocular malignancy. Despite improvements in diagnosis and more effective local therapies for primary cancer, the rate of metastatic death has not changed in the past forty years. In the present study, we made use of bioinformatics to analyze the data obtained from three public available microarray datasets on uveal melanoma in an attempt to identify novel putative chemotherapeutic options for the liver metastatic disease. We have first carried out a meta-analysis of publicly available whole-genome datasets, that included data from 132 patients, comparing metastatic vs. non metastatic uveal melanomas, in order to identify the most relevant genes characterizing the spreading of tumor to the liver. Subsequently, the L1000CDS2 web-based utility was used to predict small molecules and drugs targeting the metastatic uveal melanoma gene signature. The most promising drugs were found to be Cinnarizine, an anti-histaminic drug used for motion sickness, Digitoxigenin, a precursor of cardiac glycosides, and Clofazimine, a fat-soluble iminophenazine used in leprosy. In vitro and in vivo validation studies will be needed to confirm the efficacy of these molecules for the prevention and treatment of metastatic uveal melanoma. Uveal melanoma is the most common primary intraocular cancer, and after the skin, the uveal tract is the second most common location for melanoma1.
[Show full text]
A Master Autoantigen-Ome Links Alternative Splicing, Female Predilection, and COVID-19 to Autoimmune Diseases
bioRxiv preprint doi: https://doi.org/10.1101/2021.07.30.454526; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. A Master Autoantigen-ome Links Alternative Splicing, Female Predilection, and COVID-19 to Autoimmune Diseases Julia Y. Wang1*, Michael W. Roehrl1, Victor B. Roehrl1, and Michael H. Roehrl2* 1 Curandis, New York, USA 2 Department of Pathology, Memorial Sloan Kettering Cancer Center, New York, USA * Correspondence: [email protected] or [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2021.07.30.454526; this version posted August 4, 2021. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY 4.0 International license. Abstract Chronic and debilitating autoimmune sequelae pose a grave concern for the post-COVID-19 pandemic era. Based on our discovery that the glycosaminoglycan dermatan sulfate (DS) displays peculiar affinity to apoptotic cells and autoantigens (autoAgs) and that DS-autoAg complexes cooperatively stimulate autoreactive B1 cell responses, we compiled a database of 751 candidate autoAgs from six human cell types. At least 657 of these have been found to be affected by SARS-CoV-2 infection based on currently available multi-omic COVID data, and at least 400 are confirmed targets of autoantibodies in a wide array of autoimmune diseases and cancer.
[Show full text]
The Histone Variant Macroh2a1 Regulates Key Genes for Myogenic Cell Fusion in a Splice-Isoform Dependent Manner
cells Article The Histone Variant MacroH2A1 Regulates Key Genes for Myogenic Cell Fusion in a Splice-Isoform Dependent Manner Sarah Hurtado-Bagès 1, Melanija Posavec Marjanovic 2, Vanesa Valero 1, Roberto Malinverni 1, David Corujo 1 , Philippe Bouvet 3 , Anne-Claire Lavigne 4 , Kerstin Bystricky 4 and Marcus Buschbeck 1,2,* 1 Cancer and Leukemia Epigenetics and Biology Program, Josep Carreras Leukaemia Research Institute (IJC), Campus ICO-GTP-UAB, 08916 Badalona, Spain; shb.scientifi[email protected] (S.H.-B.); [email protected] (V.V.); [email protected] (R.M.); [email protected] (D.C.) 2 Program for Predictive and Personalized Medicine of Cancer, Germans Trias i Pujol Research Institute (PMPPC-IGTP), 08916 Badalona, Spain; [email protected] 3 Université de Lyon, Ecole Normale Supérieure de Lyon, Centre Léon Bérard, Centre de Recherche en Cancérologie de Lyon, INSERM 1052, CNRS 5286, F-69008 Lyon, France; [email protected] 4 Center for Integrative Biology (CBI), LBME, University of Toulouse, UPS, CNRS, F-31062 Toulouse, France; [email protected] (A.-C.L.); [email protected] (K.B.) * Correspondence: [email protected]; Tel.: +34-93-557-2800 Received: 31 March 2020; Accepted: 23 April 2020; Published: 30 April 2020 Abstract: MacroH2A histone variants have functions in differentiation, somatic cell reprogramming and cancer. However, at present, it is not clear how macroH2As affect gene regulation to exert these functions. We have parted from the initial observation that loss of total macroH2A1 led to a change in the morphology of murine myotubes differentiated ex vivo. The fusion of myoblasts to myotubes is a key process in embryonic myogenesis and highly relevant for muscle regeneration after acute or chronic injury.
[Show full text]
Supplemental Data.Pdf
Supplementary material -Table of content Supplementary Figures (Fig 1- Fig 6) Supplementary Tables (1-13) Lists of genes belonging to distinct biological processes identified by GREAT analyses to be significantly enriched with UBTF1/2-bound genes Supplementary Table 14 List of the common UBTF1/2 bound genes within +/- 2kb of their TSSs in NIH3T3 and HMECs. Supplementary Table 15 List of gene identified by microarray expression analysis to be differentially regulated following UBTF1/2 knockdown by siRNA Supplementary Table 16 List of UBTF1/2 binding regions overlapping with histone genes in NIH3T3 cells Supplementary Table 17 List of UBTF1/2 binding regions overlapping with histone genes in HMEC Supplementary Table 18 Sequences of short interfering RNA oligonucleotides Supplementary Table 19 qPCR primer sequences for qChIP experiments Supplementary Table 20 qPCR primer sequences for reverse transcription-qPCR Supplementary Table 21 Sequences of primers used in CHART-PCR Supplementary Methods Supplementary Fig 1. (A) ChIP-seq analysis of UBTF1/2 and Pol I (POLR1A) binding across mouse rDNA. UBTF1/2 is enriched at the enhancer and promoter regions and along the entire transcribed portions of rDNA with little if any enrichment in the intergenic spacer (IGS), which separates the rDNA repeats. This enrichment coincides with the distribution of the largest subunit of Pol I (POLR1A) across the rDNA. All sequencing reads were mapped to the published complete sequence of the mouse rDNA repeat (Gene bank accession number: BK000964). The graph represents the frequency of ribosomal sequences enriched in UBTF1/2 and Pol I-ChIPed DNA expressed as fold change over those of input genomic DNA.
[Show full text]
The Role of Histone Variants in the Epithelial-To-Mesenchymal Transition
cells Review The Role of Histone Variants in the Epithelial-To-Mesenchymal Transition Imtiaz Nisar Lone 1, Burcu Sengez 1,2 , Ali Hamiche 3, Stefan Dimitrov 1,4 and Hani Alotaibi 1,2,* 1 Izmir Biomedicine and Genome Center, Izmir 35340, Turkey; [email protected] (I.N.L.); [email protected] (B.S.); [email protected] (S.D.) 2 Izmir International Biomedicine and Genome Institute, Dokuz Eylül University, Izmir 35340, Turkey 3 Institute of Genetics and Molecular and Cellular Biology (IGBMC), 1 rue Laurent Fries, 67400 Illkirch, France; [email protected] 4 Université Grenoble Alpes, CNRS UMR 5309, INSERM U1209, Institute for Advanced Biosciences (IAB), Site Santé-Allée des Alpes, 38700 La Tronche, France * Correspondence: [email protected]; Tel.: +90-232-299-4100 (ext. 5071) Received: 18 October 2020; Accepted: 14 November 2020; Published: 17 November 2020 Abstract: The epithelial-to-mesenchymal transition (EMT) is a physiological process activated during early embryogenesis, which continues to shape tissues and organs later on. It is also hijacked by tumor cells during metastasis. The regulation of EMT has been the focus of many research groups culminating in the last few years and resulting in an elaborate transcriptional network buildup. However, the implication of epigenetic factors in the control of EMT is still in its infancy. Recent discoveries pointed out that histone variants, which are key epigenetic players, appear to be involved in EMT control. This review summarizes the available data on histone variants’ function in EMT that would contribute to a better understanding of EMT itself and EMT-related diseases.
[Show full text]
Histone Variants — Ancient Wrap Artists of the Epigenome
REVIEWS CHROMATIN DYNAMICS Histone variants — ancient wrap artists of the epigenome Paul B. Talbert and Steven Henikoff Abstract | Histones wrap DNA to form nucleosome particles that compact eukaryotic genomes. Variant histones have evolved crucial roles in chromosome segregation, transcriptional regulation, DNA repair, sperm packaging and other processes. ‘Universal’ histone variants emerged early in eukaryotic evolution and were later displaced for bulk packaging roles by the canonical histones (H2A, H2B, H3 and H4), the synthesis of which is coupled to DNA replication. Further specializations of histone variants have evolved in some lineages to perform additional tasks. Differences among histone variants in their stability, DNA wrapping, specialized domains that regulate access to DNA, and post-translational modifications, underlie the diverse functions that histones have acquired in evolution. Histone chaperone Nearly all eukaryotes wrap their DNA around histones to In this Review, we consider the diversity and evolution of An escort protein that form nucleosomes that compact the genome while still core histone variants, from archaeal ancestors to univer- performs a transfer reaction on allowing access for active processes such as trans cription, sal eukaryotic variants to lineage-specific variants and a histone, such as deposition replication and DNA repair. Each nucleosome core variant-specific post-translational modifications (PTMs). onto DNA, eviction from DNA, transfer to another chaperone particle comprises ~ 147 bp of DNA wrapped in 1.7 turns We summarize their diverse and dynamic interactions as or enzyme, or storage for later around a protein octamer of 2 molecules of each of the 4 ‘wrap artists’ of DNA and discuss recent developments use.
[Show full text]
PRODUCT SPECIFICATION Product Datasheet
Product Datasheet QPrEST PRODUCT SPECIFICATION Product Name QPrEST H2AW Mass Spectrometry Protein Standard Product Number QPrEST37895 Protein Name Core histone macro-H2A.2 Uniprot ID Q9P0M6 Gene H2AFY2 Product Description Stable isotope-labeled standard for absolute protein quantification of Core histone macro- H2A.2. Lys (13C and 15N) and Arg (13C and 15N) metabolically labeled recombinant human protein fragment. Application Absolute protein quantification using mass spectrometry Sequence (excluding ILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALE fusion tag) KAGGKEFLETVKELRKSQGPL Theoretical MW 25485 Da including N-terminal His6ABP fusion tag Fusion Tag A purification and quantification tag (QTag) consisting of a hexahistidine sequence followed by an Albumin Binding Protein (ABP) domain derived from Streptococcal Protein G. Expression Host Escherichia coli LysA ArgA BL21(DE3) Purification IMAC purification Purity >90% as determined by Bioanalyzer Protein 230 Purity Assay Isotopic Incorporation >99% Concentration >5 μM after reconstitution in 100 μl H20 Concentration Concentration determined by LC-MS/MS using a highly pure amino acid analyzed internal Determination reference (QTag), CV ≤10%. Amount >0.5 nmol per vial, two vials supplied. Formulation Lyophilized in 100 mM Tris-HCl 5% Trehalose, pH 8.0 Instructions for Spin vial before opening. Add 100 μL ultrapure H2O to the vial. Vortex thoroughly and spin Reconstitution down. For further dilution, see Application Protocol. Shipping Shipped at ambient temperature Storage Lyophilized product shall be stored at -20°C. See COA for expiry date. Reconstituted product can be stored at -20°C for up to 4 weeks. Avoid repeated freeze-thaw cycles. Notes For research use only Product of Sweden. For research use only. Not intended for pharmaceutical development, diagnostic, therapeutic or any in vivo use.
[Show full text]
Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody (Biotin Conjugated) [Clone ID: OTI1E9] Product Data
OriGene Technologies, Inc. 9620 Medical Center Drive, Ste 200 Rockville, MD 20850, US Phone: +1-888-267-4436 [email protected] EU: [email protected] CN: [email protected] Product datasheet for TA803388AM Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9] Product data: Product Type: Primary Antibodies Clone Name: OTI1E9 Applications: IHC, WB Recommended Dilution: WB 1:2000, IHC 1:150 Reactivity: Human, Mouse, Rat Host: Mouse Isotype: IgG2b Clonality: Monoclonal Immunogen: Human recombinant protein fragment corresponding to amino acids 2-261 of human H2AFY2 (NP_061119) produced in E.coli. Formulation: PBS (PH 7.3) containing 1% BSA, 50% glycerol and 0.02% sodium azide. Concentration: 0.5 mg/ml Purification: Purified from mouse ascites fluids or tissue culture supernatant by affinity chromatography (protein A/G) Conjugation: Biotin Storage: Store at -20°C as received. Stability: Stable for 12 months from date of receipt. Predicted Protein Size: 39.9 kDa Gene Name: H2A histone family member Y2 Database Link: NP_061119 Entrez Gene 361844 RatEntrez Gene 404634 MouseEntrez Gene 55506 Human Q9P0M6 Synonyms: macroH2A2 Protein Pathways: Systemic lupus erythematosus This product is to be used for laboratory only. Not for diagnostic or therapeutic use. View online » ©2021 OriGene Technologies, Inc., 9620 Medical Center Drive, Ste 200, Rockville, MD 20850, US 1 / 4 Macro H2A.2 (H2AFY2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1E9] – TA803388AM Product images: HEK293T cells were transfected with the pCMV6- ENTRY control (Left lane) or pCMV6-ENTRY H2AFY2 ([RC203699], Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-H2AFY2.
[Show full text]
MAFB Determines Human Macrophage Anti-Inflammatory
MAFB Determines Human Macrophage Anti-Inflammatory Polarization: Relevance for the Pathogenic Mechanisms Operating in Multicentric Carpotarsal Osteolysis This information is current as of October 4, 2021. Víctor D. Cuevas, Laura Anta, Rafael Samaniego, Emmanuel Orta-Zavalza, Juan Vladimir de la Rosa, Geneviève Baujat, Ángeles Domínguez-Soto, Paloma Sánchez-Mateos, María M. Escribese, Antonio Castrillo, Valérie Cormier-Daire, Miguel A. Vega and Ángel L. Corbí Downloaded from J Immunol 2017; 198:2070-2081; Prepublished online 16 January 2017; doi: 10.4049/jimmunol.1601667 http://www.jimmunol.org/content/198/5/2070 http://www.jimmunol.org/ Supplementary http://www.jimmunol.org/content/suppl/2017/01/15/jimmunol.160166 Material 7.DCSupplemental References This article cites 69 articles, 22 of which you can access for free at: http://www.jimmunol.org/content/198/5/2070.full#ref-list-1 by guest on October 4, 2021 Why The JI? Submit online. • Rapid Reviews! 30 days* from submission to initial decision • No Triage! Every submission reviewed by practicing scientists • Fast Publication! 4 weeks from acceptance to publication *average Subscription Information about subscribing to The Journal of Immunology is online at: http://jimmunol.org/subscription Permissions Submit copyright permission requests at: http://www.aai.org/About/Publications/JI/copyright.html Email Alerts Receive free email-alerts when new articles cite this article. Sign up at: http://jimmunol.org/alerts The Journal of Immunology is published twice each month by The American Association of Immunologists, Inc., 1451 Rockville Pike, Suite 650, Rockville, MD 20852 Copyright © 2017 by The American Association of Immunologists, Inc. All rights reserved. Print ISSN: 0022-1767 Online ISSN: 1550-6606.
[Show full text]
Content Based Search in Gene Expression Databases and a Meta-Analysis of Host Responses to Infection
Content Based Search in Gene Expression Databases and a Meta-analysis of Host Responses to Infection A Thesis Submitted to the Faculty of Drexel University by Francis X. Bell in partial fulﬁllment of the requirements for the degree of Doctor of Philosophy November 2015 c Copyright 2015 Francis X. Bell. All Rights Reserved. ii Acknowledgments I would like to acknowledge and thank my advisor, Dr. Ahmet Sacan. Without his advice, support, and patience I would not have been able to accomplish all that I have. I would also like to thank my committee members and the Biomed Faculty that have guided me. I would like to give a special thanks for the members of the bioinformatics lab, in particular the members of the Sacan lab: Rehman Qureshi, Daisy Heng Yang, April Chunyu Zhao, and Yiqian Zhou. Thank you for creating a pleasant and friendly environment in the lab. I give the members of my family my sincerest gratitude for all that they have done for me. I cannot begin to repay my parents for their sacriﬁces. I am eternally grateful for everything they have done. The support of my sisters and their encouragement gave me the strength to persevere to the end. iii Table of Contents LIST OF TABLES.......................................................................... vii LIST OF FIGURES ........................................................................ xiv ABSTRACT ................................................................................ xvii 1. A BRIEF INTRODUCTION TO GENE EXPRESSION............................. 1 1.1 Central Dogma of Molecular Biology........................................... 1 1.1.1 Basic Transfers .......................................................... 1 1.1.2 Uncommon Transfers ................................................... 3 1.2 Gene Expression ................................................................. 4 1.2.1 Estimating Gene Expression ............................................ 4 1.2.2 DNA Microarrays ......................................................
[Show full text]
The Role of the MLL-HOXA9 Axis in Normal and Malignant
The Role of the MLL-HOXA9 Axis in Normal and Malignant Hematopoiesis by Jingya Wang A dissertation submitted in partial fulfillment of the requirements for the degree of Doctor of Philosophy (Molecular and Cellular Pathology) in the University of Michigan 2013 Doctoral Committee: Professor Jay L. Hess, Chair Assistant Professor Tomasz Cierpicki Professor Eric R. Fearon Assistant Professor Maria E. Figueroa Professor Tom K. Kerppola Associate Professor Xiaochun Yu © Jingya Wang 2013 To My parents and My husband ii Acknowledgement This dissertation would not have been possible without the tremendous support and guidance from my advisor, Dr. Jay L. Hess. Jay’s enthusiasm and dedication towards scientific research have always been a great source of inspiration. His scientific vision and openness to novel ideas greatly influenced my scientific career. I would also like to thank Jay for encouraging me to pursue my interest in statistics and the opportunity to apply my knowledge to biomedical research. I deeply appreciate Jay’s invaluable advice and generous support for the next stage of my career. My sincere appreciations also go to Drs. Andrew Muntean and Maria (“Ken”) Figueroa. Throughout my graduate study, Andy was actively involved in many aspects of my projects and my scientific career, including providing technical assistance and scientific thinking, and most importantly, sharing his insights of science and being a better scientist. I could not have been where I am without his generous help. Ken led me into the field of high throughput sequencing data analysis, and patiently discussed experimental design to algorithm in details. Her presence also contributes greatly to the completion of this thesis.
[Show full text]
Primepcr™Assay Validation Report
PrimePCR™Assay Validation Report Gene Information Gene Name H2A histone family, member Y2 Gene Symbol H2AFY2 Organism Human Gene Summary Description Not Available Gene Aliases macroH2A2 RefSeq Accession No. NC_000010.10, NT_030059.13 UniGene ID Hs.499953 Ensembl Gene ID ENSG00000099284 Entrez Gene ID 55506 Assay Information Unique Assay ID qHsaCEP0049973 Assay Type Probe - Validation information is for the primer pair using SYBR® Green detection Detected Coding Transcript(s) ENST00000373255, ENST00000455786 Amplicon Context Sequence GGGAGGCTGATGCGTTATCTGAAGAAAGGGACGTTCAAGTACCGGATCAGCGT GGGCGCCCCTGTCTACATGGCGGCAGTCATTGAGTACCTGGCAGCGGAAATTCT AGAATTGG Amplicon Length (bp) 85 Chromosome Location 10:71835490-71849833 Assay Design Exonic Purification Desalted Validation Results Efficiency (%) 94 R2 0.9984 cDNA Cq 22.8 cDNA Tm (Celsius) 84.5 gDNA Cq 24.23 Specificity (%) 100 Information to assist with data interpretation is provided at the end of this report. Page 1/4 PrimePCR™Assay Validation Report H2AFY2, Human Amplification Plot Amplification of cDNA generated from 25 ng of universal reference RNA Melt Peak Melt curve analysis of above amplification Standard Curve Standard curve generated using 20 million copies of template diluted 10-fold to 20 copies Page 2/4 PrimePCR™Assay Validation Report Products used to generate validation data Real-Time PCR Instrument CFX384 Real-Time PCR Detection System Reverse Transcription Reagent iScript™ Advanced cDNA Synthesis Kit for RT-qPCR Real-Time PCR Supermix SsoAdvanced™ SYBR® Green Supermix Experimental Sample qPCR Human Reference Total RNA Data Interpretation Unique Assay ID This is a unique identifier that can be used to identify the assay in the literature and online. Detected Coding Transcript(s) This is a list of the Ensembl transcript ID(s) that this assay will detect.
[Show full text]