Claudia Minter Context and Form in the Work of Plath and Hughes Having an Understanding of the Context and Form of Sylvia Plath's And

Total Page:16

File Type:pdf, Size:1020Kb

Load more

Claudia Minter Context and Form in the Work of Plath and Hughes Having an understanding of the context and form of Sylvia Plath's and Ted Hughes' writing is vital in appreciating the textual conversations they form. The connections between the texts are enhanced by intertextuality and language techniques to explore significant events and values from their contexts. Plath's poem 'Fever 103' is found in her Ariel collection, written in the early 1960s, and uses literary allusion to convey Plath's feeling of being trapped by societal expectations of womanhood. She alludes to Dante's 'Inferno', in which Dante travels across three worlds, with a motif of the number three significantly within the poem through it being comprised of a number of tercets. Dante's first location was the underworld, in which Plath describes "with almost a kind of glee or pleasure in the darkness and the violence of the language" (Abbott, 2018) "the bodies of adulterers" burning for their sins. This comes after her discovery of Hughes' betrayal: he was having an affair with family friend Assia Wevill, making Plath's description of an adulterer's fate all the more poignant. 'Fever 103' then moves on to Dante's second setting, Earth, as Plath alludes to the fever she caught on her honeymoon. Hughes fed her "Lemon water, chicken / Water. Water makes me retch", the thrice repeated "water" punctuated by the negatively connoted "retch", revealing Plath's disgust at Hughes' lack of commitment to their marriage. In the final section, she breaks the motif, stating "I think I am going up / I think I may rise", repeating the personal pronoun "I" four times, symbolising her new focus on independence, aligned with Dante's ascension to Heaven. Through this manipulation of form and language, elements of Plath's context can be uncovered as she moves away from a constraining and one- sided marriage and comes to value freedom. Hughes' collection Birthday Letters collides with this depiction, attempting to argue instead that Plath's spiralling mental illness and fixation on her deceased father was what put strain on their relationship. In 'The Shot', Hughes employs the extended metaphor of Plath as a bullet, released "when his death touched the trigger", referring to Otto Plath who died when Sylvia was only young. Hughes aligns this to the development of an Electra complex, as a result of which he as her husband is only a stand-in for her father. The free-verse poem is full of ballistic imagery such as "You ricocheted" and "Trajectory perfect", detailing the hurt Hughes felt when Plath promptly left his life through first separation then her subsequent suicide. Again, he claims the reasoning was "Your Daddy, / The god with the smoking gun", rather than the dehumanising reality of being a woman in a patriarchal society. This line itself is an allusion to one of Plath's other poems, 'Daddy', where she kills the titular father figure in order to free herself from male influence and pursue her literary career. By inverting this, Hughes provides comments from his own perspective, that Plath's troubling mental illnesses stemmed only from her father's early and sudden death: Hughes himself played no part in it. Plath's 'Nick and the Candlestick' also draws on this idea of a god dictating reality, except here she is this almighty figure and her son, Nicholas, the baby Jesus. Through continuous religious allusion, Plath explores the idea of rebirth and Nicholas as a saviour, most explicitly with the line "You are the baby in the barn", referring to the nativity scene. The tercet form of the three line verses symbolises the Holy Trinity she positions herself in: the Father, the Son, and the Holy Spirit. Her "earthen womb" is imagined with natural imagery as fertile and valuable, capable of producing new life. Plath's valuing of her capacity for pregnancy is a move to reclaim her power in a world that dictates that a woman's only role is as a child incubator: by reimagining her son as the Messiah, Plath directly labels herself then as God, all powerful. No matter how much she must endure - Hughes' affair, him abusing her to the point of miscarriage, difficulty achieving a serious career due to her sex - Plath ultimately reclaims the ability to being again, rebirth, as shown in the metaphor of the magical phoenix in 'Lady Lazarus': "out of the ash / I rise with my red hair. / And I eat men like air." Plath's determination to overcome the limitations of her context by reimaging the patriarchal Christian tradition is revealed through her use of form and language. Hughes' 'The Bee God' "ransack[s] Plath's store of private narrative and biography" (Alvarez Imbuido, 2001), presenting a perspective that collides with her established narrative of resistance. As discussed in 'Nick and the Candlestick', Plath can be viewed as "the girl who wanted to be God" (Plath, 1949), a position which Hughes denies. He demotes her to an "Abbess / In the nunnery of the bees", stripping her of authority and placing her in service of "the bees", symbolic of her father due to his work as an entomologist studying bees. Alike to 'The Shot', when Hughes is fatally wounded by Plath in the form of a bullet, 'The Bee God' closes with Hughes' death, this time stung by an army of bees. He insists "Your face wanted to save me / From what had been decided", the direct address to Plath claiming she still cared for him, contrary to her work seeking to escape him and his influence. Hughes even mimics Plath's frequent use of tercet form, departing from his usual free-verse arrangement. These recollections to her work and implication in his poetry that she had killed some part of him, suppressed his poetic voice, are ironic considering her death by suicide in 1963. As Birthday Letters was published in 1998, Hughes indeed got the final say, and Plath will never have the chance to continue their textual conversation from beyond the grave. Both Plath and Hughes' manipulation of form and language with frequent use of intertextuality provides insight into their respective personal, social, and historical contexts, allowing the audience to develop a greater understanding of the connections between them. .
Recommended publications
  • Works by Sylvia Plath

    Works by Sylvia Plath

    About This Volume William K. Buckley I. It is the intention of this volume to introduce students to the works of Sylvia Plath, as other volumes have over the years (see bibliography). Yet this edition of Critical Insights seeks to present not only introduc- tory ways of interpreting Plath’s works, but also new ways of looking at her writing in order to give students a historical look at Plath’s work. Before we look at the essays in this book, let us begin with consid- HUDWLRQVRIZRPDQKRRGDQGZRUNVE\ZRPHQ7KHIROORZLQJSURYRFD- tive statement from the essay “Women Poets” by Sandra M. Gilbert DQG6XVDQ*XEDUUHPDLQVLPSRUWDQW³7KHUHLVHYLGHQWO\VRPHWKLQJ DERXWO\ULFSRHWU\E\ZRPHQWKDWLQYLWHVPHGLWDWLRQVRQIHPDOHIXO¿OO- ment or, alternatively, a female insanity” (xx). Hélène Cixous, in her HVVD\³7KH/DXJKRIWKH0HGXVD´VD\V When I say “woman,” I’m speaking of woman in her inevitable struggle against conventional man, and of a universal woman subject who must bring women to their senses and to their meaning in history. In women, personal history blends together with the history of all women, as well as national and world history. (291, 298) As Plath scholar Steven Gould Axelrod has noted, Plath criticism has ³ODUJHO\ZRUNHGEH\RQGLWVLQLWLDOLPDJHRI6\OYLD3ODWKDVDÀDZHG victim or a hopeless confessor. Instead . commentary has revealed the originality and insight with which Plath’s texts explore a range of psychological, historical, cultural and literary issues.” Our goal in our classrooms, then, is to explore those observations, as do the essays in this book, especially since, as Lisa Narbeshuber says, Plath’s poetry is more a “cultural critique, rather than as self- actualization or individual psychological critique” (86).
  • Double Image : the Hughes-Plath Relationship As Told in Birthday Letters

    Double Image : the Hughes-Plath Relationship As Told in Birthday Letters

    Copyright is owned by the Author of the thesis. Permission is given for a copy to be downloaded by an individual for the purpose of research and private study only. The thesis may not be reproduced elsewhere without the permission of the Author. Double Image: The Hughes-Plath Relationship As Told in Birthday Letters. .A thesis presented in partial fulfilment of the requirements for the degree of Master of Philosophy in English at Massey University Helen Jacqueline Cain 2002 II CONTENTS Abstract................................................ .iii Acknowledgements ....................................... .iv Introduction.............................................. 1 Chapter One -Ted Hughes on Trial. ......................... 10 Chapter Two - The Structure of Birthday Letters. ...............22 Chapter Three - Delivered of Yourself........................ .40 Chapter Four - The Man in Black. .................... 53 Chapter Five - Daddy Coming Up From Out of the Well......... 69 Chapter Six - Fixed Stars Govern a Life ........................74 Conclusion............................................... 80 Works Cited.............................................. 83 Works Consulted......................................... 87 iii ABSTRACT Proceeding from a close reading of both Birthdqy Letters and the poems of Sylvia Plath, and also from a consideration of secondary and biographical works, I argue that implicit within Birthdqy Letters is an explanation for Sylvia Plath's death and Ted Hughes's role in it. Birthdqy Letters is a collection of 88 poems written by Ted Hughes to his first wife, the poet Sylvia Plath, in the years following her death. There are two aspects to the explanation Ted Hughes provides. Both are connected to Sylvia Plath's poetry. Her development as a poet not only causes her death as told in Birthdqy Letters, but it also renders Ted Hughes incapable of helping her, because through her poetry he is made to adopt the role of Plath's father.
  • Sylvia Plath's “Daddy” As Autobiography

    Sylvia Plath's “Daddy” As Autobiography

    IAFOR Journal of Arts & Humanities Volume 7 – Issue 1 – Summer 2020 Sylvia Plath’s “Daddy” as Autobiography Najoua Stambouli University of Sfax, Tunisia Abstract Sylvia Plath’s Ariel collection of poems placed her among the United States’ most important confessional poets of the twentieth century. Almost all the poems in Ariel, which were written during the last few months of Plath’s life and published after her death, are “personal, confessional, felt” (Lowell, 1996, p. xiii). Several events that are mentioned in these poems make reference to the poet’s own life experience. Plath, indeed, “transformed her own life into writing” (Bassnett, 2005, p. 5). Analyses such as these have led some critics to consider much of Plath’s poetry to be an eloquent expression of her own factual experience. “Daddy”, one of the best-known poems in the Ariel volume, incorporates several autobiographical details worthy of note. The first part of this research paper is an investigation into the diverse autobiographical elements present in “Daddy”; the second part is an analysis of Plath’s faithfulness in transforming details about her private life into art. Keywords: confessional poetry, autobiography, personal reality, Confessional School 69 IAFOR Journal of Arts & Humanities Volume 7 – Issue 1 – Summer 2020 Introduction Sylvia Plath is considered one of the prominent figures of the confessional school of poetry. Both her prose and poetry are marked by the confessional mode. Because the purpose of this paper is to explore the way Plath handles and unmasks very personal life details directly in her poem “Daddy”, it will be crucial to shed some light on the confessional style adopted in her poetry.
  • Biography: Sylvia Plath (1932-1963)

    Biography: Sylvia Plath (1932-1963)

    TEACHING HUMAN DIGNITY Biography: Sylvia Plath (1932-1963) Biography Sylvia Plath was born in Boston, Massachusetts on October 27, 1932 to highly intelligent parents. Her father, Otto Plath was a German immigrant and a professor of entomology at Boston University. Her mother, Aurelia, was the daughter of Austrian immigrants and taught high school German and English. At the age of eight Sylvia published her first poem. The same year, 1940, her father died of gangrene caused by untreated diabetes. His death had a profound impact on the young poet. After Otto’s death, Aurelia returned to teaching to support her My life, I feel, will not be lived children, with the help of her parents. Though she struggled to until there are books and stories which “ “relive it perpetually in time.1 maintain the family’s lifestyle, she always provided Sylvia and her younger brother, Warren, with various lessons and instilled —SYLVIA PLATH in them a deep love of learning. Throughout her childhood and adolescence, Sylvia continued to publish poetry and fiction in regional newspapers and magazines, and published her first national piece in the Christian Science Monitor in 1950. Plath was an exceptionally bright and tenacious student, excelling in studies at Wellesley High School and afterward at Smith College, where she attended on a scholarship. While at Smith, she continued to publish poetry and short stories, which earned her a guest editorship at Mademoiselle Magazine in New York. This would become the basis for the Bell Jar. It was also during this time that Plath attempted suicide for the first time and was sent to a private psychiatric hospital for six months.
  • “Daddy, I Have Had to Kill You”: Sylvia Plath's Father Poems Que

    “Daddy, I Have Had to Kill You”: Sylvia Plath's Father Poems Que

    Advances in Social Science, Education and Humanities Research, volume 92 2nd International Conference on Education, Social Science, Management and Sports (ICESSMS 2016) “Daddy, I Have Had to Kill You”: Sylvia Plath’s Father Poems Que Jun School of Foreign Languages, Beihang University, Beijing 100191, China [email protected] Abstract. Sylvia Plath experiences her father’s death as a symbolic loss against which she struggles by coveting his love and masculine, creative power in a poetic and primitive merger with him. In a large body of her father-poetry, Plath also makes the father evoke what is for her the equivalent of death. In addition, the dangerous and even deadly father-daughter relationship is often mingled with a “romantic” narrative that entails mutual attraction and sexual tension. Eventually, Daddy and daughter were psychologically and emotionally too intertwined to be separated, even in her death. Keywords: Sylvia Plath, father poem, death, suicide Sylvia Plath (1932-1963), the most idiosyncratic and gifted female poet in the twentieth century, died by suicide at the age of thirty, but the gruesome fact of death, and death as a poetic subject matter, had truly mesmerized her from the time she was eight, when her father passed away in a way inexplicable to a child. Her father Otto Plath was a biology professor specializing in the study of bees, he had diabetes and could have been successfully treated, yet the stubborn man claimed that the disease he had was cancer and refused any medical treatment. By the time he was hospitalized, one leg had become gangrenous, and he died of sepsis.
  • Daddy” of Sylvia Plath

    Daddy” of Sylvia Plath

    Study Material Department of English Semester: IV Name of the course: EM 09- AMERICAN POETRY Name of the topic: “Daddy” of Sylvia Plath DR. SHAKTIPADA KUMAR Daddy Sylvia Plath Sylvia Plath regards her father as her greatest tormentor. Father has always been an obsession with her, denoting Electra awe and admiration. Her treatment of this theme is most consistent in many of her poems, such as Lament, Letter to a Purist, November Graveyard, All the Dead Drears, On the Decline of Oracles, Full Fathom Five, Electra on Azalea Plath, The Bee- Keeper’s Daughter, Man in Black, The Colossus, Little Fugue and Daddy. Published posthumously in 1965 as part of the collection Ariel, the poem was originally written in October 1962, a month after Plath's separation from her husband, the poet Ted Hughes, and four months before her death by suicide. It is a deeply complex poem informed by the poet’s relationship with her deceased father, Otto Plath. Told from the perspective of a woman addressing her father, the memory of whom has an oppressive power over her, the poem depicts the speaker's struggle to break free of his influence. Daddy belongs to the last phase of Plath’s creative life. In Little Fugue (1962) the speaker recounts the memory of her father: Such a dark funnel, my father! I see your voice Black and leafy, as in my childhood, A yew hedge of orders, Gothic and barbarous, pure German This image of the father as black, Germanic autocrat is the beginning point of Daddy (1962)— the last poem of the father, “an emotional, psychological and historical autopsy, a final report” (Mary Lynn Broo, Protean Poetic: The Poetry of Sylvia Plath).
  • The Bell Jar

    The Bell Jar

    Reading Guide The Bell Jar By Sylvia Plath ISBN: 9780060837020 Introduction "I was supposed to be having the time of my life." As it turns out, Esther Greenwood—brilliant, talented, successful, and increasingly vulnerable and disturbed—does have an eventful summer. The Bell Jar follows Esther, step by painful step, from her New York City June as a guest editor at a fashion magazine through the following, snow-deluged January. Esther slides ever deeper into devastating depression, attempts suicide, undergoes bungled electroshock therapy, and enters a private hospital. In telling her own story—based on Plath's own summer, fall, and winter of 1953-1954—Esther introduces us to her mother, her boyfriend Buddy, her fellow student editors, college and home-town acquaintances, and fellow patients. She scrutinizes her increasingly strained relationships, her own thoughts and feelings, and society's hypocritical conventions, but is defenseless against the psychological wounds inflicted by others, by her world, and by herself. Pitting her own aspirations against the oppressive expectations of others, Esther cannot keep the airless bell jar of depression and despair from descending over her. Sylvia Plath's extraordinary novel ("witty and disturbing," said the New York Times) ends with the hope, if not the clear promise, of recovery. Questions for Discussion 1. What factors, components, and stages of Esther Greenwood's descent into depression and madness are specified? How inevitable is that descent? 2. In a letter while at college, Plath wrote that "I've gone around for most of my life as in the rarefied atmosphere under a bell jar." Is this the primary meaning of the novel's titular bell jar? What other meanings does "the bell jar" have? 3.
  • Plath Poetry Timeline Poem Titles Indicate Date of Writing, As Precisely As Possible

    Plath Poetry Timeline Poem Titles Indicate Date of Writing, As Precisely As Possible

    Plath Poetry Timeline Poem titles indicate date of writing, as precisely as possible. This is not the complete list of her works Date Event Work 27th October 1932 Sylvia Plath is born to Otto Plath (German) and Aurelia Plath (Austrian) 12th October 1940 Otto Plath’s leg is amputated as a result of advanced diabetes: this could have been prevented but he refused to see a doctor until it was too late because he was afraid that he had cancer. 5th November 1940 Otto Plath dies as a result of complications arising from the amputation 1950 – 1953 Attends Smith College, a private girl’s college in Mad Girl’s Love Song (1953) Massachusetts Summer of 1953 Works as a Guest Editor for Mademoiselle magazine in New York. First suicide attempt and subsequent treatment at McLean Hospital 1955 Graduates from Smith College October 1955 Plath starts at Cambridge (Newnham College) as a Fulbright Scholar 25th February 1956 Plath meets Hughes at a party (and bites his cheek) Pursuit 16th June 956 Plath and Hughes marry Sept 1957 – May 1958 Plath goes back to US to teach at Smith College June 1959 Plath becomes pregnant with Frieda December 1959 Plath & Hughes return to England and live in London Nov 1959 - April 1960 You’re 1st April 1960 Frieda is born 27th June 1960 The Hanging Man October 1960 Colossus (her first poetry collection) is published Jan – August 1961 She writes The Bell Jar 6th February 1961 Plath miscarries 11th – 26th February 1961 Morning Song 28th February 1961 Plath has an appendectomy 18th March 1961 Tulips July 1961 The Rival August 1961 Plath & Hughes move to Devon October 1961 Moon and the Yew Tree January 1962 Nicholas is born 19th April 1962 Elm April 1962 Little Fugue June 1962 Plath drives her car off the road (and later says this was a suicide attempt) 30th June 1962 Berck-Plage Late June – August 1962 Aurelia Plath (her mother) visits July 1962 Plath learns of Hughes’ affair with Assia Wevill Poppies in July September 1962 Plath & Hughes go to Ireland to find a place for Plath to rest.
  • Claiming Sylvia Plath

    Claiming Sylvia Plath

    Claiming Sylvia Plath Claiming Sylvia Plath: The Poet as Exemplary Figure By Marianne Egeland Claiming Sylvia Plath: The Poet as Exemplary Figure, by Marianne Egeland This book first published 2013 Cambridge Scholars Publishing 12 Back Chapman Street, Newcastle upon Tyne, NE6 2XX, UK British Library Cataloguing in Publication Data A catalogue record for this book is available from the British Library Copyright © 2013 by Marianne Egeland Parts of the book have been researched and written with a Government Grant for Artists and a grant from The Norwegian Non-fiction Writers and Translators Association. It has been copy edited with a grant from The Norwegian Research Council. All rights for this book reserved. No part of this book may be reproduced, stored in a retrieval system, or transmitted, in any form or by any means, electronic, mechanical, photocopying, recording or otherwise, without the prior permission of the copyright owner. ISBN (10): 1-4438-4173-0, ISBN (13): 978-1-4438-4173-3 CONTENTS ACKNOWLEDGEMENTS ix INTRODUCTION 1 CHAPTER ONE 9 THE CONSTITUTION OF A POET Life after Death 10 Conflicting Interests 14 Trapped Into Her Past 17 Whose Facts and Whose Rights? 23 Biographers on the Move 27 Exemplary Figures 31 The Idealized Poet 36 From Socrates to Sylvia 40 CHAPTER TWO 47 CRITICS Before – and After 48 Confessional Extremist 52 A Major Literary Event 57 Assorted Objections 60 Rupture or Continuity? 66 Cult – Icon – Legend – Myth 70 Of her Time, Before or Beyond it? 76 Business as Usual 80 Re-evaluation 84 vi Contents CHAPTER THREE
  • Reading Guide Ariel

    Reading Guide Ariel

    Reading Guide Ariel By Sylvia Plath ISBN: 9780060931728 Plot Summary: "Love set you going like a fat gold watch." "From the bottom of the pool, fixed stars / Govern a life." Between the first and last words of this remarkable collection, between love and life, between the infant's "clear vowels" of "Morning Song" and the final poem's "white skull" and "Words dry and riderless," Sylvia Plath created an unprecedented poetic vision. First published in England in 1964, and in the United States a year later, Ariel was, in the words of then-editor Frances McCullough, "a sensation." The impact of these poems in England and America alike was astonishing. Perhaps the most famous, still, of the Ariel poems are "Lady Lazarus" and "Daddy," and those that present a sensitive young woman battling the forces of society and her own demons to achieve an imaginative transformation determined solely by herself. Grappling with both the minutiae of daily life and historical and mythic grandeur, these poems seem to be an attempt to raise existence--and the poet herself--to a new level of transcendence and intensity. Alternately brutal and gentle, slashing and caressing, Plath's verses have been seen as both out of proportion and unbalanced, on the one hand, and unprecedentedly focused and courageous. Whether speaking as Mary, Medusa, or herself, Sylvia Plath fashioned poems that remain "proof of the capacity of poetry to give to reality the greater permanence of the imagined"(George Steiner). Topics for Discussion 1. In what ways do the Ariel poems speak directly to conditions and qualities of life in the late 1990s? 2.
  • Table of Contents

    Table of Contents

    Table of Contents Introduction ....................................................................................................................... 2 1. Biography ...................................................................................................................... 8 2. Freud – Klein – Lacan: The Psychoanalytic Approach .............................................. 28 3. The Bell Jar ................................................................................................................. 43 Conclusion ...................................................................................................................... 76 Works cited ..................................................................................................................... 80 1 Introduction I shall perish if I can write about no one but myself. ---Plath, Journals, November 4, 1959 I must lie down where all the ladder start, In the foul rag-and-bone shop of the heart. ---W.B. Yeats, The Circus Animal’s Desertion Every piece of art, no matter how objective it is, is a form of retranslation. It transforms the picture of the world through the channel of imagination giving birth to a new reality. Art can be based on elaborate techniques following a coherent pattern but what we finally get is always a product of subjective experience. In her book Psychoanalytical Approach to Aesthetics , Hana Segal points out that “Every creative artist produces a world of his own. Even when he believes himself to be a complete realist and sets himself the
  • Re-Writing the Plath Myth: Sylvia Plath and the Cult of Celebrity in Print Publication Elizabeth Anne Roodhouse Woodbridge

    Re-Writing the Plath Myth: Sylvia Plath and the Cult of Celebrity in Print Publication Elizabeth Anne Roodhouse Woodbridge

    Re-Writing the Plath Myth: Sylvia Plath and the Cult of Celebrity in Print Publication Elizabeth Anne Roodhouse Woodbridge, V A BA, University of Virginia, 2005 A Thesis presented to the Graduate Faculty of the University of Virginia in Candidacy for the Degree of Master of Arts Department of English University of Virginia May, 2006 Degree \ \ \ \ Towards what [A. Alvarez] calls ‘the Plath industry throbbing with busy-ness in the Universities,’ and towards that ‘vast potential audience,’ I feel no obligations whatsoever. The scholars want the anatomy of the birth of the poetry; and the vast potential audience wants her blood, hair, touch, smell and a front seat in the kitchen where she died. The scholars may well inherit what they want, some day, and there are journalists supplying the other audience right now. But neither audience makes me feel she owes them anything. - Ted Hughes, from The Observer, November 21, 1971 i. Introduction: Rewriting the Plath Myth When does an author become an icon? When does the cult of celebrity transform into myth? If we had ever been in doubt of Sylvia Plath’s rising currency as a pop culture icon, the 2003 film Sylvia starring Gwyneth Paltrow as the famed “poet/suicide” Sylvia Plath seals the deal. Uniting two already-famous faces and merging them into one, the film Sylvia (and the glut of promotional propaganda for the film still circulating in its wake) calls explicit attention to these relationships between author and celebrity, image and icon. “Does Paltrow look like Plath?” we might ask, or “How well does she play her?” Importantly, we are able to ask these questions of Sylvia because its subject has attained the status of a ubiquitous and immediately recognizable figure in American culture.