PRDX3 (Human) Recombinant Protein

Total Page：16

File Type：pdf, Size：1020Kb

PRDX3 (Human) Recombinant glycerol). Protein Storage Instruction: Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to Catalog Number: P3487 -80°C. Regulation Status: For research use only (RUO) Aliquot to avoid repeated freezing and thawing. Product Description: Human PRDX3 (NP_006784, 63 Entrez GeneID: 10935 a.a. - 256 a.a.) partial recombinant protein expressed in Gene Symbol: PRDX3 Escherichia coli. Gene Alias: AOP-1, AOP1, MER5, MGC104387, Sequence: MGC24293, PRO1748, SP-22 MPAVTQHAPYFKGTAVVNGEFKDLSLDDFKGKYLVLF FYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDS Gene Summary: This gene encodes a protein with HFSHLAWINTPRKNGGLGHMNIALLSDLTKQISRDYGV antioxidant function and is localized in the LLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVEETL mitochondrion. This gene shows significant nucleotide RLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEY sequence similarity to the gene coding for the C22 FQKVNQ subunit of Salmonella typhimurium alkylhydroperoxide reductase. Expression of this gene product in E. coli Host: Escherichia coli deficient in the C22-subunit gene rescued resistance of Theoretical MW (kDa): 21.5 the bacteria to alkylhydroperoxide. The human and mouse genes are highly conserved, and they map to the Applications: Func, SDS-PAGE regions syntenic between mouse and human (See our web site product page for detailed applications chromosomes. Sequence comparisons with recently information) cloned mammalian homologues suggest that these genes consist of a family that is responsible for Protocols: See our web site at regulation of cellular proliferation, differentiation, and http://www.abnova.com/support/protocols.asp or product antioxidant functions. Two transcript variants encoding page for detailed protocols two different isoforms have been found for this gene. [provided by RefSeq] Form: Liquid Preparation Method: Escherichia coli expression system Purification: Conventional Chromatography Concentration: 1 mg/mL Purity: > 95% by SDS-PAGE Activity: Specific activity: approximately 82-83 pmole/min/ug. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX3 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide th Storage Buffer: In 20 mM Tris-HCl buffer, pH 8.0 (10% Page 1/1 Powered by TCPDF (www.tcpdf.org).

Copy Link

Recommended publications

Peroxiredoxins in Neurodegenerative Diseases
antioxidants Review Peroxiredoxins in Neurodegenerative Diseases Monika Szeliga Mossakowski Medical Research Centre, Department of Neurotoxicology, Polish Academy of Sciences, 5 Pawinskiego Street, 02-106 Warsaw, Poland; [email protected]; Tel.: +48-(22)-6086416 Received: 31 October 2020; Accepted: 27 November 2020; Published: 30 November 2020 Abstract: Substantial evidence indicates that oxidative/nitrosative stress contributes to the neurodegenerative diseases. Peroxiredoxins (PRDXs) are one of the enzymatic antioxidant mechanisms neutralizing reactive oxygen/nitrogen species. Since mammalian PRDXs were identified 30 years ago, their significance was long overshadowed by the other well-studied ROS/RNS defense systems. An increasing number of studies suggests that these enzymes may be involved in the neurodegenerative process. This article reviews the current knowledge on the expression and putative roles of PRDXs in neurodegenerative disorders such as Alzheimer’s disease, Parkinson’s disease and dementia with Lewy bodies, multiple sclerosis, amyotrophic lateral sclerosis and Huntington’s disease. Keywords: peroxiredoxin (PRDX); oxidative stress; nitrosative stress; neurodegenerative disease 1. Introduction Under physiological conditions, reactive oxygen species (ROS, e.g., superoxide anion, O2 -; · hydrogen peroxide, H O ; hydroxyl radical, OH; organic hydroperoxide, ROOH) and reactive nitrogen 2 2 · species (RNS, e.g., nitric oxide, NO ; peroxynitrite, ONOO-) are constantly produced as a result of normal · cellular metabolism and play a crucial role in signal transduction, enzyme activation, gene expression, and regulation of immune response [1]. The cells are endowed with several enzymatic (e.g., glutathione peroxidase (GPx); peroxiredoxin (PRDX); thioredoxin (TRX); catalase (CAT); superoxide dismutase (SOD)), and non-enzymatic (e.g., glutathione (GSH); quinones; flavonoids) antioxidant systems that minimize the levels of ROS and RNS.
[Show full text]
Oxidative Protein Biogenesis and Redox Regulation in the Mitochondrial Intermembrane Space
Cell Tissue Res (2017) 367:43–57 DOI 10.1007/s00441-016-2488-5 REVIEW Oxidative protein biogenesis and redox regulation in the mitochondrial intermembrane space Phanee Manganas1 & Lisa MacPherson1 & Kostas Tokatlidis1 Received: 2 June 2016 /Accepted: 5 August 2016 /Published online: 8 September 2016 # The Author(s) 2016. This article is published with open access at Springerlink.com Abstract Mitochondria are organelles that play a central role membrane (IM). The presence of these two membranes allows in cellular metabolism, as they are responsible for processes the formation of two aqueous subcompartments within the such as iron/sulfur cluster biogenesis, respiration and apopto- mitochondria, which are the intermembrane space (IMS) and sis. Here, we describe briefly the various protein import path- the matrix. Each one of these compartments is characterised ways for sorting of mitochondrial proteins into the different by a specific set of proteins that carry out specialised func- subcompartments, with an emphasis on the targeting to the tions. The majority of these proteins are encoded in the nucle- intermembrane space. The discovery of a dedicated redox- ar genome and synthesised in the cytosol, making it necessary controlled pathway in the intermembrane space that links pro- for the mitochondria to possess mechanisms through which to tein import to oxidative protein folding raises important ques- import all the proteins required for the correct function of the tions on the redox regulation of this process. We discuss the organelle (Neupert 1997). During the import process, the in- salient features of redox regulation in the intermembrane coming proteins are targeted to their correct location within space and how such mechanisms may be linked to the more the organelle by utilising a series of different import pathways.
[Show full text]
The Prognostic Values of the Peroxiredoxins Family in Ovarian Cancer
Bioscience Reports (2018) 38 BSR20180667 https://doi.org/10.1042/BSR20180667 Research Article The prognostic values of the peroxiredoxins family in ovarian cancer Saisai Li, Xiaoli Hu, Miaomiao Ye and Xueqiong Zhu Department of Obstetrics and Gynecology, the Second Afﬁliated Hospital of Wenzhou Medical University, Wenzhou 325027, Zhejiang, China Correspondence: Xueqiong Zhu ([email protected]) Purpose: Peroxiredoxins (PRDXs) are a family of antioxidant enzymes with six identified mammalian isoforms (PRDX1–6). PRDX expression is up-regulated in various types of solid tumors; however, individual PRDX expression, and its impact on prognostic value in ovarian cancer patients, remains unclear. Methods: PRDXs family protein expression profiles in normal ovarian tissues and ovarian cancer tissues were examined using the Human Protein Atlas database. Then, the prog- nostic roles of PRDX family members in several sets of clinical data (histology, pathological grades, clinical stages, and applied chemotherapy) in ovarian cancer patients were investi- gated using the Kaplan–Meier plotter. Results: PRDXs family protein expression in ovarian cancer tissues was elevated com- pared with normal ovarian tissues. Meanwhile, elevated expression of PRDX3, PRDX5, and PRDX6 mRNAs showed poorer overall survival (OS); PRDX5 and PRDX6 also predicted poor progression-free survival (PFS) for ovarian cancer patients. Furthermore, PRDX3 played sig- nificant prognostic roles, particularly in poor differentiation and late-stage serous ovarian cancer patients. Additionally, PRDX5 predicted a lower PFS in all ovarian cancer patients treated with Platin, Taxol, and Taxol+Platin chemotherapy. PRDX3 and PRDX6 also showed poor PFS in patients treated with Platin chemotherapy. Furthermore, PRDX3 and PRDX5 indicated lower OS in patients treated with these three chemotherapeutic agents.
[Show full text]
NNT Is a Key Regulator of Adrenal Redox Homeostasis and Steroidogenesis in Male Mice
236 1 Journal of E Meimaridou et al. NNT is key for adrenal redox 236:1 13–28 Endocrinology and steroid control RESEARCH NNT is a key regulator of adrenal redox homeostasis and steroidogenesis in male mice E Meimaridou1,*, M Goldsworthy2, V Chortis3,4, E Fragouli1, P A Foster3,4, W Arlt3,4, R Cox2 and L A Metherell1 1Centre for Endocrinology, William Harvey Research Institute, John Vane Science Centre, Queen Mary, University of London, London, UK 2MRC Harwell Institute, Genetics of Type 2 Diabetes, Mammalian Genetics Unit, Oxfordshire, UK 3Institute of Metabolism and Systems Research, University of Birmingham, Birmingham, UK 4Centre for Endocrinology, Diabetes and Metabolism, Birmingham Health Partners, Birmingham, UK *(E Meimaridou is now at School of Human Sciences, London Metropolitan University, London, UK) Correspondence should be addressed to E Meimaridou: [email protected] Abstract Nicotinamide nucleotide transhydrogenase, NNT, is a ubiquitous protein of the Key Words inner mitochondrial membrane with a key role in mitochondrial redox balance. NNT f RNA sequencing produces high concentrations of NADPH for detoxification of reactive oxygen species f nicotinamide nucleotide by glutathione and thioredoxin pathways. In humans, NNT dysfunction leads to an transhydrogenase adrenal-specific disorder, glucocorticoid deficiency. Certain substrains of C57BL/6 mice f redox homeostasis contain a spontaneously occurring inactivating Nnt mutation and display glucocorticoid f steroidogenesis Endocrinology deficiency along with glucose intolerance and reduced insulin secretion. To understand f ROS scavengers of the underlying mechanism(s) behind the glucocorticoid deficiency, we performed comprehensive RNA-seq on adrenals from wild-type (C57BL/6N), mutant (C57BL/6J) Journal and BAC transgenic mice overexpressing Nnt (C57BL/6JBAC).
[Show full text]
Differentiation and Cell Density Upregulate Cytochrome C Levels in Megakaryoblastic Cell Lines: Implications for Analysis of CYCS- Associated Thrombocytopenia
RESEARCH ARTICLE Differentiation and cell density upregulate cytochrome c levels in megakaryoblastic cell lines: Implications for analysis of CYCS- associated thrombocytopenia Lily Ong¤, Kirstin O. McDonald, Elizabeth C. Ledgerwood* Department of Biochemistry, School of Biomedical Sciences, University of Otago, Dunedin, New Zealand ¤ Current address: Institute of Molecular and Cell Biology, Singapore a1111111111 * [email protected] a1111111111 a1111111111 a1111111111 Abstract a1111111111 Mutations in the cytochrome c gene (CYCS) cause autosomal dominant thrombocytopenia by an unknown mechanism. While attempting to generate megakaryoblastic cell lines exog- enously expressing cytochrome c variants, we discovered that endogenous cytochrome c OPEN ACCESS expression increased both upon induction of differentiation with the phorbol ester phorbol Citation: Ong L, McDonald KO, Ledgerwood EC 12-myristate 13-acetate (PMA), and as cell density increased. A concomitant increase in (2017) Differentiation and cell density upregulate cytochrome c oxidase subunit II in response to PMA, but not cell higher cell density, sug- cytochrome c levels in megakaryoblastic cell lines: gests upregulation of the mitochondrial respiratory chain may be a specific feature of differ- Implications for analysis of CYCS-associated entiation. These results highlight the likely importance of cytochrome c in both differentiating thrombocytopenia. PLoS ONE 12(12): e0190433. https://doi.org/10.1371/journal.pone.0190433 and proliferating cells, and illustrate the unsuitability of megakaryoblastic lines for modeling CYCS-associated thrombocytopenia. Editor: Kathleen Freson, Katholieke Universiteit Leuven, BELGIUM Received: August 28, 2017 Accepted: December 14, 2017 Published: December 29, 2017 Introduction Copyright: © 2017 Ong et al. This is an open Cytochrome c is a ~12 kDa heme protein localized to the mitochondrial intermembrane space.
[Show full text]
Oxidants Are Dispensable for Hif1α Stability in Hypoxia
bioRxiv preprint doi: https://doi.org/10.1101/2020.05.05.079681; this version posted October 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder. All rights reserved. No reuse allowed without permission. Oxidants are dispensable for HIF1α stability in hypoxia Amit Kumar1, 2, 3, Manisha Vaish1, 4, Saravanan S. Karuppagounder1, 2, 3, Irina Gazaryan5, John W. Cave1, 2, 3, Anatoly A. Starkov2, 3, Elizabeth T. Anderson6, Sheng Zhang6, John T. Pinto7, Austin Rountree8, Wang Wang9, Ian R. Sweet8 and Rajiv R. Ratan1, 2, 3, * 1Burke Neurological Institute, White Plains, NY, 10605, USA 2Brain and Mind Research Institute and 3Department of Neurology, Weill Medical College of Cornell University, New York, 10016, USA 4Department of Pharmacological Sciences, Icahn School of Medicine at Mount Sinai, New York, 10029, USA 5Department of Anatomy and Cell Biology, New York Medical College, Valhalla, NY, 10595, USA 6Institute for Biotechnology, Cornell University, Ithaca, NY, 14853, USA 7Department of Biochemistry and Molecular Biology, New York Medical College, Valhalla, NY, 10595, USA 8Department of Medicine, University of Washington, Seattle, WA, 98108, USA 9Department of Pain and Anesthesiology, University of Washington, Seattle, WA, 98195, USA Correspondence should be addressed to: *Rajiv R. Ratan M.D., Ph.D. Burke Neurological Institute at Weill Cornell Medicine 785 Mamaroneck Avenue White Plains, NY, 10605, USA Email: [email protected] Phone: 914-597-2225 bioRxiv preprint doi: https://doi.org/10.1101/2020.05.05.079681; this version posted October 25, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder.
[Show full text]
Genomic Evidence of Reactive Oxygen Species Elevation in Papillary Thyroid Carcinoma with Hashimoto Thyroiditis
Endocrine Journal 2015, 62 (10), 857-877 Original Genomic evidence of reactive oxygen species elevation in papillary thyroid carcinoma with Hashimoto thyroiditis Jin Wook Yi1), 2), Ji Yeon Park1), Ji-Youn Sung1), 3), Sang Hyuk Kwak1), 4), Jihan Yu1), 5), Ji Hyun Chang1), 6), Jo-Heon Kim1), 7), Sang Yun Ha1), 8), Eun Kyung Paik1), 9), Woo Seung Lee1), Su-Jin Kim2), Kyu Eun Lee2)* and Ju Han Kim1)* 1) Division of Biomedical Informatics, Seoul National University College of Medicine, Seoul, Korea 2) Department of Surgery, Seoul National University Hospital and College of Medicine, Seoul, Korea 3) Department of Pathology, Kyung Hee University Hospital, Kyung Hee University School of Medicine, Seoul, Korea 4) Kwak Clinic, Okcheon-gun, Chungbuk, Korea 5) Department of Internal Medicine, Uijeongbu St. Mary’s Hospital, Uijeongbu, Korea 6) Department of Radiation Oncology, Seoul St. Mary’s Hospital, Seoul, Korea 7) Department of Pathology, Chonnam National University Hospital, Kwang-Ju, Korea 8) Department of Pathology, Samsung Medical Center, Sungkyunkwan University School of Medicine, Seoul, Korea 9) Department of Radiation Oncology, Korea Cancer Center Hospital, Korea Institute of Radiological and Medical Sciences, Seoul, Korea Abstract. Elevated levels of reactive oxygen species (ROS) have been proposed as a risk factor for the development of papillary thyroid carcinoma (PTC) in patients with Hashimoto thyroiditis (HT). However, it has yet to be proven that the total levels of ROS are sufficiently increased to contribute to carcinogenesis. We hypothesized that if the ROS levels were increased in HT, ROS-related genes would also be differently expressed in PTC with HT. To find differentially expressed genes (DEGs) we analyzed data from the Cancer Genomic Atlas, gene expression data from RNA sequencing: 33 from normal thyroid tissue, 232 from PTC without HT, and 60 from PTC with HT.
[Show full text]
Integrative Analysis the Characterization of Peroxiredoxins in Pan-Cancer
bioRxiv preprint doi: https://doi.org/10.1101/2020.10.09.334086; this version posted October 10, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Integrative Analysis the characterization of peroxiredoxins in pan-cancer Lei Gao1†, Jialin Meng2†, Chuang Yue3†, Xingyu Wu3, Quanxin Su3, Hao Wu3, Ze Zhang3, Qinzhou Yu2, Shenglin Gao3*, Song Fan2*, Li Zuo3* 1Department of Urology, the Second Hospital of Hebei Medical University, Shijiazhuang, China 2Department of Urology, The First Affiliated Hospital of Anhui Medical University, Institute of Urology, Anhui Medical University, Anhui Province Key Laboratory of Genitourinary Diseases, Anhui Medical University, Hefei, China 3 Department of Urology, The Affiliated Changzhou No. 2 People's Hospital of Nanjing Medical University, Changzhou, China † Authors contributed equally to the study. Correspondence: Shenglin Gao: [email protected] Song Fan: [email protected] Li Zuo: [email protected] 1 bioRxiv preprint doi: https://doi.org/10.1101/2020.10.09.334086; this version posted October 10, 2020. The copyright holder for this preprint (which was not certified by peer review) is the author/funder, who has granted bioRxiv a license to display the preprint in perpetuity. It is made available under aCC-BY-NC-ND 4.0 International license. Abstract Peroxiredoxins (PRDXs) are antioxidant enzymes protein family members that involves the process of several biological functions, such as differentiation, cell growth. Considerable evidence demonstrates that PRDXs play critical roles in the occurrence and development of carcinomas.
[Show full text]
Neutrophil Oxidative Stress Mediates Obesity-Associated Vascular Dysfunction and Metastatic Transmigration
ARTICLES https://doi.org/10.1038/s43018-021-00194-9 Neutrophil oxidative stress mediates obesity-associated vascular dysfunction and metastatic transmigration Sheri A. C. McDowell1,2, Robin B. E. Luo1,3, Azadeh Arabzadeh1, Samuel Doré1,3, Nicolas C. Bennett1,2, Valérie Breton1, Elham Karimi1, Morteza Rezanejad4, Ryan R. Yang1,5, Katherine D. Lach6, Marianne S. M. Issac 6, Bozena Samborska1, Lucas J. M. Perus1,2, Dan Moldoveanu1,7, Yuhong Wei1, Benoit Fiset1, Roni F. Rayes1,8, Ian R. Watson 1,7, Lawrence Kazak 1,7, Marie-Christine Guiot6,9, Pierre O. Fiset6, Jonathan D. Spicer 1,8,10, Andrew J. Dannenberg 11, Logan A. Walsh 1,3 ✉ and Daniela F. Quail 1,2,8 ✉ Metastasis is the leading cause of cancer-related deaths, and obesity is associated with increased breast cancer (BC) metasta- sis. Preclinical studies have shown that obese adipose tissue induces lung neutrophilia associated with enhanced BC metastasis to this site. Here we show that obesity leads to neutrophil-dependent impairment of vascular integrity through loss of endothe- lial adhesions, enabling cancer cell extravasation into the lung. Mechanistically, neutrophil-produced reactive oxygen species in obese mice increase neutrophil extracellular DNA traps (NETs) and weaken endothelial junctions, facilitating the influx of tumor cells from the peripheral circulation. In vivo treatment with catalase, NET inhibitors or genetic deletion of Nos2 reversed this effect in preclinical models of obesity. Imaging mass cytometry of lung metastasis samples from patients with cancer revealed an enrichment in neutrophils with low catalase levels correlating with elevated body mass index. Our data provide insights into potentially targetable mechanisms that underlie the progression of BC in the obese population.
[Show full text]
Genetic Variation and Gene Expression in Antioxidant Related
Chronic obstructive pulmonary disease Genetic variation and gene expression in antioxidant Thorax: first published as 10.1136/thx.2007.086199 on 19 June 2008. Downloaded from related enzymes and risk of COPD: a systematic review A R Bentley, P Emrani, P A Cassano c Additional Methods and ABSTRACT interindividual differences in the response to Results data are published Background: Observational epidemiological studies of cigarette smoke. online only at http://thorax.bmj. com/content/vol63/issue11 dietary antioxidant intake, serum antioxidant concentra- This review focuses on genes related to anti- tion and lung outcomes suggest that lower levels of oxidant activity, as oxidant-rich cigarette smoke Division of Nutritional Sciences, antioxidant defences are associated with decreased lung Cornell University, Ithaca, New strains the antioxidant defences of the lungs, York, USA function. Another approach to understanding the role of leading to direct tissue damage and contributing oxidant/antioxidant imbalance in the risk of chronic to the inflammation and antiprotease inactivation Correspondence to: obstructive pulmonary disease (COPD) is to investigate seen in COPD. This hypothesis is supported by Dr P A Cassano, Division of the role of genetic variation in antioxidant enzymes, and Nutritional Sciences, 209 epidemiological studies associating low dietary Savage Hall, Cornell University, indeed family based studies suggest a heritable antioxidant intake and serum antioxidant concen- Ithaca, NY 14853, USA; pac6@ component to lung disease. Many studies of the genes tration with decreased lung function4–9 and cornell.edu encoding antioxidant enzymes have considered COPD or increased COPD mortality risk.10 COPD related outcomes, and a systematic review is Many genetic association studies and compara- Received 25 June 2007 needed to summarise the evidence to date, and to Accepted 22 May 2008 tive expression studies investigated the relation Published Online First provide insights for further research.
[Show full text]
The NRF2, Thioredoxin, and Glutathione System in Tumorigenesis and Anticancer Therapies
antioxidants Review The NRF2, Thioredoxin, and Glutathione System in Tumorigenesis and Anticancer Therapies Morana Jaganjac y , Lidija Milkovic y , Suzana Borovic Sunjic and Neven Zarkovic * Laboratory for Oxidative Stress, Division of Molecular Medicine, Rudjer Boskovic Institute, Bijenicka 54, 10000 Zagreb, Croatia; [email protected] (M.J.); [email protected] (L.M.); [email protected] (S.B.S.) * Correspondence: [email protected]; Tel.: +385-1-457-1234 These authors contributed equally to this work. y Received: 27 October 2020; Accepted: 17 November 2020; Published: 19 November 2020 Abstract: Cancer remains an elusive, highly complex disease and a global burden. Constant change by acquired mutations and metabolic reprogramming contribute to the high inter- and intratumor heterogeneity of malignant cells, their selective growth advantage, and their resistance to anticancer therapies. In the modern era of integrative biomedicine, realizing that a personalized approach could benefit therapy treatments and patients’ prognosis, we should focus on cancer-driving advantageous modifications. Namely, reactive oxygen species (ROS), known to act as regulators of cellular metabolism and growth, exhibit both negative and positive activities, as do antioxidants with potential anticancer effects. Such complexity of oxidative homeostasis is sometimes overseen in the case of studies evaluating the effects of potential anticancer antioxidants. While cancer cells often produce more ROS due to their increased growth-favoring demands, numerous conventional anticancer therapies exploit this feature to ensure selective cancer cell death triggered by excessive ROS levels, also causing serious side effects. The activation of the cellular NRF2 (nuclear factor erythroid 2 like 2) pathway and induction of cytoprotective genes accompanies an increase in ROS levels.
[Show full text]
Proteomic Studies of Multiple Myeloma in RPMI8226 Cell Line Treated with Bendamustine
JBUON 2013; 18(4): 996-1005 ISSN: 1107-0625, online ISSN: 2241-6293 • www.jbuon.com E-mail: [email protected] ORIGINAL ARTICLE Proteomic studies of multiple myeloma in RPMI8226 cell line treated with bendamustine Chenglong Sun*, Juan Li*, Jingli Gu, Junru Liu, Beihui Huang Department of Hematology, First Affiliated Hospital of Sun Yat-sen University, Guangzhou, 510080 China *Equal contributors in this study Summary ation of RPMI8226 cells in a concentration-dependent and time-dependent manner. Proteomic approach was Multiple myeloma (MM) is a malignant and in- Purpose: performed to identify 30 differentially expressed proteins curable neoplasm of plasma cells that accumulate in the in RPMI8226 cells upon bendamustine treatment, which bone marrow. Bendamustine, an antitumor agent including included 15 up-regulated and 15 down-regulated proteins. double property of alkylating agent and purine analogues, Of these, protein disulfide isomerase A3 (PDIA3) and cy- displayed clinical antitumor activity in patients with MM. tokine-induced apoptosis inhibitor 1 (CPIN1), were selected However, the precise mechanism of action of bendamustine for further studies. has not been completely elucidated. Conclusion: These results implicate PDIA3 and CPIN1 as Methods: In this study, we established the cell model of potential molecular targets for drug intervention in MM bendamustine-induced MM RPMI8226 cell apoptosis, and used two dimensional differential in-gel electrophoresis and thus provide novel insights into the mechanisms of an- (2D-DIGE) proteomics to analyze the bendamustine-in- titumor activity of bendamustine. duced protein alterations. Results: Our results revealed that compared with control Key words: apoptosis, bendamustine, multiple myeloma, group, bendamustine significantly inhibited the prolifer- proteomics Introduction and purine analogue, has shown distinctive clin- ical activity against various cancers.
[Show full text]