Interactive Nicking

Total Page:16

File Type:pdf, Size:1020Kb

Load more

equineline.com Product 10N 12/29/20 14:16:14 EST Dr Large Bay Horse; May 07, 2006 View Complete Auction History 19 Starts, Listed winner Click here for Interactive Nicking Bold Ruler, 54 dk b Boldnesian, 63 b Alanesian, 54 b Bold Reasoning, 68 dk b/ Hail to Reason, 58 br Reason to Earn, 63 b Sailing Home, 48 ch Seattle Slew, 74 dk b/ Round Table, 54 b Poker, 63 b Glamour, 53 b My Charmer, 69 b Jet Action, 51 ch Fair Charmer, 59 ch Myrtle Charm, 46 b A.P. Indy, 89 dk b/ *Nasrullah, 40 b Bold Ruler, 54 dk b Miss Disco, 44 b Secretariat, 70 ch *Princequillo, 40 b Somethingroyal, 52 b Imperatrice, 38 dk b Weekend Surprise, 80 b Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Lassie Dear, 74 b Sir Gaylord, 59 dk b Gay Missile, 67 b Missy Baba, 58 b Dr Large Bay Horse Polynesian, 42 br Foaled May 07, 2006 Native Dancer, 50 gr in Kentucky Geisha, 43 ro Raise a Native, 61 ch 19 Starts Case Ace, 34 b Listed winner Raise You, 46 ch Lady Glory, 34 br Mr. Prospector, 70 b *Nasrullah, 40 b Nashua, 52 b Segula, 42 dk b Gold Digger, 62 b Count Fleet, 40 br Sequence, 46 dk b Miss Dogwood, 39 dk b Debit Account, 96 b Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Lyphard, 69 b *Court Martial, 42 ch Goofed, 60 ch *Barra II, 50 ch Awesome Account, 82 ch Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Special Account, 72 ch Swaps, 52 ch Intriguing, 64 ch Glamour, 53 b Breeder: WinStar Farm, LLC (KY) Inbreeding: Bold Ruler: 4S X 5S Dosage Profile: 14 13 29 0 0 Buckpasser: 4S X 4D Dosage Index: 2.86 Glamour: 5S X 5D Center of Distribution: +0.73 *Nasrullah: 5S X 5D Tom Fool: 5S X 5D Busanda: 5S X 5D Most Recent Auction Result: Sale Price: RNA $290,000 Sale: Keeneland Association September 2007 Yearling Sale Consignor: FOUR STAR SALES AGENT View Complete Auction History Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2020 The Jockey Club Information Systems, Inc. Page 1 of 2 equineline.com Product 10N 12/29/20 14:16:14 EST Dr Large Bay Horse; May 07, 2006 Nicking Stats for Sire and Broodmare Sire SIRE of Dr Large: A.P. Indy TOTALS FOR foals* starters (%) winners (%) BW (%) earnings ($) aei A.P. Indy 1224 947 (77 ) 693 (57 ) 156 (13 ) $137,238,838 2.87 BROODMARE SIRE of Dr Large: Mr. Prospector TOTALS FOR mares foals* starters (%) winners (%) BW (%) earnings ($) aei Mr. Prospector 534 4954 4023 (81 ) 2934 (59 ) 385 (8 ) $390,684,967 1.81 Nicking Stats for mares by Mr. Prospector when bred to A.P. Indy mares foals* starters (%) winners (%) BW (%) earnings ($) aei 71 127 103 (81 ) 84 (66 ) 22 (17 ) $18,737,480 3.71 * Foals of racing age Interactive Nicking To generate a second set of Nicking Stats for this Pedigree, click on a Sire and Broodmare Sire combination below to view the results. A.P. Indy with Raise a Native mares Seattle Slew with Mr. Prospector mares Seattle Slew with Raise a Native mares Bold Reasoning with Mr. Prospector mares Bold Reasoning with Raise a Native mares Copyright © 2020 The Jockey Club Information Systems, Inc. Page 2 of 2.
Recommended publications
  • Tom Fool 08/23/09 14:58:14 ET

    Tom Fool 08/23/09 14:58:14 ET

    Lifetime Past Performance for Tom Fool 08/23/09 14:58:14 ET In North America / USA Year Age Starts 1st 2nd 3rd Earnings (USA$) 1951 2 7 5(4) 2 0 $155,960 1952 3 13 6(4) 5 1 $157,850 Owner: unknown owner 1953 4 10 10(8) 0 0 $256,355 Trainer: unknown trainer Totals 30 21(16) 7 1 $570,165 Owner & trainer as of 10/24/53 (BlkType) Tom Fool Bay Horse by Menow (35) -- Gaga (42) by *Bull Dog (27) -- Bred in USA by (Jan 01, 1949) (SPR=99; CPI=57.8) Date #Track Dist Run Temp Splits Type/Value/Clm v Points of Call Jockey W First Three Finishers Comments Earned Up Rail (USA$) 102453 7PIM ft 1Cm 1:55ÈÀ STK 50k 1 unknown 126 Tom Fool,Navy Page,Alerted $30,000 jockey 092653 6BEL ft 1m 1:36ÈÀ STK 50k 1 unknown 126 Tom Fool,Alerted,Grecian Queen $36,400 jockey 080853 7SAR ft 1Lm 2:05ÄÀ STK 25k 1 unknown 126 Tom Fool,Combat Boots $18,250 jockey 080453 6SAR ft 1m 1:37ÂÀ STK 15k 1 unknown 126 Tom Fool,Indian Land $10,925 jockey 071153 6AQU ft 1Lm 2:04ÄÀ STK 50k 1 unknown 136 Tom Fool,Golden Gloves,High Scud $37,900 jockey 062753 6AQU ft 7f 1:22ÀÀ STK 50k 1 unknown 135 Tom Fool,Squared Away,Eatontown $41,700 jockey 053053 6BEL ft 1Lm 2:00ÆÀ STK 50k 1 unknown 128 Tom Fool,Royal Vale,Cold Command $40,400 jockey 052353 6BEL gd 1m 1:35ÈÀ STK 30k 1 unknown 130 Tom Fool,Royal Vale,Intent $25,800 jockey 110852 6JAM ft 1Cm 1:58ÀÀ STK 50k 1 unknown 128 Tom Fool,Marcador,Roaring Bull $37,650 jockey 110152 6JAM ft 1Nm 1:50ÂÀ STK 50k 2 unknown 125 Battlefield,Tom Fool,Alerted $10,000 jockey 101852 6JAM ft 1Nm 1:49ÄÀ STK 50k 1 unknown 119 Tom Fool,Battlefield,Alerted $42,200
  • Bold Example (Usa)

    Bold Example (Usa)

    BOLD EXAMPLE (USA) Bold Ruler Nasrullah Sire: (Bay 1954) Miss Disco BOLD LAD (USA) (Chesnut 1962) Misty Morn Princequillo BOLD EXAMPLE (USA) (1952) Grey Flight (mare 1969) Better Self Bimelech Dam: (Bay 1945) Bee Mac LADY BE GOOD (1956) Past Eight Eight Thirty (Chesnut 1945) Helvetia 5Sx5S Blenheim II Bold Example (USA), won 3 races in U.S.A. at 2 and 3 years and £18,159, placed second in Blue Hen Stakes, Delaware Park and Polly Drummond Stakes, Delaware Park and fourth in Matron Stakes, Belmont Park, Gr.1, Selima Stakes, Laurel, Gr.1 and Seashore Stakes, Monmouth Park, Gr.3; Own sister to GOOD LAD (USA); dam of 5 winners: 1974 FRENCH CONNECTION (USA) (c. by Le Fabuleux), won 2 races in U.S.A. at 3 and 5 years and £6,674 and placed once. 1975 Up And Coming (USA) (f. by Pronto), died at 2. 1976 Past Example (USA) (f. by Buckpasser), unraced; dam of 3 winners. POLISH PRECEDENT (USA) (c. by Danzig (USA)), Top rated 3yr old miler in France in 1989, 4th top rated 3yr old in Europe in 1989, placed at 3 years and £56,800 second in Queen Elizabeth II Stakes, Ascot, Gr.1; also 7 races in France at 3 years and £261,578 including Prix du Moulin de Longchamp, Longchamp, Gr.1, P. Fresnay-le-Buffard Jacques Le Marois, Deauville, Gr.1, Prix de la Jonchere, Chantilly, Gr.3, Prix du Palais Royal, Longchamp, Gr.3, Prix Messidor, M'-Laffitte, Gr.3 and Prix du Pont-Neuf, Longchamp, L.; sire.
  • Hangover Kid Bay Horse; Apr 16, 2008 26 Starts, G2 Winner Click Here for Interactive Nicking Native Dancer, 50 Gr Raise a Native, 61 Ch Raise You, 46 Ch Mr

    Hangover Kid Bay Horse; Apr 16, 2008 26 Starts, G2 Winner Click Here for Interactive Nicking Native Dancer, 50 Gr Raise a Native, 61 Ch Raise You, 46 Ch Mr

    equineline.com Product 10N 12/18/20 09:25:09 EST Hangover Kid Bay Horse; Apr 16, 2008 26 Starts, G2 winner Click here for Interactive Nicking Native Dancer, 50 gr Raise a Native, 61 ch Raise You, 46 ch Mr. Prospector, 70 b Nashua, 52 b Gold Digger, 62 b Sequence, 46 dk b Kingmambo, 90 b Northern Dancer, 61 b Nureyev, 77 b Special, 69 b Miesque, 84 b Prove Out, 69 ch Pasadoble, 79 b *Santa Quilla, 70 dk b/ Lemon Drop Kid, 96 b Boldnesian, 63 b Bold Reasoning, 68 dk b/ Reason to Earn, 63 b Seattle Slew, 74 dk b/ Poker, 63 b My Charmer, 69 b Fair Charmer, 59 ch Charming Lassie, 87 dk b/ Tom Fool, 49 b Buckpasser, 63 b Busanda, 47 blk Lassie Dear, 74 b Sir Gaylord, 59 dk b Gay Missile, 67 b Missy Baba, 58 b Hangover Kid Bay Horse =Nearco (ITY), 35 br Foaled Apr 16, 2008 Nearctic, 54 br in New York *Lady Angela, 44 ch Northern Dancer, 61 b 26 Starts Native Dancer, 50 gr G2 winner Natalma, 57 b Almahmoud, 47 ch Rakeen, 87 b Hail to Reason, 58 br Halo, 69 dk b/ Cosmah, 53 b Glorious Song, 76 b *Herbager, 56 b Ballade, 72 dk b/ Miss Swapsco, 65 dk b/ Absolute Patience, 97 b Atan, 61 ch Sharpen Up (GB), 69 ch =Rocchetta (GB), 61 ch Diesis (GB), 80 ch =Reliance II (FR), 62 b Doubly Sure (GB), 71 b =Soft Angels, 63 ch I'm Harriet, 88 ch His Majesty, 68 b Cormorant, 74 b Song Sparrow, 67 b I'm Well Bred, 82 b No Robbery, 60 b Is Certain, 66 dk b/ Itsabet, 45 ch Breeder: Steve Taglienti (NY) Inbreeding: Native Dancer: 5S X 5D Dosage Profile: 10 0 16 4 0 Northern Dancer: 5S X 3D Dosage Index: 1.50 Center of Distribution: +0.53 Please Note: Nicking Stats and Interactive Nicking are on the following page Copyright © 2020 The Jockey Club Information Systems, Inc.
  • Flashpoint B+ Based on the Cross of Boundary and His Sons/Mr

    Flashpoint B+ Based on the Cross of Boundary and His Sons/Mr

    05/18/11 10:48:25 EDT Flashpoint B+ Based on the cross of Boundary and his sons/Mr. Prospector and his sons and grandsons Variant = 2.22 Breeder: Silverleaf Farms, Inc. (FL) Nearctic, 54 br Northern Dancer, 61 b Natalma, 57 b Danzig, 77 b Admiral's Voyage, 59 dk b/ Pas de Nom, 68 dk b/ *Petitioner, 52 b Boundary, 90 b Sword Dancer, 56 ch Damascus, 64 b Kerala, 58 b Edge, 78 ch Round Table, 54 b Ponte Vecchio, 70 b Terentia, 62 b Pomeroy, 01 b Raise a Native, 61 ch Mr. Prospector, 70 b Gold Digger, 62 b Seeking the Gold, 85 b Buckpasser, 63 b Con Game, 74 dk b/ Broadway, 59 b Questress, 94 dk b/ In Reality, 64 b Believe It, 75 ch Breakfast Bell, 70 ch Nahema, 82 dk b/ Chompion, 65 b Flickering Star, 73 b Winking Star, 59 br Flashpoint Gray or Roan Colt Native Dancer, 50 gr Foaled Feb 20, 2008 Raise a Native, 61 ch in Florida Raise You, 46 ch Mr. Prospector, 70 b Nashua, 52 b Gold Digger, 62 b Sequence, 46 dk b Two Punch, 83 ro *Herbager, 56 b *Grey Dawn II, 62 gr Polamia, 55 gr Heavenly Cause, 78 ro Nantallah, 53 b Lady Dulcinea, 63 ro Shy Dancer, 55 ro Two Punch Lil, 92 gr *Nasrullah, 40 b Bold Ruler, 54 dk b Miss Disco, 44 b Secretariat, 70 ch *Princequillo, 40 b Somethingroyal, 52 b Imperatrice, 38 dk b Morning Snack, 81 ch Tom Fool, 49 b Tompion, 57 br Sunlight, 52 b Cream in My Coffee, 68 ch Native Dancer, 50 gr Toast of the Town, 65 dk b/ Raise You, 46 ch Note on terminology in this report: Direct Cross refers to Dosage Profile: 8 7 9 0 0 Inbreeding: Mr.
  • UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1

    UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1

    UNDER CAUTION:Layout 1 12/4/13 10:08 AM Page 1 UNDER CAUTION A.P. Indy—Coldheartedcat, by Storm Cat Ranked in the Top Five Leading Freshman Sires in 2011 By Horse of the Year and classic winner A. P. INDY, leading sire twice, sire of 140 stakes winners, including champions BERNARDINI, MINESHAFT, RAGS TO RICHES, MARCHFIELD, MALIBU MOON, EYE OF THE LEOPARD and TEMPERA. Out of the winning STORM CAT mare Coldheartedcat. She is a half-sister to classic winner CAVEAT, DEW LINE, BALTIC CHILL and Winters’ Love dam of TRANQUILITY LAKE ($1,662,390), and leading California sire BENCHMARK; granddam of AFTER MARKET ($903,685, sire), COURAGEOUS CAT ($1,165,760, Shoemaker Mile S.-G1, etc.) and JALIL. 2014 FEE: $1,500-LIVE FOAL-SECOND MARE FREE 2 LIFETIME BREEDINGS PER YEAR, NO ADDITIONAL COST $1,500 to be paid when 2014 contract is signed and returned. This offer applies to first 10 bookings in 2014. Property of Medallion Hill Farm LLC SK RACING STABLE Inquiries to (925) 550-2383 or (925) 354-5237 14728 Cool Valley Road, Valley Center, California 92082 (760) 443-9523 / FAX (760) 751-9523 e-mail: [email protected] 184 www.ctba.com California Thoroughbred 2014 Stallion Directory www.ctba.com UnderCautioncs406201ORIGJockeyClubPageSent11-8-2013-NoChange11-27-2013-1245pm :Layout 1 11/27/13 12:48 PM Page1 UNDER CAUTION 2001 Chestnut - Height 16.1 - Dosage Profile: 7-14-19-0-0; DI: 3.21; CD: +0.70 RACE AND (STAKES) RECORD Bold Ruler Boldnesian Age Starts 1st 2nd 3rd Earnings Alanesian Bold Reasoning 2 3 1 0 0 $18,300 Hail to Reason 61 foals, 10 SWs 3 3 0 1 0 2,200 Reason to Earn Sailing Home Seattle Slew Round Table 4 11 2 1 1 36,045 1050 foals, 114 SWs Poker Glamour 5 14 2 1 3 41,700 My Charmer Jet Action 31 5 3 4 $98,245 12 foals, 4 SWs Fair Charmer Myrtle Charm A.P.
  • MJC Media Guide

    MJC Media Guide

    2021 MEDIA GUIDE 2021 PIMLICO/LAUREL MEDIA GUIDE Table of Contents Staff Directory & Bios . 2-4 Maryland Jockey Club History . 5-22 2020 In Review . 23-27 Trainers . 28-54 Jockeys . 55-74 Graded Stakes Races . 75-92 Maryland Million . 91-92 Credits Racing Dates Editor LAUREL PARK . January 1 - March 21 David Joseph LAUREL PARK . April 8 - May 2 Phil Janack PIMLICO . May 6 - May 31 LAUREL PARK . .. June 4 - August 22 Contributors Clayton Beck LAUREL PARK . .. September 10 - December 31 Photographs Jim McCue Special Events Jim Duley BLACK-EYED SUSAN DAY . Friday, May 14, 2021 Matt Ryb PREAKNESS DAY . Saturday, May 15, 2021 (Cover photo) MARYLAND MILLION DAY . Saturday, October 23, 2021 Racing dates are subject to change . Media Relations Contacts 301-725-0400 Statistics and charts provided by Equibase and The Daily David Joseph, x5461 Racing Form . Copyright © 2017 Vice President of Communications/Media reproduced with permission of copyright owners . Dave Rodman, Track Announcer x5530 Keith Feustle, Handicapper x5541 Jim McCue, Track Photographer x5529 Mission Statement The Maryland Jockey Club is dedicated to presenting the great sport of Thoroughbred racing as the centerpiece of a high-quality entertainment experience providing fun and excitement in an inviting and friendly atmosphere for people of all ages . 1 THE MARYLAND JOCKEY CLUB Laurel Racing Assoc. Inc. • P.O. Box 130 •Laurel, Maryland 20725 301-725-0400 • www.laurelpark.com EXECUTIVE OFFICIALS STATE OF MARYLAND Sal Sinatra President and General Manager Lawrence J. Hogan, Jr., Governor Douglas J. Illig Senior Vice President and Chief Financial Officer Tim Luzius Senior Vice President and Assistant General Manager Boyd K.
  • Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes

    Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’S Plate 3RD Belmont Stakes

    Northern Dancer 90th May 2, 1964 THE WINNER’S PEDIGREE AND CAREER HIGHLIGHTS Pharos Nearco Nogara Nearctic *Lady Angela Hyperion NORTHERN DANCER Sister Sarah Polynesian Bay Colt Native Dancer Geisha Natalma Almahmoud *Mahmoud Arbitrator YEAR AGE STS. 1ST 2ND 3RD EARNINGS 1963 2 9 7 2 0 $ 90,635 1964 3 9 7 0 2 $490,012 TOTALS 18 14 2 2 $580,647 At 2 Years WON Summer Stakes, Coronation Futurity, Carleton Stakes, Remsen Stakes 2ND Vandal Stakes, Cup and Saucer Stakes At 3 Years WON Kentucky Derby, Flamingo Stakes, Florida Derby, Blue Grass Stakes, Preakness, Queen’s Plate 3RD Belmont Stakes Horse Eq. Wt. PP 1/4 1/2 3/4 MILE STR. FIN. Jockey Owner Odds To $1 Northern Dancer b 126 7 7 2-1/2 6 hd 6 2 1 hd 1 2 1 nk W. Hartack Windfields Farm 3.40 Hill Rise 126 11 6 1-1/2 7 2-1/2 8 hd 4 hd 2 1-1/2 2 3-1/4 W. Shoemaker El Peco Ranch 1.40 The Scoundrel b 126 6 3 1/2 4 hd 3 1 2 1 3 2 3 no M. Ycaza R. C. Ellsworth 6.00 Roman Brother 126 12 9 2 9 1/2 9 2 6 2 4 1/2 4 nk W. Chambers Harbor View Farm 30.60 Quadrangle b 126 2 5 1 5 1-1/2 4 hd 5 1-1/2 5 1 5 3 R. Ussery Rokeby Stables 5.30 Mr. Brick 126 1 2 3 1 1/2 1 1/2 3 1 6 3 6 3/4 I.
  • Fancy Strike

    Fancy Strike

    equineline.com Pedigree 07/19/16 11:20:24 EDT 15--Fancy Strike Bay Colt; May 11, 2015 Pulpit, 94 b Tapit, 01 gr/ro Tap Your Heels, 96 gr/ro Tapizar, 08 b Deputy Minister, 79 dk b/ Unnamed Winning Call, 98 b Call Now, 92 b Foaled in Kentucky Mr. Prospector, 70 b Smart Strike, 92 b Fancy Strike, 09 dk b/ Classy 'n Smart, 81 b Pleasant Colony, 78 dk b/ Settling Mist, 99 b Toll Fee, 85 b By TAPIZAR (2008). Stakes winner of 6 races of $972,632, Breeders' Cup Dirt Mile [G1] (SA, $540,000), San Fernando S. [G2] (SA, $90,000), Sham S. [G3] (SA, $60,000), West Virginia Governor's S. [L] (MNR, $124,600), 2nd Razorback H. [G3] (OP, $25,000). His first foals are 2-year-olds of 2016. Sire of 100 foals, 12 starters, 4 winners of 4 races and earning $177,406 USA, including Tip Tap Tapizar (at 2, 2016, $33,060, 3rd Bashford Manor S. [G3] (CD, $9,600)), Draft Beer (at 2, 2016, $35,550), Zartera (at 2, 2016, $27,900), Thurman Merman (at 2, 2016, $20,400), Tap It All (placed, at 2, 2016, $41,100). Son of stakes winner Tapit, Leading sire twice, sire of 82 stakes winners, 6 champions, including Untapable (Champion in U.S., $3,926,625, Longines Breeders' Cup Distaff [G1] (SA, $1,100,000), etc.), Stardom Bound (Champion in U.S., $1,861,610, Breeders' Cup Juvenile Fillies [G1] (OSA, $1,080,000), etc.), Hansen (Champion in U.S., $1,810,805, Breeders' Cup Juvenile [G1] (CD, $1,080,000), etc.), As de Trebol (Champion in Spain, $246,135 USA, 2nd Prix du Palais-Royal [G3], etc.), Chachkova (Champion twice in Turkey, to 6, 2016, $187,476 USA, Marmara S., etc.), Tapit Girl (Champion in Turkey, $167,938 USA, SIAY ve S.
  • SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1

    SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1

    SUNDARBAN :Layout 1 12/4/13 1:15 PM Page 1 SUNDARBAN A.P. Indy—Desert Tigress, by Storm Cat $1.7 million 2007 Keeneland September Yearling Earned $103,340 as the winner of 4 races, including his maiden win by 8 3/4 lengths going gate-to-wire at 1 1/16 miles as the 123-pound highweight. Out of DESERT TIGRESS, by Storm Cat, sister to GROUP 3-winning sire HURRICANE CAT who has six group winners in France and Chile from his first two crops to race & second dam is champion older mare SKY BEAUTY,9GRADE 1 wins, including FILLY TRIPLE CROWN. Third dam is multiple GRADE 1 winner MAPLEJINSKY and this is the family of champions GOLD BEAUTY & DAYJUR, BREEDERS’ CUP DISTAFF (G1) winner PLEASANT HOME ($1,378,070) & multiple 2012 GRADE 1 winner POINT OF ENTRY. By Horse of the Year and Classic winner A.P. INDY, sire of the earners of more than $120 million & 11 champions, including BERNARDINI, MINESHAFT, RAGS TO RICHES, TEMPERA, etc. 2014 FEE: $2,500-LIVE FOAL First foals are two-year-olds of 2014 Standing at MILKY WAY FARM Inquiries to Linda Madsen 34174 De Portola Road, Temecula, California 92592 (909) 241-6600 e-mail: [email protected] • http://www.thoroughbredinfo.com/showcase/sundarban.htm 154 California Thoroughbred 2014 Stallion Directory www.ctba.com SUNDARBAN CS403401ORIGJockeyClubPageSent11-8-2013-1stChngLoretta11-27-2013-1052am:Layout 1 11/27/13 10:53 AM Page1 SUNDARBAN 2006 Bay - Height 16.2 - Dosage Profile: 8-12-21-1-0; DI: 2.65; CD: +0.64 Bold Ruler RACE AND (STAKES) RECORD Boldnesian Alanesian Age Starts 1st 2nd 3rd Earnings Bold Reasoning Hail to Reason 2 unraced 61 foals, 10 SWs Reason to Earn Sailing Home Seattle Slew 3 1 0 0 0 $170 Round Table 1050 foals, 114 SWs 4 9430 98,635 Poker Glamour My Charmer 5 6002 4,535 Jet Action 12 foals, 4 SWs 16 4 3 2 $103,340 Fair Charmer Myrtle Charm A.P.
  • With a Well-Received First-Crop of Yearlings for Heeraat, Mickley Stud Is Looking Forward to the Stallion’S Runners Hitting the Track in the Spring

    With a Well-Received First-Crop of Yearlings for Heeraat, Mickley Stud Is Looking Forward to the Stallion’S Runners Hitting the Track in the Spring

    Here he comes With a well-received first-crop of yearlings for Heeraat, Mickley Stud is looking forward to the stallion’s runners hitting the track in the spring. Aisling Crowe chats with Richard Kent 48 mickley stud Photo by Emma Berry LL BOODSTOCK investment IS HIGH RISK, but backing a new stallion is at the very top of the “beware” pyramid and should come with a government health warning.A Launching a new stallion onto the market takes nerves of steel, and particularly so when the stud in question is not perhaps located in the more fashionable enclaves of the thoroughbred world and the sire does not command the astronomical covering fee that attracts the attention, and mares, of the industry’s influencers. The process is fraught with as much risk as that of a space launch. Luckily, Richard Kent of Mickley Stud possesses the pedigree, experience and nous which have helped him guide the first three seasons of Heeraat toward lift-off, the son of Dark Angel due to have his first runners next spring, The process is also aided by Heeraat himself, a talented sprinter from a fast family, and by a sire who is establishing himself as a dominant force in the breed. “It has taken 25 years to try and understand how to get a stallion’s career going and to develop the confidence to do it,” confides the Cork-born Kent who runs the stud in Shropshire with his partner Claire Lloyd. “I spoke to Tony O’Callaghan about how he had achieved success with Danetime, Kodiac, and now Society Rock and he said you just have to keep working away, even though you can be unlucky and get average horses until one day the good ones come along.” Danetime and Kodiac began life at similar fees to the £4,000 that Heeraat has stood at for his first three seasons.
  • MOR SPIRIT Dkb/Br, 2013

    MOR SPIRIT Dkb/Br, 2013

    Enters Stud in 2019 MOR SPIRIT dkb/br, 2013 Dosage (4-0-14-0-0); DI: 1.57; CD: 0.44 See gray pages—Nearctic RACE AND (BLACK TYPE) RECORD Storm Cat, 1983 Storm Bird, by Northern Dancer Age Starts 1st 2nd 3rd Earned 8s, BTW, $570,610 Giant's Causeway, 1997 1,414 f, 177 BTW, 2.94 AEI Terlingua, by Secretariat 2 4 2(1) 2(1) 0 $288,400 13s, BTW, $3,078,989 3 5 1(1) 2(2) 0 $388,000 2,429 f, 186 BTW, 1.76 AEI Mariah's Storm, 1991 Rahy, by Blushing Groom Eskendereya, ch, 2007 16s, BTW, $724,895 4 5 3(3) 1(1) 0 $992,000 14 f, 11 r, 8 w, 2 BTW Immense, by Roberto Totals 14 6(5) 5(4) 0 $1,668,400 6s, BTW, $725,700 390 f, 18 BTW, 1.42 AEI Seattle Slew, 1974 Bold Reasoning, by Boldnesian Won At 2 7.53 AWD 17s, BTW, $1,208,726 Los Alamitos Futurity (G1, $350,500, 8.5f in 1:43.54, Aldebaran Light, 1996 1,050 f, 111 BTW, 3.69 AEI My Charmer, by Poker 5s, wnr, $18,660 dftg. Toews On Ice, I’malreadythere, Urlacher, Frank 12 f, 8 r, 5 w, 2 BTW Altair, 1991 Alydar, by Raise a Native Conversation, Hollywood Don, Sorryaboutnothing). Unraced A maiden special weight race at SA ($68,100, 8f in 8 f, 5 r, 4 w, 1 BTW Stellar Odyssey, by Northern Dancer ¼ 1:37.48, by 4 , dftg. Urlacher, Uninvited, Nightly Dixieland Band, 1980 Northern Dancer, by Nearctic News, Wise Tale, Bruntino, Recalibrating).
  • Graydar Oxbow

    Graydar Oxbow

    GRAYDAR OXBOW We have enjoyed tremendous success in standing/managing stallions over the last 20 years. KRIS S. SAINT BALLADO UNBRIDLED’S SONG 2 Dear Breeder, Taylor Made is a family owned and operated farm built on honesty, long-lasting relationships and horsemanship. Taylor Made Stallions’ mode of operation has always been – and remains – to focus on standing quality stallions that provide breeders great opportunities, whether they are breeding to race or sell. 2013 was a bounce-back year for commercial breeders, including a GSVRIVXYVRMRK/IIRIPERH7ITXIQFIVWEPIXLEXWE[KEMRWEGVSWWXLIFSEVHLMKLPMKLXIHF]WIZIR½KYVI]IEVPMRKWERHFSEWXMRK the third highest average of all time. The recent market results have proven that the well-conformed individual has re-emerged as the most important component SJEFY]IV´WWIPIGXMSRGVMXIVME,IVIEX8E]PSV1EHI[IQEOIWYVIIEGLSJSYVWXEPPMSRWVI¾IGXXLEXGSQTSRIRX3YVXIEQLEW been highly selective in providing the breeder a top group of well-conformed stallions whose progeny will be well received at the track and in the sales ring. Last year also marked a bittersweet landmark for one of the great sires of our time. While reaching 17 Grade 1 winners over his historic career in 2013, Unbridled’s Song passed away at the age of 20. Every person at Taylor Made has been touched by this amazing animal over the years. He leaves a lasting legacy that will never be forgotten across the industry he served so well. And yet there is much to look forward to in 2014. The legacy continues with our newest stallion, Graydar, the Grade 1-winning son of Unbridled’s Song. One of the most stunning physicals to come to the breeding shed in years, Graydar had a brilliant VEGIGEVIIVMRGPYHMRKEGSQQERHMRKZMGXSV]MRXLI(SRR,ERHMGET + EX+YPJWXVIEQ4EVO;IEVIGSR½HIRXLI[MPPFI a favorite among breeders as Taylor Made Stallions adds another chapter to its storied tradition.