H00009950-M01 規格 : [ 100 Ug ] List All

GOLGA5 monoclonal antibody (M01), clone 6B3

Catalog # : H00009950-M01 規格 : [ 100 ug ] List All

Specification Application Image

Product Mouse monoclonal antibody raised against a partial recombinant Western Blot (Cell lysate) Description: GOLGA5.

Immunogen: GOLGA5 (NP_005104, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence: SWFVDLAGKAEDLLNRVDQGAATALSRKDNASNIYSKNTDYTELHQQNT DLIYQTGPKSTYISSAADNIRNQKATILAGTANVKVGSRTPVEASHPVE enlarge Western Blot (Transfected Host: Mouse lysate)

Reactivity: Human

Isotype: IgG2a Kappa

Quality Control Antibody Reactive Against Recombinant Protein. Testing: enlarge Western Blot (Recombinant protein)

Sandwich ELISA (Recombinant protein)

enlarge Western Blot detection against Immunogen (36.52 KDa) . ELISA Storage Buffer: In 1x PBS, pH 7.4 RNAi Knockdown (Antibody Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. validated) Instruction:

MSDS: Download

Datasheet: Download enlarge Applications

Western Blot (Cell lysate)

Page 1 of 3 2016/5/22 GOLGA5 monoclonal antibody (M01), clone 6B3 Western Blot analysis of GOLGA5 expression in K-562 ( Cat # L009V1 ). Protocol Download

Western Blot (Transfected lysate)

Western Blot analysis of GOLGA5 expression in transfected 293T cell line by GOLGA5 monoclonal antibody (M01), clone 6B3.

Lane 1: GOLGA5 transfected lysate(83 KDa). Lane 2: Non-transfected lysate. Protocol Download

Western Blot (Recombinant protein) Protocol Download

Sandwich ELISA (Recombinant protein)

Detection limit for recombinant GST tagged GOLGA5 is approximately 0.1ng/ml as a capture antibody. Protocol Download

ELISA

RNAi Knockdown (Antibody validated)

Page 2 of 3 2016/5/22 Western blot analysis of GOLGA5 over-expressed 293 cell line, cotransfected with GOLGA5 Validated Chimera RNAi ( Cat # H00009950-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with GOLGA5 monoclonal antibody (M01), clone 6B3 (Cat # H00009950-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. Protocol Download

Gene Information

Entrez GeneID: 9950

GeneBank NM_005113 Accession#:

Protein NP_005104 Accession#:

Gene Name: GOLGA5

Gene Alias: GOLIM5,RFG5,ret-II

Gene golgi autoantigen, golgin subfamily a, 5 Description:

Omim ID: 188550, 606918

Gene Ontology: Hyperlink

Gene Summary: The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes a member of the golgin family of proteins, whose members localize to the Golgi. This protein is a coiled-coil membrane protein that has been postulated to play a role in vesicle tethering and docking. Translocations involving this gene and the ret proto-oncogene have been found in tumor tissues; the chimeric sequences have been designated RET-II and PTC5. [provided by RefSeq

Other Golgi autoantigen, golgin subfamily a, 5,cell proliferation-inducing gene Designations: 31,golgi integral membrane protein 5,golgin-84,ret-fused gene 5

Page 3 of 3 2016/5/22